Citrus Sinensis ID: 035521

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MGRLGHDPHIQHFSHLHLLELSNPQTLNTTTSCSACKLQPSGLMYTCKPCNFTLHVSCTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCATKPLTLIHQSHPHQLQLTFDPPYYTEGFSCDICKKVGSAHWLYRCSLCEFDAHLDCAANLLAQPIHTQHQYSLNPGAINQMQHGNRQNAMGMNNNQFFSQRQSMGALPLQNNSYNQAPAPAAAAAGTVNPLMDALVQGLVQGAAEQFGQTIVQSLINDGGNNCDPANDSGGDLSVNGIFGDSGTQN
cccccccccEEEcccccccEEEccccccccccccccccccccccEEEccccccccHHHccccccccccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccccccccccEEEEccccccccEEccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccHHHHccccccccEEEccccccHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEccccccc
cccEcccccEEcccccccEEEccccccccccEcccccccccccEEEEccccEEEEHHHccccccccccccccccEEEEEcccccccccEEccccccccccEEEEccccEEEEHHHcccccccccccccccEEEEEcccccccccEEcccccccccccEEEEEcccEEEEHHHccccccccccccccEEEEcccccccccccccEEEEEccccEEEEccccccccEEEEcccccEEEEEccccccccccccEEEEEcccccccccccccEEEEEccccccccccccccccEEccEEccccccc
mgrlghdphiqhfshlhllelsnpqtlntttscsacklqpsglmytckpcnftlhvsctqmpqlithpshpahslslvptpiypagifncdgcgrqghgfsyhcthcdfdlhilcatkpltlihqshphqlqltfdppyytegfscdickkvgsahwlyrcslcefdAHLDCAANLlaqpihtqhqyslnpgainqmqhgnrqnamgmnnnqFFSQrqsmgalplqnnsynqapapaaaaagtvNPLMDALVQGLVQGAAEQFGQTIVQSLIndggnncdpandsggdlsvngifgdsgtqn
MGRLGHDPHIQHFSHLHLLELSNPQTLNTTTSCSACKLQPSGLMYTCKPCNFTLHVSCTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCATKPLTLIHQSHPHQLQLTFDPPYYTEGFSCDICKKVGSAHWLYRCSLCEFDAHLDCAANLLAQPIHTQHQYSLNPGAINQMQHGNRQNAMGMNNNQFFSQRQSMGALPLQNNSYNQAPAPAAAAAGTVNPLMDALVQGLVQGAAEQFGQTIVQSLINDGGNNCDPANDSGGDLSVNGIFGDSGTQN
MGRLGHDPHIQHFSHLHLLELSNPQTLNTTTSCSACKLQPSGLMYTCKPCNFTLHVSCTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCATKPLTLIHQSHPHQLQLTFDPPYYTEGFSCDICKKVGSAHWLYRCSLCEFDAHLDCAANLLAQPIHTQHQYSLNPGAINQMQHGNRQNAMGMNNNQFFSQRQSMGALPLQNNSYNQapapaaaaaGTVNPLMDALVQGLVQGAAEQFGQTIVQSLINDGGNNCDPANDSGGDLSVNGIFGDSGTQN
*********IQHFSHLHLLELSNPQTLNTTTSCSACKLQPSGLMYTCKPCNFTLHVSCTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCATKPLTLIHQSHPHQLQLTFDPPYYTEGFSCDICKKVGSAHWLYRCSLCEFDAHLDCAANLLAQPIHTQHQYSL********************************************************PLMDALVQGLVQGAAEQFGQTIVQSLIND****************************
*****HDPHIQHFSHLHLLELSNPQTLNTTTSCSACKLQPSGLMYTCKPCNFTLHVSCTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCATKPLTLIHQSHPHQLQLTFDPPYYTEGFSCDICKKVGSAHWLYRCSLCEFDAHLDCAANLLAQPIHTQHQYSLNPGAINQMQHGNRQNAMGMNNNQFFSQRQSMGALPLQNNSYNQAPAP*****GTVNPLMDALVQGLVQGAAEQFGQT*****************************G******
MGRLGHDPHIQHFSHLHLLELSNPQTLNTTTSCSACKLQPSGLMYTCKPCNFTLHVSCTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCATKPLTLIHQSHPHQLQLTFDPPYYTEGFSCDICKKVGSAHWLYRCSLCEFDAHLDCAANLLAQPIHTQHQYSLNPGAINQMQHGNRQNAMGMNNNQFFSQRQSMGALPLQNNSYNQAPAPAAAAAGTVNPLMDALVQGLVQGAAEQFGQTIVQSLINDGGNNCDPANDSGGDLSVNGIFGDSGTQN
**RLGHDPHIQHFSHLHLLELSNPQTLNTTTSCSACKLQPSGLMYTCKPCNFTLHVSCTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCATKPLTLIHQSHPHQLQLTFDPPYYTEGFSCDICKKVGSAHWLYRCSLCEFDAHLDCAANLLAQPIHTQHQYSLNPGAINQMQHGNRQNAMGMNNNQFFSQRQSMGALPLQNNSYNQAPAPAAAAAGTVNPLMDALVQGLVQGAAEQFGQTIVQSLINDGGNNCDPANDSGGDLSVNGIFGD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRLGHDPHIQHFSHLHLLELSNPQTLNTTTSCSACKLQPSGLMYTCKPCNFTLHVSCTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCATKPLTLIHQSHPHQLQLTFDPPYYTEGFSCDICKKVGSAHWLYRCSLCEFDAHLDCAANLLAQPIHTQHQYSLNPGAINQMQHGNRQNAMGMNNNQFFSQRQSMGALPLQNNSYNQAPAPAAAAAGTVNPLMDALVQGLVQGAAEQFGQTIVQSLINDGGNNCDPANDSGGDLSVNGIFGDSGTQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query302 2.2.26 [Sep-21-2011]
O80763578 Probable nucleoredoxin 1 no no 0.178 0.093 0.389 2e-06
Q7Y0E8569 Probable nucleoredoxin 1- no no 0.168 0.089 0.410 8e-05
Q7Y0F2581 Probable nucleoredoxin 1- no no 0.268 0.139 0.326 0.0005
>sp|O80763|NRX1_ARATH Probable nucleoredoxin 1 OS=Arabidopsis thaliana GN=At1g60420 PE=1 SV=1 Back     alignment and function desciption
 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 28/59 (47%), Gaps = 5/59 (8%)

Query: 58  CTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCA 116
               P+ + H  H  H L L    +Y      CD C  +G  +SYHC  CDFDLH  CA
Sbjct: 491 AKDWPKKVKHVLHEEHELELTRVQVY-----TCDKCEEEGTIWSYHCDECDFDLHAKCA 544
Probable thiol-disulfide oxidoreductase required for pollen tube growth and pollen function in the pistil. Seems not to be required for in vitro pollen tube growth. May be involved in the generation of lipid signaling molecules in pistil.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 8EC: .EC: 1EC: .EC: 8
>sp|Q7Y0E8|NRX11_ORYSJ Probable nucleoredoxin 1-1 OS=Oryza sativa subsp. japonica GN=Os03g0405500 PE=2 SV=1 Back     alignment and function description
>sp|Q7Y0F2|NRX12_ORYSJ Probable nucleoredoxin 1-2 OS=Oryza sativa subsp. japonica GN=Os03g0405900 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
224118064326 predicted protein [Populus trichocarpa] 0.927 0.858 0.580 1e-86
255579402324 protein binding protein, putative [Ricin 0.943 0.879 0.491 3e-74
225450311360 PREDICTED: uncharacterized protein LOC10 0.877 0.736 0.453 3e-64
147833060366 hypothetical protein VITISV_033016 [Viti 0.831 0.685 0.451 2e-60
15226210 718 cysteine/histidine-rich C1 domain-contai 0.529 0.222 0.596 3e-53
224120902321 predicted protein [Populus trichocarpa] 0.615 0.579 0.570 2e-51
157679148212 DC1 domain containing protein [Nicotiana 0.605 0.863 0.546 9e-50
297746404319 unnamed protein product [Vitis vinifera] 0.850 0.805 0.350 3e-34
224138078400 predicted protein [Populus trichocarpa] 0.894 0.675 0.332 1e-33
449437906253 PREDICTED: uncharacterized protein LOC10 0.764 0.913 0.337 3e-31
>gi|224118064|ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|222858396|gb|EEE95943.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  325 bits (834), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 176/303 (58%), Positives = 207/303 (68%), Gaps = 23/303 (7%)

Query: 1   MGRLGHDPHIQHFSHLHLLELSNPQTLNTTTSCSACKLQPSGLMYTCKPCNFTLHVSCTQ 60
           MG+L HDP+I HFSH H LELSN Q+L    SCSAC LQPSG MY+CKPCNFTLH+SCTQ
Sbjct: 1   MGKLNHDPYINHFSHPHPLELSNAQSL-YMNSCSACNLQPSGWMYSCKPCNFTLHISCTQ 59

Query: 61  MPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCATKPL 120
           MP LITHP HP H L+L  TP+YP G FNCDGCG QG+GF+YHCT CDFD+H++CAT PL
Sbjct: 60  MPTLITHPCHPIHPLTLFSTPVYPGGSFNCDGCGLQGNGFNYHCTTCDFDVHMMCATNPL 119

Query: 121 TLIHQSHPHQLQLTFDPPYYTEGFSCDICKKVGSAHWLYRCSLCEFDAHLDCAANLLAQP 180
           +L HQSHPHQL L F PPY T+GFSCDIC K+GS HWLYRCS CEFDAH+ CA ++   P
Sbjct: 120 SLAHQSHPHQLNLAFYPPYQTKGFSCDICHKIGSNHWLYRCSACEFDAHMKCAMSVNNTP 179

Query: 181 I-HTQHQYSLNPGAINQMQHGNRQNAMGMNNNQFFSQRQSMGALPLQNN----------- 228
           + H QH  SL P A N      +Q  +G   N  +   QSMGA+P+              
Sbjct: 180 LPHVQHSNSL-PVANNVNIQYQQQPGLG-GANYGYRHSQSMGAMPMLQQRQQRQQRQLQQ 237

Query: 229 -SYNQ-APAPAAAAAGTVNPLMDALVQGLVQGAAEQFGQTIVQSLIN-DGGNNCDPANDS 285
            SY Q +  P  AA GT+   MD +VQG V  AA+Q GQT  QS++N DG NN DP  + 
Sbjct: 238 VSYQQPSGGPNGAANGTI---MDTMVQGFVDAAAQQVGQTFAQSIMNPDGSNNSDP--NG 292

Query: 286 GGD 288
           GGD
Sbjct: 293 GGD 295

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255579402|ref|XP_002530545.1| protein binding protein, putative [Ricinus communis] gi|223529907|gb|EEF31836.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225450311|ref|XP_002268131.1| PREDICTED: uncharacterized protein LOC100261320 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147833060|emb|CAN66246.1| hypothetical protein VITISV_033016 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15226210|ref|NP_180334.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|3860266|gb|AAC73034.1| hypothetical protein [Arabidopsis thaliana] gi|330252929|gb|AEC08023.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224120902|ref|XP_002330854.1| predicted protein [Populus trichocarpa] gi|222872676|gb|EEF09807.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|157679148|dbj|BAF80453.1| DC1 domain containing protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|297746404|emb|CBI16460.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224138078|ref|XP_002322724.1| predicted protein [Populus trichocarpa] gi|222867354|gb|EEF04485.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449437906|ref|XP_004136731.1| PREDICTED: uncharacterized protein LOC101202742 [Cucumis sativus] gi|449511350|ref|XP_004163933.1| PREDICTED: uncharacterized LOC101202742 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
TAIR|locus:2041996 718 AT2G27660 [Arabidopsis thalian 0.645 0.271 0.531 2.6e-63
TAIR|locus:2050517146 AT2G44400 [Arabidopsis thalian 0.447 0.924 0.465 4.7e-32
TAIR|locus:2064551268 AT2G42060 [Arabidopsis thalian 0.546 0.615 0.406 8.8e-31
TAIR|locus:2050477247 AT2G44380 [Arabidopsis thalian 0.543 0.663 0.356 2.1e-29
TAIR|locus:2827948248 AT2G17740 [Arabidopsis thalian 0.549 0.669 0.366 4.4e-29
TAIR|locus:2050589250 AT2G44370 [Arabidopsis thalian 0.539 0.652 0.354 3.9e-28
TAIR|locus:2158347250 AT5G43520 [Arabidopsis thalian 0.543 0.656 0.343 1.2e-26
TAIR|locus:2062804248 AT2G28270 [Arabidopsis thalian 0.552 0.673 0.329 1.4e-25
TAIR|locus:2168728234 AT5G40590 [Arabidopsis thalian 0.519 0.670 0.323 2.2e-25
TAIR|locus:2065604396 AT2G37800 [Arabidopsis thalian 0.516 0.393 0.315 1.6e-19
TAIR|locus:2041996 AT2G27660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 581 (209.6 bits), Expect = 2.6e-63, Sum P(2) = 2.6e-63
 Identities = 109/205 (53%), Positives = 139/205 (67%)

Query:    10 IQHFSHLHLLELSNPQTLNTTTSCSACKLQP-SGLMYTCKPCNFTLHVSCTQMPQLITHP 68
             I HFSH H L+L+ P T  ++  CSACKL   +G +Y+C+PCNF+LH SC++M Q+ITHP
Sbjct:    12 INHFSHPHRLQLT-PAT--SSPPCSACKLTGGNGRVYSCRPCNFSLHESCSKMKQVITHP 68

Query:    69 SHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCATKPLTLIHQSHP 128
             SHP+H+LSL+  P+Y  G FNCDGCG  G GFSY C+ CDFD+H LCA KPL++IH+SHP
Sbjct:    69 SHPSHTLSLLVAPVYDGGYFNCDGCGIHGTGFSYQCSVCDFDIHALCAYKPLSIIHKSHP 128

Query:   129 -HQLQLTFDPPY-YTEGFSCDICKKVGSAHWLYRCSLCEFDAHLDCAANLLAQPIHTQHQ 186
              H L+L F  PY   +GFSCDIC+K+G   WLYRC  CEFDAH+ C       P   QH 
Sbjct:   129 QHNLKLAFQSPYGANKGFSCDICRKIGKNQWLYRCIPCEFDAHVGCITG--PNPHLLQHS 186

Query:   187 YSL-NPGAINQMQHGNRQNAMGMNN 210
              S  NP   +   H   QN++ + N
Sbjct:   187 TSAPNPHT-HHAGHPQHQNSLPVPN 210
GO:0008270 "zinc ion binding" evidence=IEA
GO:0047134 "protein-disulfide reductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0002679 "respiratory burst involved in defense response" evidence=RCA
GO:0006865 "amino acid transport" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
GO:0015824 "proline transport" evidence=RCA
TAIR|locus:2050517 AT2G44400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064551 AT2G42060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050477 AT2G44380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827948 AT2G17740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050589 AT2G44370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158347 AT5G43520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062804 AT2G28270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168728 AT5G40590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065604 AT2G37800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
pfam0310730 pfam03107, C1_2, C1 domain 3e-05
pfam0764930 pfam07649, C1_3, C1-like domain 5e-05
pfam0764930 pfam07649, C1_3, C1-like domain 9e-05
pfam0310730 pfam03107, C1_2, C1 domain 3e-04
cd0234043 cd02340, ZZ_NBR1_like, Zinc finger, ZZ type 4e-04
pfam07793 729 pfam07793, DUF1631, Protein of unknown function (D 8e-04
pfam0310730 pfam03107, C1_2, C1 domain 0.001
>gnl|CDD|202539 pfam03107, C1_2, C1 domain Back     alignment and domain information 
 Score = 39.9 bits (94), Expect = 3e-05
 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%)

Query: 88  FNCDGCGRQGHGFS-YHCTHCDFDLHILCA 116
           F C  C R+  GF  Y C  C F LH+ CA
Sbjct: 1   FWCSVCRRKIDGFYFYTCKKCCFTLHVRCA 30

This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in pfam00130, therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol (A Bateman pers. obs.). This family are found in plant proteins. Length = 30
>gnl|CDD|219497 pfam07649, C1_3, C1-like domain Back     alignment and domain information
>gnl|CDD|219497 pfam07649, C1_3, C1-like domain Back     alignment and domain information
>gnl|CDD|202539 pfam03107, C1_2, C1 domain Back     alignment and domain information
>gnl|CDD|239080 cd02340, ZZ_NBR1_like, Zinc finger, ZZ type Back     alignment and domain information
>gnl|CDD|219580 pfam07793, DUF1631, Protein of unknown function (DUF1631) Back     alignment and domain information
>gnl|CDD|202539 pfam03107, C1_2, C1 domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 302
cd0234043 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre 98.39
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 98.26
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 98.19
PF0310730 C1_2: C1 domain; InterPro: IPR004146 This short do 98.14
cd0233945 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger pre 98.0
cd0234445 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present 97.93
PF0310730 C1_2: C1 domain; InterPro: IPR004146 This short do 97.92
cd0224946 ZZ Zinc finger, ZZ type. Zinc finger present in dy 97.91
cd0234043 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre 97.88
cd0233849 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger pre 97.81
cd0234243 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger pre 97.76
cd0224946 ZZ Zinc finger, ZZ type. Zinc finger present in dy 97.7
cd0234148 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present 97.6
cd0233849 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger pre 97.59
cd0234148 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present 97.59
cd0233549 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present 97.55
cd0234549 ZZ_dah Zinc finger, ZZ type. Zinc finger present i 97.55
cd0233449 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger pr 97.51
cd0234348 ZZ_EF Zinc finger, ZZ type. Zinc finger present in 97.51
cd0233945 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger pre 97.5
cd0234445 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present 97.5
cd0234348 ZZ_EF Zinc finger, ZZ type. Zinc finger present in 97.45
cd0233549 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present 97.4
cd0233449 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger pr 97.38
cd0234549 ZZ_dah Zinc finger, ZZ type. Zinc finger present i 97.35
KOG1280 381 consensus Uncharacterized conserved protein contai 97.32
smart0029144 ZnF_ZZ Zinc-binding domain, present in Dystrophin, 97.26
PF0056946 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc 97.21
KOG1280381 consensus Uncharacterized conserved protein contai 97.2
cd0233741 ZZ_CBP Zinc finger, ZZ type. Zinc finger present i 97.19
cd0233741 ZZ_CBP Zinc finger, ZZ type. Zinc finger present i 97.17
cd0234243 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger pre 97.12
KOG4582278 consensus Uncharacterized conserved protein, conta 97.1
smart0029144 ZnF_ZZ Zinc-binding domain, present in Dystrophin, 97.07
PF0056946 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc 97.04
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 96.67
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 96.53
KOG0696 683 consensus Serine/threonine protein kinase [Signal 96.27
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 96.21
KOG0696 683 consensus Serine/threonine protein kinase [Signal 96.14
KOG4582278 consensus Uncharacterized conserved protein, conta 95.76
cd0002950 C1 Protein kinase C conserved region 1 (C1) . Cyst 95.6
cd0002950 C1 Protein kinase C conserved region 1 (C1) . Cyst 95.0
smart0010949 C1 Protein kinase C conserved region 1 (C1) domain 94.97
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 94.82
smart0010949 C1 Protein kinase C conserved region 1 (C1) domain 94.4
KOG0956 900 consensus PHD finger protein AF10 [General functio 94.24
KOG0954 893 consensus PHD finger protein [General function pre 92.7
KOG4286966 consensus Dystrophin-like protein [Cell motility; 92.27
cd0233645 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present 90.46
KOG0957 707 consensus PHD finger protein [General function pre 89.9
KOG4286 966 consensus Dystrophin-like protein [Cell motility; 89.42
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 88.93
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 88.89
cd0233645 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present 87.9
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 87.72
KOG0956 900 consensus PHD finger protein AF10 [General functio 86.6
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 86.05
KOG1169 634 consensus Diacylglycerol kinase [Lipid transport a 83.72
KOG2807378 consensus RNA polymerase II transcription initiati 83.48
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 80.47
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 80.16
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type Back     alignment and domain information 
Probab=98.39  E-value=2.5e-07  Score=63.19  Aligned_cols=39  Identities=31%  Similarity=0.761  Sum_probs=33.3

Q ss_pred             cCccCCCCCCCCcEeecCC-CCCCccccCCCCceecCCCCCCCccc
Q 035521           32 SCSACKLQPSGLMYTCKPC-NFTLHVSCTQMPQLITHPSHPAHSLS   76 (302)
Q Consensus        32 ~Cd~C~~~~~g~~Y~C~~C-~f~lH~~Ca~~P~~i~Hp~Hp~H~L~   76 (302)
                      .||+|++++.|.+|+|.+| ||+||.+|....   .   |+.|+|.
T Consensus         2 ~Cd~C~~~i~G~ry~C~~C~d~dLC~~C~~~~---~---H~~H~f~   41 (43)
T cd02340           2 ICDGCQGPIVGVRYKCLVCPDYDLCESCEAKG---V---HPEHAML   41 (43)
T ss_pred             CCCCCCCcCcCCeEECCCCCCccchHHhhCcC---C---CCCCCEE
Confidence            6999999999999999999 899999999854   3   3557664

Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines Back     alignment and domain information
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type Back     alignment and domain information
>cd02344 ZZ_HERC2 Zinc finger, ZZ type Back     alignment and domain information
>PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines Back     alignment and domain information
>cd02249 ZZ Zinc finger, ZZ type Back     alignment and domain information
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type Back     alignment and domain information
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type Back     alignment and domain information
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type Back     alignment and domain information
>cd02249 ZZ Zinc finger, ZZ type Back     alignment and domain information
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type Back     alignment and domain information
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type Back     alignment and domain information
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type Back     alignment and domain information
>cd02335 ZZ_ADA2 Zinc finger, ZZ type Back     alignment and domain information
>cd02345 ZZ_dah Zinc finger, ZZ type Back     alignment and domain information
>cd02334 ZZ_dystrophin Zinc finger, ZZ type Back     alignment and domain information
>cd02343 ZZ_EF Zinc finger, ZZ type Back     alignment and domain information
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type Back     alignment and domain information
>cd02344 ZZ_HERC2 Zinc finger, ZZ type Back     alignment and domain information
>cd02343 ZZ_EF Zinc finger, ZZ type Back     alignment and domain information
>cd02335 ZZ_ADA2 Zinc finger, ZZ type Back     alignment and domain information
>cd02334 ZZ_dystrophin Zinc finger, ZZ type Back     alignment and domain information
>cd02345 ZZ_dah Zinc finger, ZZ type Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein Back     alignment and domain information
>PF00569 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>cd02337 ZZ_CBP Zinc finger, ZZ type Back     alignment and domain information
>cd02337 ZZ_CBP Zinc finger, ZZ type Back     alignment and domain information
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type Back     alignment and domain information
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein Back     alignment and domain information
>PF00569 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>cd00029 C1 Protein kinase C conserved region 1 (C1) Back     alignment and domain information
>cd00029 C1 Protein kinase C conserved region 1 (C1) Back     alignment and domain information
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains) Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains) Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd02336 ZZ_RSC8 Zinc finger, ZZ type Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>cd02336 ZZ_RSC8 Zinc finger, ZZ type Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>KOG1169 consensus Diacylglycerol kinase [Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
1v5n_A89 Solution Structure Of Dc1 Domain Of Pdi-Like Hypoth 5e-07
>pdb|1V5N|A Chain A, Solution Structure Of Dc1 Domain Of Pdi-Like Hypothetical Protein From Arabidopsis Thaliana Length = 89 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 28/55 (50%), Gaps = 5/55 (9%)
Query: 62  PQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCA 116
           P+ + H  H  H L L    +Y      CD C  +G  +SYHC  CDFDLH  CA
Sbjct: 27  PKKVKHVLHEEHELELTRVQVY-----TCDKCEEEGTIWSYHCDECDFDLHAKCA 76

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 9e-26
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 3e-17
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 3e-08
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
 Score = 96.9 bits (241), Expect = 9e-26
 Identities = 25/82 (30%), Positives = 30/82 (36%), Gaps = 5/82 (6%)

Query: 45  YTCKPCNFTLHVSCTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHC 104
              K             P+ + H  H  H L L    +Y      CD C  +G  +SYHC
Sbjct: 10  ERLKEIEAKYDEIAKDWPKKVKHVLHEEHELELTRVQVY-----TCDKCEEEGTIWSYHC 64

Query: 105 THCDFDLHILCATKPLTLIHQS 126
             CDFDLH  CA    T     
Sbjct: 65  DECDFDLHAKCALNEDTKESGP 86
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 99.53
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 99.31
2fc7_A82 ZZZ3 protein; structure genomics, ZZ domain, struc 97.86
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 97.82
2dip_A98 Zinc finger SWIM domain-containing protein 2; ZZ d 97.78
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 97.66
2e5r_A63 Dystrobrevin alpha; ZZ domain, structural genomics 97.57
2e5r_A63 Dystrobrevin alpha; ZZ domain, structural genomics 97.51
2fc7_A82 ZZZ3 protein; structure genomics, ZZ domain, struc 97.49
1tot_A52 CREB-binding protein; zinc binding, CBP, TAZ2, tra 97.34
2dip_A98 Zinc finger SWIM domain-containing protein 2; ZZ d 97.29
1tot_A52 CREB-binding protein; zinc binding, CBP, TAZ2, tra 97.2
2db6_A74 SH3 and cysteine rich domain 3; STAC3, C1 domain, 96.76
1ptq_A50 Protein kinase C delta type; phosphotransferase; 1 96.45
2enz_A65 NPKC-theta, protein kinase C theta type; zinc bind 96.38
2yuu_A83 NPKC-delta, protein kinase C delta type; metal bin 96.29
1faq_A52 RAF-1; transferase, serine/threonine-protein kinas 96.28
2eli_A85 Protein kinase C alpha type; PKC-alpha, PKC-A, str 96.27
1kbe_A49 Kinase suppressor of RAS; KSR, cysteine-rich domai 96.22
3uej_A65 NPKC-delta, protein kinase C delta type; proteine 96.17
1kbe_A49 Kinase suppressor of RAS; KSR, cysteine-rich domai 96.12
2enz_A65 NPKC-theta, protein kinase C theta type; zinc bind 96.12
2enn_A77 NPKC-theta, protein kinase C theta type; zinc bind 96.07
1ptq_A50 Protein kinase C delta type; phosphotransferase; 1 96.01
1y8f_A66 UNC-13 homolog A, MUNC13-1; cysteine-rich domain, 95.97
1faq_A52 RAF-1; transferase, serine/threonine-protein kinas 95.95
2db6_A74 SH3 and cysteine rich domain 3; STAC3, C1 domain, 95.87
2eli_A85 Protein kinase C alpha type; PKC-alpha, PKC-A, str 95.61
1rfh_A59 RAS association (ralgds/AF-6) domain family 5; zin 95.58
3uej_A65 NPKC-delta, protein kinase C delta type; proteine 95.51
1y8f_A66 UNC-13 homolog A, MUNC13-1; cysteine-rich domain, 95.47
2enn_A77 NPKC-theta, protein kinase C theta type; zinc bind 95.46
2yuu_A83 NPKC-delta, protein kinase C delta type; metal bin 95.37
2fnf_X72 Putative RAS effector NORE1; zinc, signal transduc 95.32
2row_A84 RHO-associated protein kinase 2; ATP-binding, coil 95.06
2fnf_X72 Putative RAS effector NORE1; zinc, signal transduc 94.89
1rfh_A59 RAS association (ralgds/AF-6) domain family 5; zin 94.87
4b6d_A61 RAC GTPase-activating protein 1; signaling protein 93.8
4b6d_A61 RAC GTPase-activating protein 1; signaling protein 93.59
2row_A84 RHO-associated protein kinase 2; ATP-binding, coil 93.46
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 91.28
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 89.64
1r79_A84 Diacylglycerol kinase, delta; C1 domain, cystein-r 87.89
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 87.73
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 86.6
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 86.45
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 85.85
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 85.33
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 83.56
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 83.27
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 80.02
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Back     alignment and structure
Probab=99.53  E-value=2.4e-15  Score=117.08  Aligned_cols=66  Identities=33%  Similarity=0.706  Sum_probs=60.2

Q ss_pred             CCCCCccccCCCCceecCCCCCCCccccccCCCCCCCceecccCCCCCCCeeEEcCCCCccccccccCCCc
Q 035521           50 CNFTLHVSCTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCATKPL  120 (302)
Q Consensus        50 C~f~lH~~Ca~~P~~i~Hp~Hp~H~L~L~~~~~~~~~~~~C~~C~~~i~G~~Y~C~~CdfdlH~~Ca~lP~  120 (302)
                      ++..||+.|+.+|++|.|++||+|+|+|...+     .+.|++|++.+.+++|+|.+|+|+||+.||.+|.
T Consensus        15 ~~~~lhe~Ca~lP~~i~Hp~Hp~H~L~L~~~~-----~~~C~~C~~~~~~~~Y~C~~C~f~lH~~Ca~~p~   80 (89)
T 1v5n_A           15 IEAKYDEIAKDWPKKVKHVLHEEHELELTRVQ-----VYTCDKCEEEGTIWSYHCDECDFDLHAKCALNED   80 (89)
T ss_dssp             HHHHHHHHTSSSCSEECCSTTTTSCEEEECCS-----SCCCTTTSCCCCSCEEECTTTCCCCCHHHHHCSS
T ss_pred             HHHHHhHHHHcCCceecCCCCCCCccEEeeCC-----CeEeCCCCCcCCCcEEEcCCCCCeEcHHhcCCCC
Confidence            45689999999999999999999999998653     5789999999999999999999999999999875
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Back     alignment and structure
>2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 Back     alignment and structure
>2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 Back     alignment and structure
>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Back     alignment and structure
>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Back     alignment and structure
>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A Back     alignment and structure
>3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A* Back     alignment and structure
>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A Back     alignment and structure
>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Back     alignment and structure
>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Back     alignment and structure
>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Back     alignment and structure
>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Back     alignment and structure
>3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A* Back     alignment and structure
>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Back     alignment and structure
>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Back     alignment and structure
>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Back     alignment and structure
>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Back     alignment and structure
>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens} Back     alignment and structure
>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens} Back     alignment and structure
>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1r79_A Diacylglycerol kinase, delta; C1 domain, cystein-rich zinc binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: g.49.1.1 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 302
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 5e-21
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 2e-13
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 6e-09
d2dipa185 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing p 0.001
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure

class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: C1-like domain
domain: Pdi-like hypothetical protein At1g60420
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 83.4 bits (206), Expect = 5e-21
 Identities = 26/84 (30%), Positives = 33/84 (39%), Gaps = 7/84 (8%)

Query: 45  YTCKPCNFTLHVSCTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHC 104
              K             P+ + H  H  H L L    +     + CD C  +G  +SYHC
Sbjct: 10  ERLKEIEAKYDEIAKDWPKKVKHVLHEEHELELTRVQV-----YTCDKCEEEGTIWSYHC 64

Query: 105 THCDFDLHILCATKPLTLIHQSHP 128
             CDFDLH  CA    T   +S P
Sbjct: 65  DECDFDLHAKCALNEDTK--ESGP 86
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
d1v5na_89 Pdi-like hypothetical protein At1g60420 {Thale cre 99.71
d1v5na_89 Pdi-like hypothetical protein At1g60420 {Thale cre 99.46
d2dipa185 Zinc finger ZZ-type-containing protein 2 {Human (H 97.89
d2fc7a169 Zinc finger ZZ-type-containing protein 3, ZZZ3 {Hu 97.8
d2fc7a169 Zinc finger ZZ-type-containing protein 3, ZZZ3 {Hu 97.38
d1tota152 CREB-binding protein, CBP {Mouse (Mus musculus) [T 97.32
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 96.96
d1faqa_52 RAF-1 {Human (Homo sapiens) [TaxId: 9606]} 96.84
d1xa6a362 Beta-chimaerin, middle domain {Human (Homo sapiens 96.84
d1tota152 CREB-binding protein, CBP {Mouse (Mus musculus) [T 96.78
d2dipa185 Zinc finger ZZ-type-containing protein 2 {Human (H 96.75
d1ptqa_50 Protein kinase C-delta (PKCdelta) {Mouse (Mus musc 96.67
d1faqa_52 RAF-1 {Human (Homo sapiens) [TaxId: 9606]} 96.57
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 96.41
d1kbea_49 Kinase suppressor of Ras, Ksr {Mouse (Mus musculus 96.26
d1ptqa_50 Protein kinase C-delta (PKCdelta) {Mouse (Mus musc 96.24
d1xa6a362 Beta-chimaerin, middle domain {Human (Homo sapiens 96.12
d1kbea_49 Kinase suppressor of Ras, Ksr {Mouse (Mus musculus 95.64
d1r79a_84 Diacylglycerol kinase delta {Human (Homo sapiens) 95.36
d1r79a_84 Diacylglycerol kinase delta {Human (Homo sapiens) 93.6
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 81.8
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: C1-like domain
domain: Pdi-like hypothetical protein At1g60420
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.71  E-value=5.3e-19  Score=135.92  Aligned_cols=79  Identities=33%  Similarity=0.598  Sum_probs=72.7

Q ss_pred             CCCCcEeecCCCCCCccccCCCCceecCCCCCCCccccccCCCCCCCceecccCCCCCCCeeEEcCCCCccccccccCCC
Q 035521           40 PSGLMYTCKPCNFTLHVSCTQMPQLITHPSHPAHSLSLVPTPIYPAGIFNCDGCGRQGHGFSYHCTHCDFDLHILCATKP  119 (302)
Q Consensus        40 ~~g~~Y~C~~C~f~lH~~Ca~~P~~i~Hp~Hp~H~L~L~~~~~~~~~~~~C~~C~~~i~G~~Y~C~~CdfdlH~~Ca~lP  119 (302)
                      ..|..|+|.+|++.+|+.|+++|++|+|++||+|+|+|...+     .+.|++|++.+.++.|+|.+|+|+||..||.+|
T Consensus         5 ~~~t~~~~~e~~~~~he~c~~~P~~I~Hp~Hp~H~L~L~~~~-----~~~C~~C~~~~~g~~Y~C~~C~f~LH~~CA~~P   79 (89)
T d1v5na_           5 SSGTEERLKEIEAKYDEIAKDWPKKVKHVLHEEHELELTRVQ-----VYTCDKCEEEGTIWSYHCDECDFDLHAKCALNE   79 (89)
T ss_dssp             CCCCSSCCSHHHHHHHHHTSSSCSEECCSTTTTSCEEEECCS-----SCCCTTTSCCCCSCEEECTTTCCCCCHHHHHCS
T ss_pred             CCchHHHHHHHHhhhhHHHhcCCCeecCCCCCCCCeEEecCC-----CCEeCCCCCCcCCcEeEeccCCCEecHHHcCCC
Confidence            467889999999999999999999999999999999997653     578999999999999999999999999999999


Q ss_pred             ccee
Q 035521          120 LTLI  123 (302)
Q Consensus       120 ~~i~  123 (302)
                      .++.
T Consensus        80 ~~~~   83 (89)
T d1v5na_          80 DTKE   83 (89)
T ss_dssp             SCSS
T ss_pred             cccC
Confidence            7654
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure