Citrus Sinensis ID: 035490


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
SHFHDPIGFTTSLNNSINLGQWTGVTCAHRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHGEIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKLQKLSIRRNLLT
cccccccccccccccccccEEcEEEEcccccccEEEEEccccccccEEccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccHHccccccEEEccccEEEEEccccccccccccEEEccccccc
cccccccccccccccccccccEEEEEcccccccEEEEEccccccccccccccHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccccHcccccccEEEcccccccccccHHHcccccccEEEccccccc
shfhdpigfttslnnsinlgqwtgvtcahrhQKVAKLDLRKYQSLRgflspyvgnlsflrhiniadnsfhgeipreignlfsletlmitdnsfsglmptnlsrcsNLIAFHAnnnklageiPEEIGCLFKLQKLSIRRNLLT
shfhdpigFTTSLNNSINLGQWTGVTCAHRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHGEIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGclfklqklsirrnllt
SHFHDPIGFTTSLNNSINLGQWTGVTCAHRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHGEIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKLQKLSIRRNLLT
******IGFTTSLNNSINLGQWTGVTCAHRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHGEIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKLQKLSI******
SHFHDPIGFTTSLNNSINLGQWTGVTCAHRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHGEIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKLQKLSIRRNLLT
SHFHDPIGFTTSLNNSINLGQWTGVTCAHRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHGEIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKLQKLSIRRNLLT
****DPIGFTTSLNNSINLGQWTGVTCAHRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHGEIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKLQKLSIR*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SHFHDPIGFTTSLNNSINLGQWTGVTCAHRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHGEIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKLQKLSIRRNLLT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query142 2.2.26 [Sep-21-2011]
Q9SD62 1025 Putative receptor-like pr yes no 0.915 0.126 0.488 4e-23
C0LGT6 1031 LRR receptor-like serine/ no no 0.922 0.127 0.424 3e-22
C0LGP4 1010 Probable LRR receptor-lik no no 0.901 0.126 0.395 4e-20
O49318 1124 Probable leucine-rich rep no no 0.845 0.106 0.398 3e-18
Q9FL28 1173 LRR receptor-like serine/ no no 0.845 0.102 0.370 4e-16
C0LGH8 664 Probable LRR receptor-lik no no 0.971 0.207 0.314 2e-15
C0LGF5 1072 Probable LRR receptor-lik no no 0.767 0.101 0.4 2e-15
Q9LVP0 1102 Probable leucine-rich rep no no 0.880 0.113 0.362 4e-15
O22938 890 Leucine-rich repeat recep no no 0.873 0.139 0.349 1e-14
Q9LYN8 1192 Leucine-rich repeat recep no no 0.690 0.082 0.396 2e-14
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function desciption
 Score =  106 bits (265), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 64/131 (48%), Positives = 87/131 (66%), Gaps = 1/131 (0%)

Query: 12  SLNNSINLGQWTGVTCAHRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHG 71
           S N+S+ L  WTGV C  +H++V  +DL   + L G +SP+VGNLSFLR +N+ADN FHG
Sbjct: 61  SWNDSLPLCSWTGVKCGLKHRRVTGVDLGGLK-LTGVVSPFVGNLSFLRSLNLADNFFHG 119

Query: 72  EIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKL 131
            IP E+GNLF L+ L +++N F G++P  LS CS+L     ++N L   +P E G L KL
Sbjct: 120 AIPSEVGNLFRLQYLNMSNNLFGGVIPVVLSNCSSLSTLDLSSNHLEQGVPLEFGSLSKL 179

Query: 132 QKLSIRRNLLT 142
             LS+ RN LT
Sbjct: 180 VLLSLGRNNLT 190





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGH8|Y1634_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g63430 OS=Arabidopsis thaliana GN=At1g63430 PE=1 SV=1 Back     alignment and function description
>sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|O22938|Y2182_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 OS=Arabidopsis thaliana GN=At2g41820 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
225455118 1009 PREDICTED: probable LRR receptor-like se 0.971 0.136 0.5 3e-31
147810637 1009 hypothetical protein VITISV_020143 [Viti 0.971 0.136 0.5 3e-31
224113119 1065 predicted protein [Populus trichocarpa] 0.943 0.125 0.488 8e-31
357483211 1018 LRR receptor-like serine/threonine-prote 0.971 0.135 0.503 1e-30
224127492 1022 predicted protein [Populus trichocarpa] 0.943 0.131 0.503 5e-30
359482058 1040 PREDICTED: probable LRR receptor-like se 0.971 0.132 0.496 7e-30
255571869 721 serine-threonine protein kinase, plant-t 0.971 0.191 0.503 7e-30
147853780 1904 hypothetical protein VITISV_030954 [Viti 0.971 0.072 0.496 7e-30
255585471 963 serine-threonine protein kinase, plant-t 0.971 0.143 0.510 1e-29
357516993 1010 Receptor protein kinase-like protein [Me 0.964 0.135 0.5 1e-29
>gi|225455118|ref|XP_002268823.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 100/140 (71%), Gaps = 2/140 (1%)

Query: 4   HDPIGFTTSLNNSINLGQWTGVTCAHRH-QKVAKLDLRKYQSLRGFLSPYVGNLSFLRHI 62
            DP+G  +S N+S++  +W+GV C+ RH  +V KL+L  Y  L G LSP++GNL+FLR I
Sbjct: 46  QDPLGMLSSWNDSLHFCRWSGVYCSRRHVHRVTKLNLFSY-GLVGSLSPHIGNLTFLRTI 104

Query: 63  NIADNSFHGEIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIP 122
            + +NSFHG++P EIG LF L+ L++++NSF G +PTNL+ CS L   +  +NKL G+IP
Sbjct: 105 VLQNNSFHGKVPSEIGGLFRLQVLVLSNNSFEGKVPTNLTYCSELRVLNLIDNKLEGKIP 164

Query: 123 EEIGCLFKLQKLSIRRNLLT 142
           EE+G L KL+ L + RN LT
Sbjct: 165 EELGSLSKLKALGLTRNNLT 184




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147810637|emb|CAN63094.1| hypothetical protein VITISV_020143 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224113119|ref|XP_002316397.1| predicted protein [Populus trichocarpa] gi|222865437|gb|EEF02568.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357483211|ref|XP_003611892.1| LRR receptor-like serine/threonine-protein kinase FEI [Medicago truncatula] gi|355513227|gb|AES94850.1| LRR receptor-like serine/threonine-protein kinase FEI [Medicago truncatula] Back     alignment and taxonomy information
>gi|224127492|ref|XP_002329291.1| predicted protein [Populus trichocarpa] gi|222870745|gb|EEF07876.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482058|ref|XP_002274540.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255571869|ref|XP_002526877.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223533776|gb|EEF35508.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147853780|emb|CAN83822.1| hypothetical protein VITISV_030954 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255585471|ref|XP_002533428.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526716|gb|EEF28948.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357516993|ref|XP_003628785.1| Receptor protein kinase-like protein [Medicago truncatula] gi|355522807|gb|AET03261.1| Receptor protein kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.915 0.126 0.488 2.4e-26
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.915 0.128 0.450 1.7e-22
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.915 0.126 0.427 5.9e-22
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.880 0.123 0.428 1.1e-20
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.901 0.126 0.395 2.1e-19
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.845 0.147 0.409 8.3e-19
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.943 0.119 0.382 2.8e-18
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.845 0.117 0.404 5.2e-18
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.964 0.116 0.354 8.6e-16
TAIR|locus:2036636 632 NIK3 "NSP-interacting kinase 3 0.880 0.197 0.375 1.2e-15
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 309 (113.8 bits), Expect = 2.4e-26, P = 2.4e-26
 Identities = 64/131 (48%), Positives = 87/131 (66%)

Query:    12 SLNNSINLGQWTGVTCAHRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHG 71
             S N+S+ L  WTGV C  +H++V  +DL   + L G +SP+VGNLSFLR +N+ADN FHG
Sbjct:    61 SWNDSLPLCSWTGVKCGLKHRRVTGVDLGGLK-LTGVVSPFVGNLSFLRSLNLADNFFHG 119

Query:    72 EIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKL 131
              IP E+GNLF L+ L +++N F G++P  LS CS+L     ++N L   +P E G L KL
Sbjct:   120 AIPSEVGNLFRLQYLNMSNNLFGGVIPVVLSNCSSLSTLDLSSNHLEQGVPLEFGSLSKL 179

Query:   132 QKLSIRRNLLT 142
               LS+ RN LT
Sbjct:   180 VLLSLGRNNLT 190


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036636 NIK3 "NSP-interacting kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00037121001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (1009 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-04
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
 Score = 74.9 bits (184), Expect = 1e-16
 Identities = 37/109 (33%), Positives = 59/109 (54%), Gaps = 5/109 (4%)

Query: 22  WTGVTCA----HRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHGEIPREI 77
           W+G  C          +  L L   Q LRGF+   +  L  L+ IN++ NS  G IP  +
Sbjct: 404 WSGADCQFDSTKGKWFIDGLGLDN-QGLRGFIPNDISKLRHLQSINLSGNSIRGNIPPSL 462

Query: 78  GNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIG 126
           G++ SLE L ++ NSF+G +P +L + ++L   + N N L+G +P  +G
Sbjct: 463 GSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSLSGRVPAALG 511


Length = 623

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 142
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.76
PLN03150623 hypothetical protein; Provisional 99.64
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.55
KOG0617 264 consensus Ras suppressor protein (contains leucine 99.4
KOG0617 264 consensus Ras suppressor protein (contains leucine 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.2
PLN03150 623 hypothetical protein; Provisional 99.2
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.17
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.13
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.99
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.91
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.9
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.88
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 98.82
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.7
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.69
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.65
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.65
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.62
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.62
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.62
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.57
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.53
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.51
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.51
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.37
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.32
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.27
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.25
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.24
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.22
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.22
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.18
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.1
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.1
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.98
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.84
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.73
KOG1644 233 consensus U2-associated snRNP A' protein [RNA proc 97.65
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.64
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.49
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.44
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.44
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.41
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 97.25
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 97.24
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.08
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 96.81
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.58
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.48
PRK15386 426 type III secretion protein GogB; Provisional 96.33
PRK15386 426 type III secretion protein GogB; Provisional 96.33
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.32
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.69
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.56
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.16
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.91
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 94.88
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.64
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 93.56
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.35
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.27
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.07
smart0037026 LRR Leucine-rich repeats, outliers. 93.01
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.01
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.59
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.94
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 89.74
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.72
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 85.25
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 83.58
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.27
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.76  E-value=4.3e-18  Score=136.63  Aligned_cols=137  Identities=29%  Similarity=0.569  Sum_probs=96.5

Q ss_pred             ccCCCCCcccCcCCCCCceeeeeEecCCCCcEEEEEcCCCCcceeecCccccCccccceeeeccCcceeeCChhhc-CCC
Q 035490            3 FHDPIGFTTSLNNSINLGQWTGVTCAHRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHGEIPREIG-NLF   81 (142)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~l~~L~l~~n~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~-~l~   81 (142)
                      +.||...+..|+...++|.|.|++|... .+++.|++++|. +.+..+..+..+++|+.|++++|.+++.+|..+. .+.
T Consensus        41 ~~~~~~~~~~w~~~~~~c~w~gv~c~~~-~~v~~L~L~~~~-i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~  118 (968)
T PLN00113         41 INDPLKYLSNWNSSADVCLWQGITCNNS-SRVVSIDLSGKN-ISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSS  118 (968)
T ss_pred             CCCCcccCCCCCCCCCCCcCcceecCCC-CcEEEEEecCCC-ccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCC
Confidence            4577778889988889999999999754 689999999988 8888888888888888888888888877776554 566


Q ss_pred             CCcEEEccCccccc----------------------CCCccccCCCCCcEEEccCceeeecCchhhhCCCCCCEEEcccc
Q 035490           82 SLETLMITDNSFSG----------------------LMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKLQKLSIRRN  139 (142)
Q Consensus        82 ~L~~l~l~~n~~~~----------------------~~p~~~~~l~~L~~l~l~~n~~~~~~p~~~~~~~~L~~L~l~~n  139 (142)
                      +|+.+++++|.+.+                      .+|..+..+++|+.|++++|.+.+.+|..++.+++|+.|++++|
T Consensus       119 ~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n  198 (968)
T PLN00113        119 SLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASN  198 (968)
T ss_pred             CCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCC
Confidence            66666666665544                      34444455555555555555555455555555555555555555


Q ss_pred             cC
Q 035490          140 LL  141 (142)
Q Consensus       140 ~i  141 (142)
                      .+
T Consensus       199 ~l  200 (968)
T PLN00113        199 QL  200 (968)
T ss_pred             CC
Confidence            43



>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-12
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-12
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-08
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 40.8 bits (94), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 32/116 (27%), Positives = 50/116 (43%), Gaps = 1/116 (0%) Query: 27 CAHRHQKVAKLDLRKYQSLRGFLSPYVGNLSFLRHINIADNSFHGEIPREIGNLFSLETL 86 C + + +L L+ G + P + N S L ++++ N G IP +G+L L L Sbjct: 386 CQNPKNTLQELYLQN-NGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDL 444 Query: 87 MITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKLQKLSIRRNLLT 142 + N G +P L L + N L GEIP + L +S+ N LT Sbjct: 445 KLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLT 500
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-30
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-10
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-08
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  108 bits (273), Expect = 6e-30
 Identities = 39/148 (26%), Positives = 60/148 (40%), Gaps = 7/148 (4%)

Query: 1   SHFHDPIGFTTSLNNSINL--GQWTGVTCAHRHQ--KVAKLDLRKYQ-SLRGFLSPYVGN 55
               +P   + S   + +     W GV C    Q  +V  LDL          +   + N
Sbjct: 16  KDLGNPTTLS-SWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLAN 74

Query: 56  LSFLRHINIAD-NSFHGEIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANN 114
           L +L  + I   N+  G IP  I  L  L  L IT  + SG +P  LS+   L+    + 
Sbjct: 75  LPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSY 134

Query: 115 NKLAGEIPEEIGCLFKLQKLSIRRNLLT 142
           N L+G +P  I  L  L  ++   N ++
Sbjct: 135 NALSGTLPPSISSLPNLVGITFDGNRIS 162


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.82
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.74
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.73
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.7
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.67
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.67
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.67
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.65
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.65
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.64
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.64
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 99.64
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.63
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.62
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.61
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.6
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.6
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.6
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.6
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.6
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.6
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.59
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.59
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.59
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.59
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.58
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.58
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.58
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.57
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.57
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.57
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.56
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.56
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.56
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.56
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.55
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.54
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.54
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.54
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.53
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.53
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.53
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.53
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.53
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.53
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.52
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.52
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.51
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.51
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.51
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.51
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.51
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.48
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.48
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.48
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.47
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.46
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.45
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.45
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.45
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.45
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.45
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.44
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.44
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.44
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.41
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.41
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.41
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.41
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.41
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.4
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.4
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.39
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.39
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.39
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.39
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.39
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.37
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.35
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.34
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.34
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.32
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 99.32
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.28
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.27
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.25
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.24
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.23
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.22
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 99.22
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.21
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 99.2
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.11
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.03
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.02
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.01
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.95
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.93
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.79
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.65
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.6
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.52
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.38
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.31
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.19
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.18
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.18
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.17
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.93
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.4
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.29
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.91
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.66
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.62
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.47
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.22
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.14
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.66
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.4
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.89  E-value=3.6e-23  Score=146.36  Aligned_cols=137  Identities=28%  Similarity=0.471  Sum_probs=119.6

Q ss_pred             ccCCCCCcccCcCCCCCce--eeeeEecCCC--CcEEEEEcCCCCccee--ecCccccCccccceeeecc-CcceeeCCh
Q 035490            3 FHDPIGFTTSLNNSINLGQ--WTGVTCAHRH--QKVAKLDLRKYQSLRG--FLSPYVGNLSFLRHINIAD-NSFHGEIPR   75 (142)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~--~~g~~~~~~~--~~l~~L~l~~n~~~~~--~~~~~l~~l~~L~~L~l~~-n~l~~~~~~   75 (142)
                      +.||. .+.+|..++++|.  |.|++|....  .+++.|++++|. +.+  .+|..+..+++|++|++++ |.+.+.+|.
T Consensus        18 ~~~~~-~l~~W~~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~-l~~~~~~~~~l~~l~~L~~L~L~~~n~l~~~~p~   95 (313)
T 1ogq_A           18 LGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLN-LPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPP   95 (313)
T ss_dssp             TTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCC-CSSCEECCGGGGGCTTCSEEEEEEETTEESCCCG
T ss_pred             cCCcc-cccCCCCCCCCCcCCCcceEeCCCCCCceEEEEECCCCC-ccCCcccChhHhCCCCCCeeeCCCCCcccccCCh
Confidence            34565 6888988888998  9999998654  789999999999 988  8889999999999999994 889888898


Q ss_pred             hhcCCCCCcEEEccCcccccCCCccccCCCCCcEEEccCceeeecCchhhhCCCCCCEEEcccccC
Q 035490           76 EIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKLQKLSIRRNLL  141 (142)
Q Consensus        76 ~~~~l~~L~~l~l~~n~~~~~~p~~~~~l~~L~~l~l~~n~~~~~~p~~~~~~~~L~~L~l~~n~i  141 (142)
                      .+..+++|+.++++.|.+++.+|..+..+++|+.|++++|.+++.+|..+..+++|+.|++++|.|
T Consensus        96 ~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l  161 (313)
T 1ogq_A           96 AIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRI  161 (313)
T ss_dssp             GGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCC
T ss_pred             hHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcCCcc
Confidence            899999999999999999878888888899999999999999877888888888999999988876



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 142
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-04
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 46.1 bits (108), Expect = 3e-07
 Identities = 17/85 (20%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 55  NLSFLRHINIADNSFHGEIPREIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANN 114
           NL  L ++ +  N+     P  + +L  L+ L   +N  S    ++L+  +N+    A +
Sbjct: 305 NLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGH 360

Query: 115 NKLAGEIPEEIGCLFKLQKLSIRRN 139
           N+++   P  +  L ++ +L +   
Sbjct: 361 NQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.64
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.51
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.51
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.46
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.46
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.44
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.42
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.36
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.33
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.32
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.29
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.27
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.2
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.19
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.12
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.09
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.06
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.99
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.98
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.92
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.91
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.78
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.74
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.34
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.18
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.14
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.13
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.11
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.82
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.65
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.56
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.16
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.74
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.87  E-value=1.9e-22  Score=140.67  Aligned_cols=138  Identities=28%  Similarity=0.466  Sum_probs=121.3

Q ss_pred             CccCCCCCcccCcCCCCCc--eeeeeEecCCC--CcEEEEEcCCCCccee--ecCccccCccccceeeecc-CcceeeCC
Q 035490            2 HFHDPIGFTTSLNNSINLG--QWTGVTCAHRH--QKVAKLDLRKYQSLRG--FLSPYVGNLSFLRHINIAD-NSFHGEIP   74 (142)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~--~~~g~~~~~~~--~~l~~L~l~~n~~~~~--~~~~~l~~l~~L~~L~l~~-n~l~~~~~   74 (142)
                      ++.|| .++..|..++|+|  .|.|++|....  .+++.|+++++. +.+  .+|+.+..+++|++|++++ |.++|.+|
T Consensus        17 ~~~~~-~~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~-l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP   94 (313)
T d1ogqa_          17 DLGNP-TTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLN-LPKPYPIPSSLANLPYLNFLYIGGINNLVGPIP   94 (313)
T ss_dssp             HTTCC-GGGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCC-CSSCEECCGGGGGCTTCSEEEEEEETTEESCCC
T ss_pred             HCCCC-CcCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCC-CCCCCCCChHHhcCccccccccccccccccccc
Confidence            34565 3688999888998  49999998654  479999999998 876  4789999999999999986 89999999


Q ss_pred             hhhcCCCCCcEEEccCcccccCCCccccCCCCCcEEEccCceeeecCchhhhCCCCCCEEEcccccC
Q 035490           75 REIGNLFSLETLMITDNSFSGLMPTNLSRCSNLIAFHANNNKLAGEIPEEIGCLFKLQKLSIRRNLL  141 (142)
Q Consensus        75 ~~~~~l~~L~~l~l~~n~~~~~~p~~~~~l~~L~~l~l~~n~~~~~~p~~~~~~~~L~~L~l~~n~i  141 (142)
                      +.+..+++|+++++++|++.+..+..+..+..|+.++++.|.+.+.+|..+..++.++.+++++|.+
T Consensus        95 ~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l  161 (313)
T d1ogqa_          95 PAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRI  161 (313)
T ss_dssp             GGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCC
T ss_pred             cccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecccccc
Confidence            9999999999999999999987778888889999999999999888888899999999999998865



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure