Citrus Sinensis ID: 035522

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------51
MAPDSSISKLVVIITFISSIIVPVITDNAVLTASDASSAIQLEREALLNSGWWNSSWATANYTSDHCKWMGITCNSAGSIVEISSYEMDNNGNAAELSQFNFTCFPNLITFKISGTGFLSGRIPSEIGALSKLQVLNLSQNHLTGTIPSEIGSSRNLFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNKLDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREVGNLKILELLYLDSNNLTGPIPSTLYHLNPLIEWYLAYNNLVGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQLSGLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQLQNLVLSHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLSGVVPASVRRIPKLIVSENNLELENSTSSENAPPPQAKPFKGNKGKQRKIVTRL
ccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccccEEEEcccccEEEEEEEEccccccccccccccccccccccEEEccccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccEEEcccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHcccccccEEccccEEEEcccccccccccccEEEccccccEEcccHHccccccccEEEcccccccccccHHccccccccccccccccccccccccccccccccEEEccccEEcccccccccccccccEEEccccccccccccccccccccccEEcccccccccccHHHHcccccccEEcccccccccccHHccccccccEEEcccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccccccccEEcccccccccEEEEEEEccccccccccHHHHcccccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHccccEEEcccccccccccHHHcccccccEEEccccccccccccccc
MAPDSSISKLVVIITFISSIivpvitdnavltasdasSAIQLEREALLnsgwwnsswatanytsdhckwmgitcnsagSIVEISSyemdnngnaaelsqfnftcfpnlitfkisgtgflsgripseiGALSKLQVLNLSqnhltgtipseigssrnlfQLDLSINilngsipleignlkdLDYLMLQgnkldglipssignltkltgLNLSLnklsgrlprevgnLKILELLYldsnnltgpipstlyhlnPLIEWYLAYNnlvgplpkevgnmKNLKILLLHRnnltgpisstiGYLNLLEILDLshnrldgpipstignltNLTSLVLssnqlsgllprevgnlkyldsrsldgnnligpipptigyltnltslnlgynqlsssippelmncsqLQNLVlshntlsgifpseignlthlrqldlshnfingtipsqlgnipnisavdlsknnlsgvvpasvrripklivsennlelenstssenapppqakpfkgnkgkqrkivtrl
MAPDSSISKLVVIITFISSIIVPVITDNAVLTASDASSAIQLEREALLNSGWWNSSWATANYTSDHCKWMGITCNSAGSIVEISSYEMDNNGNAAELSQFNFTCFPNLITFKISGTGFLSGRIPSEIGALSKLQVLNLSQNHLTGTIPSEIGSSRNLFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNKLDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREVGNLKILELLYLDSNNLTGPIPSTLYHLNPLIEWYLAYNNLVGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQLSGLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQLQNLVLSHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLSGVVPASVRRIPKLIVSENNLElenstssenapppqakpfkgnkgkqrkivtrl
MAPDSSISKLvviitfissiivpvitDNAVLTASDASSAIQLEREALLNSGWWNSSWATANYTSDHCKWMGITCNSAGSIVEISSYEMDNNGNAAELSQFNFTCFPNLITFKISGTGFLSGRIPSEIGALSKLQVLNLSQNHLTGTIPSEIGSSRNLFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNKLDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREVGNLKILELLYLDSNNLTGPIPSTLYHLNPLIEWYLAYNNLVGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIGnltnltslvlssnqlsGLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQLQNLVLSHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLSGVVPASVRRIPKLIVSENNLELENSTSSENAPPPQAKPFKGNKGKQRKIVTRL
*******SKLVVIITFISSIIVPVITDNAVLTASDASSAIQLEREALLNSGWWNSSWATANYTSDHCKWMGITCNSAGSIVEISSYEMDNNGNAAELSQFNFTCFPNLITFKISGTGFLSGRIPSEIGALSKLQVLNL******************LFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNKLDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREVGNLKILELLYLDSNNLTGPIPSTLYHLNPLIEWYLAYNNLVGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQLSGLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQLQNLVLSHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLSGVVPASVRRIPKLIV**************************************
******I**LVVIITFISSIIVPVITDNAVLTASDASSAIQLEREA*L***WWNSSWATANYTSDHCKWMGITCNSAGSIVEISSYEMDNNGNAAELSQFNFTCFPNLITFKISGTGFLSGRIPSEIGALSKLQVLNLSQNHLTGTIPSEIGSSRNLFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNKLDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREVGNLKILELLYLDSNNLTGPIPSTLYHLNPLIEWYLAYNNLVGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQLSGLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQLQNLVLSHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLSGVVPASVRRIPKLIVSENNLELENSTSSENAPPPQAKPFKGNKGKQRKIVT**
MAPDSSISKLVVIITFISSIIVPVITDNAVLTASDASSAIQLEREALLNSGWWNSSWATANYTSDHCKWMGITCNSAGSIVEISSYEMDNNGNAAELSQFNFTCFPNLITFKISGTGFLSGRIPSEIGALSKLQVLNLSQNHLTGTIPSEIGSSRNLFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNKLDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREVGNLKILELLYLDSNNLTGPIPSTLYHLNPLIEWYLAYNNLVGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQLSGLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQLQNLVLSHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLSGVVPASVRRIPKLIVSENNLE********************************
***DSSISKLVVIITFISSIIVPVITDNAVLTASDASSAIQLEREALLNSGWWNSSWATANYTSDHCKWMGITCNSAGSIVEISSYEMDNNGNAAELSQFNFTCFPNLITFKISGTGFLSGRIPSEIGALSKLQVLNLSQNHLTGTIPSEIGSSRNLFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNKLDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREVGNLKILELLYLDSNNLTGPIPSTLYHLNPLIEWYLAYNNLVGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQLSGLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQLQNLVLSHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLSGVVPASVRRIPKLIVSENNLELENSTSSENAPPPQAKPFKGNKGKQRKIV***
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPDSSISKLVVIITFISSIIVPVITDNAVLTASDASSAIQLEREALLNSGWWNSSWATANYTSDHCKWMGITCNSAGSIVEISSYEMDNNGNAAELSQFNFTCFPNLITFKISGTGFLSGRIPSEIGALSKLQVLNLSQNHLTGTIPSEIGSSRNLFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNKLDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREVGNLKILELLYLDSNNLTGPIPSTLYHLNPLIEWYLAYNNLVGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQLSGLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQLQNLVLSHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLSGVVPASVRRIPKLIVSENNLELENSTSSENAPPPQAKPFKGNKGKQRKIVTRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query509 2.2.26 [Sep-21-2011]
Q8VZG8 1045 Probable LRR receptor-lik yes no 0.858 0.418 0.394 3e-67
Q9LP24 1120 Probable leucine-rich rep no no 0.823 0.374 0.397 8e-66
C0LGV1 1135 LRR receptor-like serine/ no no 0.750 0.336 0.401 5e-63
C0LGR3 1091 Probable LRR receptor-lik no no 0.801 0.373 0.367 2e-60
Q9LHP4 1141 Receptor-like protein kin no no 0.705 0.314 0.421 1e-59
O22938 890 Leucine-rich repeat recep no no 0.888 0.507 0.348 2e-59
Q9SHI2 1101 Leucine-rich repeat recep no no 0.703 0.325 0.390 2e-59
Q9LVP0 1102 Probable leucine-rich rep no no 0.703 0.324 0.404 3e-59
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.772 0.313 0.372 1e-58
P93194 1109 Receptor-like protein kin N/A no 0.671 0.308 0.380 2e-58
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function desciption
 Score =  256 bits (654), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 178/451 (39%), Positives = 234/451 (51%), Gaps = 14/451 (3%)

Query: 30  VLTASDASSAIQLEREALLN--SGWWN-------SSWATANYTSDHCKWMGITCNSAGSI 80
           VL+ S A SA   E  ALL   S + N       SSW   N +S    W G+ C S GSI
Sbjct: 37  VLSCSFAVSATVEEANALLKWKSTFTNQTSSSKLSSWVNPNTSSFCTSWYGVAC-SLGSI 95

Query: 81  VEISSYEMDNNGNAAELSQFNFTCFPNLITFKISGTGFLSGRIPSEIGALSKLQVLNLSQ 140
           + ++   + N G       F F+  PNL    +S   F SG I    G  SKL+  +LS 
Sbjct: 96  IRLN---LTNTGIEGTFEDFPFSSLPNLTFVDLSMNRF-SGTISPLWGRFSKLEYFDLSI 151

Query: 141 NHLTGTIPSEIGSSRNLFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNKLDGLIPSSIG 200
           N L G IP E+G   NL  L L  N LNGSIP EIG L  +  + +  N L G IPSS G
Sbjct: 152 NQLVGEIPPELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLLTGPIPSSFG 211

Query: 201 NLTKLTGLNLSLNKLSGRLPREVGNLKILELLYLDSNNLTGPIPSTLYHLNPLIEWYLAY 260
           NLTKL  L L +N LSG +P E+GNL  L  L LD NNLTG IPS+  +L  +    +  
Sbjct: 212 NLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGNLKNVTLLNMFE 271

Query: 261 NNLVGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIG 320
           N L G +P E+GNM  L  L LH N LTGPI ST+G +  L +L L  N+L+G IP  +G
Sbjct: 272 NQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELG 331

Query: 321 NLTNLTSLVLSSNQLSGLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGY 380
            + ++  L +S N+L+G +P   G L  L+   L  N L GPIPP I   T LT L L  
Sbjct: 332 EMESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDT 391

Query: 381 NQLSSSIPPELMNCSQLQNLVLSHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLG 440
           N  +  +P  +    +L+NL L  N   G  P  + +   L ++    N  +G I    G
Sbjct: 392 NNFTGFLPDTICRGGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGNSFSGDISEAFG 451

Query: 441 NIPNISAVDLSKNNLSGVVPASVRRIPKLIV 471
             P ++ +DLS NN  G + A+  +  KL+ 
Sbjct: 452 VYPTLNFIDLSNNNFHGQLSANWEQSQKLVA 482

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|O22938|Y2182_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 OS=Arabidopsis thaliana GN=At2g41820 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query509
225452751 878 PREDICTED: probable leucine-rich repeat 0.944 0.547 0.408 4e-84
357451683 1029 Receptor protein kinase-like protein [Me 0.860 0.425 0.411 2e-79
224110038 964 predicted protein [Populus trichocarpa] 0.921 0.486 0.410 8e-79
224110020 1048 predicted protein [Populus trichocarpa] 0.888 0.431 0.429 7e-78
224065673 964 predicted protein [Populus trichocarpa] 0.923 0.487 0.408 1e-77
225465647 820 PREDICTED: probable LRR receptor-like se 0.889 0.552 0.410 4e-76
356577797 1204 PREDICTED: probable LRR receptor-like se 0.862 0.364 0.414 2e-75
224093626 1039 predicted protein [Populus trichocarpa] 0.880 0.431 0.420 5e-75
224065665 847 predicted protein [Populus trichocarpa] 0.874 0.525 0.407 2e-74
147852997 661 hypothetical protein VITISV_031965 [Viti 0.846 0.652 0.432 2e-74
>gi|225452751|ref|XP_002277606.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  318 bits (816), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 214/524 (40%), Positives = 304/524 (58%), Gaps = 43/524 (8%)

Query: 1   MAPDSSISKLVVIITFISSIIVPVITDNAVLTASDASSAIQLEREALLNSGWWNSSWATA 60
           MA    IS  VV++T  S +++ + +    L++  +S+    E EAL ++GWWNS     
Sbjct: 1   MASSIIISPAVVVVTITSIMMIMLFSLANALSSPSSSTD---EAEALRSTGWWNS----- 52

Query: 61  NYTSDHCKWMGITCNSAGSIVEISSYEMDNNGNAAELSQFNFTCFPNLITFKISGTGFLS 120
             TS HC W G+ CN+AG + +I+ +  D+     ELS+  F+ FP+L+   +S  G L+
Sbjct: 53  --TSAHCNWDGVYCNNAGRVTQIAFF--DSGKKLGELSKLEFSSFPSLVELFLSDCG-LN 107

Query: 121 GRIPSEIGALSKLQVLNLSQNHLTGTIPSEIGSSRNLFQLDLSINILNGSIPLEIGNLKD 180
           G IP +IG L++L +L L  N+LTG +P  + +   L  L L  N L+GSIP EIG +K+
Sbjct: 108 GSIPHQIGTLTQLIILYLPLNNLTGELPLSLANLTQLEYLSLHSNRLHGSIPPEIGKMKN 167

Query: 181 LDYLMLQGNKLDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREVGNLKILELL-------- 232
           L Y +L  N L G+IPSS GNLT LT L L  N++SG +P ++G +K LE L        
Sbjct: 168 LIYFILHDNNLTGVIPSSFGNLTNLTYLYLGSNQISGFIPPQIGKMKNLEFLSLSYNGLH 227

Query: 233 ----------------YLDSNNLTGPIPSTLYHLNPLIEWYLAYNNLVGPLPKEVGNMKN 276
                           +LD NNLT  IPS+  +L  L   YL  N + G +P ++G +KN
Sbjct: 228 GSIPPEIGKLQNLNYLFLDYNNLTSVIPSSFGNLTNLTYLYLDSNQISGFIPPQIGKIKN 287

Query: 277 LKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQLS 336
           L++L L  N L GPI   IG L  L+IL+L +N L G IPS+ GNLTNLT L L  NQ+S
Sbjct: 288 LELLELSYNGLHGPIPLEIGKLKNLKILNLGYNNLIGVIPSSFGNLTNLTYLTLGGNQIS 347

Query: 337 GLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQ 396
           G +P E+G +K L   +L  N+L G IP + G LT+LTSL L  NQ++ SIPPE+     
Sbjct: 348 GFIPPEIGKMKNLIFFNLGYNSLTGVIPSSFGNLTHLTSLILRGNQINGSIPPEIGYLLD 407

Query: 397 LQNLVLSHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLS 456
           L  L L+ N +SG  P EI NL  L  LD+S+N I+G IPS+LGN+      +LS+NN+S
Sbjct: 408 LLYLDLNTNQISGFIPEEILNLKKLGHLDISNNLISGKIPSELGNLKEAIYFNLSRNNIS 467

Query: 457 GVVPASVRRIPKLIVSENNLELENSTSSENAPPPQAKPFKGNKG 500
           G +P S+      +   ++ +LE  +++    P +A  F  NKG
Sbjct: 468 GTIPLSISNNMWTLFDLSHNQLEGQSTA----PLEA--FDHNKG 505

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357451683|ref|XP_003596118.1| Receptor protein kinase-like protein [Medicago truncatula] gi|355485166|gb|AES66369.1| Receptor protein kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224110038|ref|XP_002333164.1| predicted protein [Populus trichocarpa] gi|222835017|gb|EEE73466.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110020|ref|XP_002333160.1| predicted protein [Populus trichocarpa] gi|222835013|gb|EEE73462.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224065673|ref|XP_002301914.1| predicted protein [Populus trichocarpa] gi|222843640|gb|EEE81187.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225465647|ref|XP_002270862.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356577797|ref|XP_003557009.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Glycine max] Back     alignment and taxonomy information
>gi|224093626|ref|XP_002334827.1| predicted protein [Populus trichocarpa] gi|222875006|gb|EEF12137.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224065665|ref|XP_002301910.1| predicted protein [Populus trichocarpa] gi|222843636|gb|EEE81183.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147852997|emb|CAN79070.1| hypothetical protein VITISV_031965 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query509
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.868 0.394 0.397 1.2e-70
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.864 0.421 0.388 1.1e-65
TAIR|locus:2154344 1135 AT5G48940 [Arabidopsis thalian 0.776 0.348 0.372 1.1e-61
TAIR|locus:2054421 890 AT2G41820 [Arabidopsis thalian 0.860 0.492 0.344 2.8e-60
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.872 0.402 0.347 8.5e-59
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.705 0.314 0.402 2e-58
TAIR|locus:2131518 1091 AT4G26540 [Arabidopsis thalian 0.872 0.406 0.351 6e-58
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.797 0.366 0.354 8.1e-58
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.870 0.406 0.347 9.7e-58
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.815 0.353 0.350 5.6e-57
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 721 (258.9 bits), Expect = 1.2e-70, P = 1.2e-70
 Identities = 182/458 (39%), Positives = 244/458 (53%)

Query:    30 VLTASDASSAIQLEREALLN--SGWWNSS----WA-TANY-TSDHC-KWMGITCNSAGSI 80
             +L+ S ++SA   E  ALL   S + NSS    W   AN  TS  C  W G++CNS GSI
Sbjct:    20 ILSCSISASATIAEANALLKWKSTFTNSSKLSSWVHDANTNTSFSCTSWYGVSCNSRGSI 79

Query:    81 VEISSYEMDNNGNAAELSQFNFTCFPNLITFKISGTGFLSGRIPSEIGALSKLQVLNLSQ 140
              E++   + N G       F F    NL    +S    LSG IP + G LSKL   +LS 
Sbjct:    80 EELN---LTNTGIEGTFQDFPFISLSNLAYVDLS-MNLLSGTIPPQFGNLSKLIYFDLST 135

Query:   141 NHLTGTIPSEIGSSRNLFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNKLDGLIPSSIG 200
             NHLTG I   +G+ +NL  L L  N L   IP E+GN++ +  L L  NKL G IPSS+G
Sbjct:   136 NHLTGEISPSLGNLKNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLG 195

Query:   201 NLTKLTGLNLSLNKLSGRLPREVGNLKILELLYLDSNNLTGPIPSTLYHLNPLIEWYLAY 260
             NL  L  L L  N L+G +P E+GN++ +  L L  N LTG IPSTL +L  L+  YL  
Sbjct:   196 NLKNLMVLYLYENYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYE 255

Query:   261 NNLVGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIG 320
             N L G +P E+GNM+++  L L +N LTG I S++G L  L +L L  N L G IP  +G
Sbjct:   256 NYLTGVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLG 315

Query:   321 XXXXXXXXXXXXXXXXGLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGY 380
                             G +P  +GNLK L    L  N L G IPP +G + ++  L L  
Sbjct:   316 NIESMIDLELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNN 375

Query:   381 NQLSSSIPPELMNCSQLQNLVLSHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLG 440
             N+L+ SIP    N   L  L L  N L+G+ P E+GN+  +  LDLS N + G++P   G
Sbjct:   376 NKLTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFG 435

Query:   441 NIPNISAVDLSKNNLSGVVPASVRR---IPKLIVSENN 475
             N   + ++ L  N+LSG +P  V     +  LI+  NN
Sbjct:   436 NFTKLESLYLRVNHLSGAIPPGVANSSHLTTLILDTNN 473
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054421 AT2G41820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131518 AT4G26540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query509
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-76
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-58
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-44
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-32
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-13
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 9e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  258 bits (660), Expect = 3e-76
 Identities = 168/416 (40%), Positives = 233/416 (56%), Gaps = 11/416 (2%)

Query: 55  SSWATANYTSDHCKWMGITCNSAGSIVEISSYEMDNNGNAAELSQFNFTCFPNLITFKIS 114
           S+W   N ++D C W GITCN++  +V I   ++     + ++S   F   P + T  +S
Sbjct: 49  SNW---NSSADVCLWQGITCNNSSRVVSI---DLSGKNISGKISSAIFR-LPYIQTINLS 101

Query: 115 GTGFLSGRIPSEIGALS-KLQVLNLSQNHLTGTIPSEIGSSRNLFQLDLSINILNGSIPL 173
               LSG IP +I   S  L+ LNLS N+ TG+IP   GS  NL  LDLS N+L+G IP 
Sbjct: 102 NNQ-LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPN 158

Query: 174 EIGNLKDLDYLMLQGNKLDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREVGNLKILELLY 233
           +IG+   L  L L GN L G IP+S+ NLT L  L L+ N+L G++PRE+G +K L+ +Y
Sbjct: 159 DIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIY 218

Query: 234 LDSNNLTGPIPSTLYHLNPLIEWYLAYNNLVGPLPKEVGNMKNLKILLLHRNNLTGPISS 293
           L  NNL+G IP  +  L  L    L YNNL GP+P  +GN+KNL+ L L++N L+GPI  
Sbjct: 219 LGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPP 278

Query: 294 TIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQLSGLLPREVGNLKYLDSRS 353
           +I  L  L  LDLS N L G IP  +  L NL  L L SN  +G +P  + +L  L    
Sbjct: 279 SIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQ 338

Query: 354 LDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQLQNLVLSHNTLSGIFPS 413
           L  N   G IP  +G   NLT L+L  N L+  IP  L +   L  L+L  N+L G  P 
Sbjct: 339 LWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPK 398

Query: 414 EIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLSGVVPASVRRIPKL 469
            +G    LR++ L  N  +G +PS+   +P +  +D+S NNL G + +    +P L
Sbjct: 399 SLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSL 454

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 509
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.98
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.95
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.93
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
PLN03150623 hypothetical protein; Provisional 99.55
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.21
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.21
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.19
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.18
PLN03150623 hypothetical protein; Provisional 99.18
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.15
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.13
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.13
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.89
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.77
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.7
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.58
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.43
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.33
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.32
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.31
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.29
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.24
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.16
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.14
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.08
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.91
PRK15386 426 type III secretion protein GogB; Provisional 97.91
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.72
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.67
PRK15386 426 type III secretion protein GogB; Provisional 97.61
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.55
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.46
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.43
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.39
KOG4341483 consensus F-box protein containing LRR [General fu 97.2
KOG4341483 consensus F-box protein containing LRR [General fu 97.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.99
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.64
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.56
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.43
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.42
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.68
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.42
KOG4308 478 consensus LRR-containing protein [Function unknown 94.76
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.48
KOG4308478 consensus LRR-containing protein [Function unknown 92.83
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.51
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.27
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.88
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.07
KOG0473 326 consensus Leucine-rich repeat protein [Function un 87.26
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.17
smart0037026 LRR Leucine-rich repeats, outliers. 84.98
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.98
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1e-55  Score=490.88  Aligned_cols=457  Identities=37%  Similarity=0.563  Sum_probs=324.5

Q ss_pred             CchhHHHHHHHHHHhccCCCCCCCCCCCCCCCCCCCCCCceecCCCCCEEEEEcCCCCCcccccccCCCccCCCCCCcEE
Q 035522           32 TASDASSAIQLEREALLNSGWWNSSWATANYTSDHCKWMGITCNSAGSIVEISSYEMDNNGNAAELSQFNFTCFPNLITF  111 (509)
Q Consensus        32 ~~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~~~~c~w~gv~c~~~~~v~~l~l~~~~~~~~~~~~~~~~l~~l~~L~~L  111 (509)
                      ..++|++||+++|+++.++.+++.+|..   ..++|.|.|++|+..++|+.|+++++.+.+.+    +..+..+++|+.|
T Consensus        26 ~~~~~~~~l~~~~~~~~~~~~~~~~w~~---~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~----~~~~~~l~~L~~L   98 (968)
T PLN00113         26 LHAEELELLLSFKSSINDPLKYLSNWNS---SADVCLWQGITCNNSSRVVSIDLSGKNISGKI----SSAIFRLPYIQTI   98 (968)
T ss_pred             CCHHHHHHHHHHHHhCCCCcccCCCCCC---CCCCCcCcceecCCCCcEEEEEecCCCccccC----ChHHhCCCCCCEE
Confidence            3568899999999999877777889974   67899999999987789999999999999877    7889999999999


Q ss_pred             ecCCCCCcceeCchhcc-CCCCCCEEEccCCcCCccCCccccCCCCCcEEeccCCcCCCcCCccCCCCCCCCEEECcCCC
Q 035522          112 KISGTGFLSGRIPSEIG-ALSKLQVLNLSQNHLTGTIPSEIGSSRNLFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNK  190 (509)
Q Consensus       112 ~l~~~~~~~~~~~~~~~-~l~~L~~L~L~~~~l~~~~~~~l~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~  190 (509)
                      ++++|. +.+.+|..+. .+++|++|++++|.+.+.+|.  +.+++|++|++++|.+.+.+|..++++++|++|++++|.
T Consensus        99 ~Ls~n~-~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~  175 (968)
T PLN00113         99 NLSNNQ-LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNV  175 (968)
T ss_pred             ECCCCc-cCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCc
Confidence            999999 8888887754 888899999888888776664  356777777777777777777777777777777777777


Q ss_pred             CCCCCcccccCCCCCCEEeccCCcCcccCCcccCCCCCCcEEECcCCCCCCCCchhhhCCCCcceeecccCcCCCCCchh
Q 035522          191 LDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREVGNLKILELLYLDSNNLTGPIPSTLYHLNPLIEWYLAYNNLVGPLPKE  270 (509)
Q Consensus       191 ~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~  270 (509)
                      +.+.+|..+.++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..+..+++|++|++++|.+.+.+|..
T Consensus       176 l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~  255 (968)
T PLN00113        176 LVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSS  255 (968)
T ss_pred             ccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChh
Confidence            77777777777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             ccCCCCcceeecccccccCcchhhhcCCCCCCEEECcCCCCCCCCccccCCCCCcCeeeCccccCCccCcccccCCCCCC
Q 035522          271 VGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQLSGLLPREVGNLKYLD  350 (509)
Q Consensus       271 l~~~~~L~~L~L~~n~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~ls~n~l~~~~~~~~~~l~~L~  350 (509)
                      +.++++|+.|++++|.+.+.+|..+..+++|++|++++|.+.+.+|..+..+++|++|++++|.+.+..|..+..+++|+
T Consensus       256 l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~  335 (968)
T PLN00113        256 LGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQ  335 (968)
T ss_pred             HhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCC
Confidence            77777777777777777666666666677777777777777666666666666777777776666666666666666666


Q ss_pred             EEEcCCCcCCCCCccccCCCCCCCEEECcCCcCcccCcccccCCccCc------------------------eeeeeccc
Q 035522          351 SRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQLQ------------------------NLVLSHNT  406 (509)
Q Consensus       351 ~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~------------------------~L~L~~n~  406 (509)
                      .|++++|.+.+.+|..+..+++|+.|++++|.+.+.+|..+..+++|+                        .|++++|+
T Consensus       336 ~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~  415 (968)
T PLN00113        336 VLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNS  415 (968)
T ss_pred             EEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCE
Confidence            666666666666666666666666666666666555555444444444                        44444444


Q ss_pred             CCCcCcccccCCCcCCeEecccCcCCcCChhhccCCCCCCEEeCcCCcCcccCCccc--cCCCeEecccCccccCCCCCC
Q 035522          407 LSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLSGVVPASV--RRIPKLIVSENNLELENSTSS  484 (509)
Q Consensus       407 l~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~~~~~~~~--~~l~~L~ls~N~l~~~~~ip~  484 (509)
                      +++.+|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|++.+.+|..+  .+++.|++++|++++  .+|.
T Consensus       416 l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~--~~~~  493 (968)
T PLN00113        416 FSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSG--AVPR  493 (968)
T ss_pred             eeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCC--ccCh
Confidence            444444444455555555555555555555444555555555555555555555432  345566666666666  5554


Q ss_pred             --CCCCCCCccCcCCCcC
Q 035522          485 --ENAPPPQAKPFKGNKG  500 (509)
Q Consensus       485 --~~~~~l~~l~l~~N~~  500 (509)
                        ..++++..+++++|..
T Consensus       494 ~~~~l~~L~~L~Ls~N~l  511 (968)
T PLN00113        494 KLGSLSELMQLKLSENKL  511 (968)
T ss_pred             hhhhhhccCEEECcCCcc
Confidence              4556666777777654

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query509
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-37
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-04
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-37
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-04
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-20
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-12
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 5e-10
2omz_A 466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-04
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-10
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 6e-10
2omv_A 461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 1e-09
1o6s_A 466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-09
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 2e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-09
2omy_A 461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 3e-09
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-04
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 6e-07
4b8c_D727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 5e-06
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 1e-04
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 1e-04
4eco_A636 Crystal Structure Of A Hypothetical Protein (Bacegg 1e-04
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 3e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 3e-04
2z64_A 599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 4e-04
3vq1_A 606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 4e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  115 bits (288), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 133/447 (29%), Positives = 186/447 (41%), Gaps = 59/447 (13%)
Query: 78  GSIVEISSYEMDNNGNAAELSQFNFTCFPNLITFKISGTGFLSGRIPSEIGALSKLQVLN 137
           G    +   ++  N  + + S+   TC   L    IS   F+ G IP     L  LQ L+
Sbjct: 220 GDCSALQHLDISGNKLSGDFSRAISTC-TELKLLNISSNQFV-GPIPPL--PLKSLQYLS 275
Query: 138 LSQNHLTGTIPSEI-GSSRNLFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNKLDGLIP 196
           L++N  TG IP  + G+   L  LDLS N   G++P   G+   L+ L L  N   G +P
Sbjct: 276 LAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELP 335
Query: 197 SSIGNLTKLTGL---NLSLNKLSGRLPREVGNLKI-LELLYLDSNNLTGPIPSTLYH--L 250
             +  L K+ GL   +LS N+ SG LP  + NL   L  L L SNN +GPI   L     
Sbjct: 336 --MDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK 393
Query: 251 NPLIEWYLAYNNLVGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNR 310
           N L E YL  N   G +P  + N   L  L L  N L+G I S++G L+ L  L L  N 
Sbjct: 394 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM 453
Query: 311 LDGPIPSTIGXXXXXXXXXXXXXXXXGLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYL 370
           L+G IP  +                 G +P  + N   L+  SL  N L G IP  IG L
Sbjct: 454 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 513
Query: 371 TNLTSLNLGYNQLSSSIPPELMNCSQLQNLVLSHNTLSGIFPSEI--------------- 415
            NL  L L  N  S +IP EL +C  L  L L+ N  +G  P+ +               
Sbjct: 514 ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGK 573
Query: 416 -----------------GNLTHLRQL--------------DLSHNFINGTIPSQLGNIPN 444
                            GNL   + +              +++     G       N  +
Sbjct: 574 RYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGS 633
Query: 445 ISAVDLSKNNLSGVVPASVRRIPKLIV 471
           +  +D+S N LSG +P  +  +P L +
Sbjct: 634 MMFLDMSYNMLSGYIPKEIGSMPYLFI 660
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query509
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-103
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-101
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-100
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-98
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-76
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-75
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-46
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-70
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-69
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-69
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-67
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-45
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-65
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-63
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-53
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-34
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-63
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-58
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-55
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-38
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-56
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-54
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-53
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-51
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-42
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-51
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-49
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-47
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-36
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-53
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-51
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-52
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-44
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-48
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-46
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-45
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-44
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-35
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-48
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-45
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-42
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-37
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-29
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-13
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-43
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-37
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-42
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-38
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-32
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-41
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-39
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-38
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-34
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-41
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-40
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-32
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-41
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-30
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-39
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-38
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-36
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-36
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-33
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-31
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-38
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-35
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-34
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-34
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-38
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-36
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-34
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-30
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-35
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-34
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-33
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-30
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-29
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-27
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-30
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-29
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-29
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-28
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-26
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-27
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-22
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-26
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-13
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-22
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-23
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-18
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-07
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  326 bits (837), Expect = e-103
 Identities = 122/385 (31%), Positives = 182/385 (47%), Gaps = 12/385 (3%)

Query: 105 FPNLITFKISGTGFLSGRIPSEIGALSKLQVLNLSQNHLTGTIPSEIGSSRNLFQLDLSI 164
              L    ISG   LSG     I   ++L++LN+S N   G IP      ++L  L L+ 
Sbjct: 222 CSALQHLDISGNK-LSGDFSRAISTCTELKLLNISSNQFVGPIPPLP--LKSLQYLSLAE 278

Query: 165 NILNGSIPLEI-GNLKDLDYLMLQGNKLDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREV 223
           N   G IP  + G    L  L L GN   G +P   G+ + L  L LS N  SG LP + 
Sbjct: 279 NKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDT 338

Query: 224 -GNLKILELLYLDSNNLTGPIPSTLYHLNPLIEW-YLAYNNLVGPLPKEVGN--MKNLKI 279
              ++ L++L L  N  +G +P +L +L+  +    L+ NN  GP+   +       L+ 
Sbjct: 339 LLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQE 398

Query: 280 LLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQLSGLL 339
           L L  N  TG I  T+   + L  L LS N L G IPS++G+L+ L  L L  N L G +
Sbjct: 399 LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 458

Query: 340 PREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQLQN 399
           P+E+  +K L++  LD N+L G IP  +   TNL  ++L  N+L+  IP  +     L  
Sbjct: 459 PQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAI 518

Query: 400 LVLSHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLSGVV 459
           L LS+N+ SG  P+E+G+   L  LDL+ N  NGTIP+ +          ++ N ++G  
Sbjct: 519 LKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSG----KIAANFIAGKR 574

Query: 460 PASVRRIPKLIVSENNLELENSTSS 484
              ++             L      
Sbjct: 575 YVYIKNDGMKKECHGAGNLLEFQGI 599
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query509
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.22
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.21
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.18
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.14
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.47
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.47
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.38
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.99
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.94
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.29
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.29
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-62  Score=531.94  Aligned_cols=469  Identities=30%  Similarity=0.444  Sum_probs=316.0

Q ss_pred             ccCchhHHHHHHHHHHhccCCCCCCCCCCCCCCCCCCCCCCceecCCCCCEEEEEcCCCCCccc---ccc----------
Q 035522           30 VLTASDASSAIQLEREALLNSGWWNSSWATANYTSDHCKWMGITCNSAGSIVEISSYEMDNNGN---AAE----------   96 (509)
Q Consensus        30 ~~~~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~~~~c~w~gv~c~~~~~v~~l~l~~~~~~~~---~~~----------   96 (509)
                      +.+.++|++||++||+++.||. .+++|..   ++|||.|.||+|+ .++|+.|++++.++.|.   +.+          
T Consensus         7 ~~~~~~~~~all~~k~~~~~~~-~l~~W~~---~~~~C~w~gv~C~-~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~   81 (768)
T 3rgz_A            7 SQSLYREIHQLISFKDVLPDKN-LLPDWSS---NKNPCTFDGVTCR-DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLES   81 (768)
T ss_dssp             -CCHHHHHHHHHHHHTTCSCTT-SSTTCCT---TSCGGGSTTEEEE-TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCE
T ss_pred             ccCCHHHHHHHHHHHhhCCCcc-cccCCCC---CCCCcCCcceEEC-CCcEEEEECCCCCcCCccCccChhHhccCcccc
Confidence            4557789999999999998887 8999974   6899999999998 78999999999998875   210          


Q ss_pred             ---------cCCCccCCCCCCcEEecCCCCCcceeCch--hccCCCCCCEEEccCCcCCccCCccc-c------------
Q 035522           97 ---------LSQFNFTCFPNLITFKISGTGFLSGRIPS--EIGALSKLQVLNLSQNHLTGTIPSEI-G------------  152 (509)
Q Consensus        97 ---------~~~~~l~~l~~L~~L~l~~~~~~~~~~~~--~~~~l~~L~~L~L~~~~l~~~~~~~l-~------------  152 (509)
                               ..+..+..+++|++|++++|. +.|.+|.  .++++++|++|++++|.+.+..|..+ .            
T Consensus        82 l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~-l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~  160 (768)
T 3rgz_A           82 LFLSNSHINGSVSGFKCSASLTSLDLSRNS-LSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSA  160 (768)
T ss_dssp             EECTTSCEEECCCCCCCCTTCCEEECCSSE-EEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCS
T ss_pred             cCCcCCCcCCCchhhccCCCCCEEECCCCc-CCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCC
Confidence                     012567888999999999998 8888887  78888888888887776665554432 2            


Q ss_pred             -------------------------------------CCCCCcEEeccCCcCCCcCCccCCCCCCCCEEECcCCCCCCCC
Q 035522          153 -------------------------------------SSRNLFQLDLSINILNGSIPLEIGNLKDLDYLMLQGNKLDGLI  195 (509)
Q Consensus       153 -------------------------------------~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~  195 (509)
                                                           .+++|++|++++|.+.+.+|. ++++++|++|++++|.+++.+
T Consensus       161 n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~  239 (768)
T 3rgz_A          161 NSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDF  239 (768)
T ss_dssp             SCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCH
T ss_pred             CccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcc
Confidence                                                 334444555555555544444 666777777777777776666


Q ss_pred             cccccCCCCCCEEeccCCcCcc----------------------cCCcccCCC-CCCcEEECcCCCC-------------
Q 035522          196 PSSIGNLTKLTGLNLSLNKLSG----------------------RLPREVGNL-KILELLYLDSNNL-------------  239 (509)
Q Consensus       196 ~~~l~~l~~L~~L~l~~n~l~~----------------------~~~~~l~~l-~~L~~L~l~~n~l-------------  239 (509)
                      |..+.++++|++|++++|.+.+                      .+|..+... ++|++|++++|.+             
T Consensus       240 ~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~  319 (768)
T 3rgz_A          240 SRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSL  319 (768)
T ss_dssp             HHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTT
T ss_pred             cHHHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCC
Confidence            6666665555555555544432                      233332221 3333333333332             


Q ss_pred             -----------CCCCchh-hhCCCCcceeecccCc---------------------------------------------
Q 035522          240 -----------TGPIPST-LYHLNPLIEWYLAYNN---------------------------------------------  262 (509)
Q Consensus       240 -----------~~~~~~~-l~~~~~L~~L~l~~n~---------------------------------------------  262 (509)
                                 .+.+|.. +..+++|++|++++|.                                             
T Consensus       320 L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L  399 (768)
T 3rgz_A          320 LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQEL  399 (768)
T ss_dssp             CCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEE
T ss_pred             ccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEE
Confidence                       2222221 2222222222222222                                             


Q ss_pred             ------CCCCCchhccCCCCcceeecccccccCcchhhhcCCCCCCEEECcCCC------------------------CC
Q 035522          263 ------LVGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNR------------------------LD  312 (509)
Q Consensus       263 ------~~~~~~~~l~~~~~L~~L~L~~n~~~~~~~~~~~~~~~L~~L~l~~n~------------------------l~  312 (509)
                            +++.+|..+..+++|+.|++++|.+++.+|..++.+++|++|++++|.                        ++
T Consensus       400 ~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~  479 (768)
T 3rgz_A          400 YLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLT  479 (768)
T ss_dssp             ECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCC
T ss_pred             ECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCccc
Confidence                  222233334445566666666666655555555555555555555544                        44


Q ss_pred             CCCccccCCCCCcCeeeCccccCCccCcccccCCCCCCEEEcCCCcCCCCCccccCCCCCCCEEECcCCcCcccCcccc-
Q 035522          313 GPIPSTIGNLTNLTSLVLSSNQLSGLLPREVGNLKYLDSRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPEL-  391 (509)
Q Consensus       313 ~~~~~~~~~l~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~-  391 (509)
                      +.+|..+..+++|++|++++|++++.+|..++.+++|++|++++|++.+.+|..+..+++|++|++++|.+++.+|..+ 
T Consensus       480 ~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~  559 (768)
T 3rgz_A          480 GEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMF  559 (768)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGG
T ss_pred             CcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHh
Confidence            4445555555555555555555555555555555666666666666655566666666666666666666655544322 


Q ss_pred             ---------------------------------------------------------------------cCCccCceeee
Q 035522          392 ---------------------------------------------------------------------MNCSQLQNLVL  402 (509)
Q Consensus       392 ---------------------------------------------------------------------~~~~~L~~L~L  402 (509)
                                                                                           ..+++|+.|++
T Consensus       560 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdL  639 (768)
T 3rgz_A          560 KQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDM  639 (768)
T ss_dssp             TTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEEC
T ss_pred             cccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEEC
Confidence                                                                                 22456778888


Q ss_pred             ecccCCCcCcccccCCCcCCeEecccCcCCcCChhhccCCCCCCEEeCcCCcCcccCCccccC---CCeEecccCccccC
Q 035522          403 SHNTLSGIFPSEIGNLTHLRQLDLSHNFINGTIPSQLGNIPNISAVDLSKNNLSGVVPASVRR---IPKLIVSENNLELE  479 (509)
Q Consensus       403 ~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~ls~N~l~~~~~~~~~~---l~~L~ls~N~l~~~  479 (509)
                      ++|++++.+|..++.+++|+.|+|++|.++|.+|..++.+++|+.||+++|+++|.+|..+.+   |++||+++|+++| 
T Consensus       640 s~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g-  718 (768)
T 3rgz_A          640 SYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSG-  718 (768)
T ss_dssp             CSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEE-
T ss_pred             cCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccc-
Confidence            888888889999999999999999999999999999999999999999999999999987654   5599999999999 


Q ss_pred             CCCCC-CCCCCCCccCcCCCcCCCCcccc
Q 035522          480 NSTSS-ENAPPPQAKPFKGNKGKQRKIVT  507 (509)
Q Consensus       480 ~~ip~-~~~~~l~~l~l~~N~~lc~~~~~  507 (509)
                       .||. ++|..+...++.|||++||.++.
T Consensus       719 -~iP~~~~~~~~~~~~~~gN~~Lcg~~l~  746 (768)
T 3rgz_A          719 -PIPEMGQFETFPPAKFLNNPGLCGYPLP  746 (768)
T ss_dssp             -ECCSSSSGGGSCGGGGCSCTEEESTTSC
T ss_pred             -cCCCchhhccCCHHHhcCCchhcCCCCc
Confidence             9998 78999999999999999998874
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 509
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-23
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-23
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-16
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-22
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-21
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-20
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-20
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-16
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-08
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 8e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 97.8 bits (242), Expect = 3e-23
 Identities = 62/289 (21%), Positives = 104/289 (35%), Gaps = 15/289 (5%)

Query: 170 SIPLEIGNLKDLDYLMLQGNKLDGLIPSSIGNLTKLTGLNLSLNKLSGRLPREVGNLKIL 229
            +P ++    D   L LQ NK+  +      NL  L  L L  NK+S   P     L  L
Sbjct: 24  KVPKDLP--PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKL 81

Query: 230 ELLYLDSNNLTGPIPSTLYHLNPLIEWYLAYNNLVGPLPKEVGNMKNLKILLLHRNNLTG 289
           E LYL  N L   +P  +      +  +      V        N   +  L  +    +G
Sbjct: 82  ERLYLSKNQLKE-LPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSG 140

Query: 290 PISSTIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQLSGLLPREVGNLKYL 349
             +     +  L  + ++   +   IP   G   +LT L L  N+++ +    +  L  L
Sbjct: 141 IENGAFQGMKKLSYIRIADTNIT-TIPQ--GLPPSLTELHLDGNKITKVDAASLKGLNNL 197

Query: 350 DSRSLDGNNLIGPIPPTIGYLTNLTSLNLGYNQLSSSIPPELMNCSQLQNLVLSHNTLSG 409
               L  N++      ++    +L  L+L  N+L   +P  L +   +Q + L +N +S 
Sbjct: 198 AKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVK-VPGGLADHKYIQVVYLHNNNISA 256

Query: 410 I------FPSEIGNLTHLRQLDLSHNFINGT--IPSQLGNIPNISAVDL 450
           I       P           + L  N +      PS    +   +AV L
Sbjct: 257 IGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQL 305
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query509
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.52
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.33
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.79
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.73
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.13
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.89
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=4.3e-39  Score=308.86  Aligned_cols=294  Identities=30%  Similarity=0.478  Sum_probs=187.1

Q ss_pred             cCchhHHHHHHHHHHhccCCCCCCCCCCCCCCCCCCCC--CCceecCCC---CCEEEEEcCCCCCcccccccCCCccCCC
Q 035522           31 LTASDASSAIQLEREALLNSGWWNSSWATANYTSDHCK--WMGITCNSA---GSIVEISSYEMDNNGNAAELSQFNFTCF  105 (509)
Q Consensus        31 ~~~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~~~~c~--w~gv~c~~~---~~v~~l~l~~~~~~~~~~~~~~~~l~~l  105 (509)
                      .|.++|++||++||+++.++. .+++|..   ++|||.  |.||+|+..   .||++|+++++++.|...  .+..+.++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~---~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~--lp~~l~~L   75 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLP---TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYP--IPSSLANL   75 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCT---TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEE--CCGGGGGC
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCCC---CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCC--CChHHhcC
Confidence            589999999999999997764 6889975   789994  999999854   379999999988877320  15667777


Q ss_pred             CCCcEEecCC-CCCcceeCchhccCCCCCCEEEccCCcCCccCCccccCCCCCcEEeccCCcCCCcCCccCCCCCCCCEE
Q 035522          106 PNLITFKISG-TGFLSGRIPSEIGALSKLQVLNLSQNHLTGTIPSEIGSSRNLFQLDLSINILNGSIPLEIGNLKDLDYL  184 (509)
Q Consensus       106 ~~L~~L~l~~-~~~~~~~~~~~~~~l~~L~~L~L~~~~l~~~~~~~l~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L  184 (509)
                      ++|++|++++ |. +.|.+|..|+++++|++|++++|++.+..+..+..+.+|+++++++|.+.+.+|..+.++++|+++
T Consensus        76 ~~L~~L~Ls~~N~-l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l  154 (313)
T d1ogqa_          76 PYLNFLYIGGINN-LVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGI  154 (313)
T ss_dssp             TTCSEEEEEEETT-EESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEE
T ss_pred             ccccccccccccc-cccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCccccee
Confidence            7777777765 45 666777777777777777777777776666667777777777777776666666666667777777


Q ss_pred             ECcCCCCCCCCcccccCCCCC-CEEeccCCcCcccCCcccCCCCCCcEEECcCCCCCCCCchhhhCCCCcceeecccCcC
Q 035522          185 MLQGNKLDGLIPSSIGNLTKL-TGLNLSLNKLSGRLPREVGNLKILELLYLDSNNLTGPIPSTLYHLNPLIEWYLAYNNL  263 (509)
Q Consensus       185 ~L~~n~~~~~~~~~l~~l~~L-~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~l~~n~~  263 (509)
                      ++++|.+.+.+|..+..+.++ +.+++++|++++..|..+..+..+ .+++..+...+.+|..+..+++++.+++.++.+
T Consensus       155 ~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l  233 (313)
T d1ogqa_         155 TFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSL  233 (313)
T ss_dssp             ECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEE
T ss_pred             eccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccccccccccccccccccc
Confidence            777776666666666666554 566666666666655555544333 455555555555555555555555555555554


Q ss_pred             CCCCchhccCCCCcceeecccccccCcchhhhcCCCCCCEEECcCCCCCCCCccccCCCCCcCeeeCcccc
Q 035522          264 VGPLPKEVGNMKNLKILLLHRNNLTGPISSTIGYLNLLEILDLSHNRLDGPIPSTIGNLTNLTSLVLSSNQ  334 (509)
Q Consensus       264 ~~~~~~~l~~~~~L~~L~L~~n~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~ls~n~  334 (509)
                      .+.++ .+..+++|+.|++++|++++.+|..++.+++|++|++++|+++|.+|. +.++++|+.+++++|+
T Consensus       234 ~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         234 AFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             ccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence            44332 244444455555555555444444444444555555555544444442 2344444444444443
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure