Citrus Sinensis ID: 035547

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480--
NTSFLGTLPDSIGTLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIPSLHKSRNLNYLDLSSNNLNEIHLLSNNQFENQFPEISNMSSSFSKLRLASSKPWVIPILKNQSQLSFFYISNNQISGEIPNWIWEVGGVNLYFLNLSQNLLVSLQEPYHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTLGVLNLRRNNLGVVLKSLANCNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSERISCPRNNVSWPLLKIVDLASNKFSGRLSQKWLLTMMIIQLKIPNIFTSIDCSSNNFEGPMPEEMGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLLMNNLMGKIPTSTQLQSFLPTSYEGNKGLYIPPLTNDIQTHPPESQPLPPPASSNEIDWFFIAISIGFAVSFGAVVSPLMFFVHVKKWYNDLIYKFIYRRFR
cccEEccccHHHcccccccEEEcccccccccccccccccccccEEEccccccEEEcccccccccccEEEccccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccccccEEEccccccEEcccHHHHccccccEEEcccccccccccHHHHHcccccccEEEccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHHHHHHHHHccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcc
cccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccccccccEEEEccccccccEccccccccccccHHHHccccccEEEcccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEEccccccccccHcHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHccccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEcccccccccccccHHccccccEEEEcccccccccccHHHcccccHHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEEccccccccccccHccccccHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
ntsflgtlpdsigtlenltrvdlrsynftrpiptsMANLAQLFhmdfssnhfsgpipslhksrnlnyldlssnnlneihllsnnqfenqfpeisnmsssfsklrlasskpwvipilknqsqLSFFYIsnnqisgeipnwiwevgGVNLYFLNLSQNLLVSlqepyhisgrtysfSTINKSLIGFIPEYICKATYFQVLDLsnnnlsgsipaclitkssttlGVLNLRRNNLGVVLKSLANCNMLQVLDLrnnhisdnfpcwlrnAFSLQVLVFRSnnfseriscprnnvswplLKIVDLASNKFSGRLSQKWLLTMMIIQLKipniftsidcssnnfegpmpeemgrfkslyapnmshnalkgsipssfgnlkQIESLDLLMNNlmgkiptstqlqsflptsyegnkglyippltndiqthppesqplpppassneidWFFIAISIGFAVSFGAVVSPLMFFVHVKKWYNDLIYKFIYRRFR
ntsflgtlpdsigtlenltrVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIPSLHKSRNLNYLDLSSNNLNEIHLLSNNQFENQFPEISNMSSSFSKLRLASSKPWVIPILKNQSQLSFFYISNNQISGEIPNWIWEVGGVNLYFLNLSQNLLVSLQEPYHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTLGVLNLRRNNLGVVLKSLANCNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSeriscprnnvswpLLKIVDLASNKFSGRLSQKWLLTMMIIQLKIPNIFTSIDCSSNNFEGPMPEEMGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLLMNNLMGKIPTSTQLQSFLPTSYEGNKGLYIPPLTNDIQTHPPESQPLPPPASSNEIDWFFIAISIGFAVSFGAVVSPLMFFVHVKKWYNDLIYKFIYRRFR
NTSFLGTLPDSIGTLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIPSLHKsrnlnyldlssnnlnEIHLLSNNQFENQFPEISNMsssfsklrlasskPWVIPILKNQSQLSFFYISNNQISGEIPNWIWEVGGVNLYFlnlsqnllvslqEPYHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTlgvlnlrrnnlgvvlKSLANCNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSERISCPRNNVSWPLLKIVDLASNKFSGRLSQKWLLTMMIIQLKIPNIFTSIDCSSNNFEGPMPEEMGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLLMNNLMGKIPTSTQLQSFLPTSYEGNKGLYIPPLTNDIQTHppesqplpppassNEIDWFFIAISIGFAVSFGAVVSPLMFFVHVKKWYNDLIYKFIYRRFR
**********SIGTLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPI******RNLNYLDLSSNNLNEIHLLS**********************LASSKPWVIPILKNQSQLSFFYISNNQISGEIPNWIWEVGGVNLYFLNLSQNLLVSLQEPYHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTLGVLNLRRNNLGVVLKSLANCNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSERISCPRNNVSWPLLKIVDLASNKFSGRLSQKWLLTMMIIQLKIPNIFTSIDCS*************************************NLKQIESLDLLMNNLMGKIPTSTQLQSFLPTSYEGNKGLYIPP***********************IDWFFIAISIGFAVSFGAVVSPLMFFVHVKKWYNDLIYKFIYRR**
NTSFLGTLPDSIGTLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIPSLHKSRNLNYLDLSSNNLNEIHLLSNNQFENQFPEISNMSSSFSKLRLASSKPWVIPILKNQSQLSFFYISNNQISGEIPNWIWEVGGVNLYFLNLSQNLLVSLQEPYHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTLGVLNLRRNNLGVVLKSLANCNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSERISCPRNNVSWPLLKIVDLASNKFSGRLSQKWLLTMMIIQLKIPNIFTSIDCSSNNFEGPMPEEMGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLLMNNLMGKIPTSTQLQSFLPTSYEGNKGLYIPPL*************************FFIAISIGFAVSFGAVVSPLMFFVHVKKWYNDLIYKFIYRRFR
NTSFLGTLPDSIGTLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIPSLHKSRNLNYLDLSSNNLNEIHLLSNNQFENQFPEISNMSSSFSKLRLASSKPWVIPILKNQSQLSFFYISNNQISGEIPNWIWEVGGVNLYFLNLSQNLLVSLQEPYHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTLGVLNLRRNNLGVVLKSLANCNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSERISCPRNNVSWPLLKIVDLASNKFSGRLSQKWLLTMMIIQLKIPNIFTSIDCSSNNFEGPMPEEMGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLLMNNLMGKIPTSTQLQSFLPTSYEGNKGLYIPPLTNDIQTHP*********ASSNEIDWFFIAISIGFAVSFGAVVSPLMFFVHVKKWYNDLIYKFIYRRFR
***FLGTLPDSIGTLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIPSLHKSRNLNYLDLSSNNLNEIHLLSNNQFENQFPEISNMSSSFSKLRLASSKPWVIPILKNQSQLSFFYISNNQISGEIPNWIWEVGGVNLYFLNLSQNLLVSLQEPYHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTLGVLNLRRNNLGVVLKSLANCNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSERISCPRNNVSWPLLKIVDLASNKFSGRLSQKWLLTMMIIQLKIPNIFTSIDCSSNNFEGPMPEEMGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLLMNNLMGKIPTSTQLQSFLPTSYEGNKGLYIPPLTNDI***************SNEIDWFFIAISIGFAVSFGAVVSPLMFFVHVKKWYNDLIYKFIY****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NTSFLGTLPDSIGTLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIPSLHKSRNLNYLDLSSNNLNEIHLLSNNQFENQFPEISNMSSSFSKLRLASSKPWVIPILKNQSQLSFFYISNNQISGEIPNWIWEVGGVNLYFLNLSQNLLVSLQEPYHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTLGVLNLRRNNLGVVLKSLANCNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSERISCPRNNVSWPLLKIVDLASNKFSGRLSQKWLLTMMIIQLKIPNIFTSIDCSSNNFEGPMPEEMGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLLMNNLMGKIPTSTQLQSFLPTSYEGNKGLYIPPLTNDIQTHPPESQPLPPPASSNEIDWFFIAISIGFAVSFGAVVSPLMFFVHVKKWYNDLIYKFIYRRFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query482 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.962 0.547 0.267 2e-35
Q8VZG8 1045 Probable LRR receptor-lik no no 0.724 0.333 0.307 7e-29
C0LGS2 1136 Probable LRR receptor-lik no no 0.780 0.330 0.318 2e-28
C0LGQ5 1249 LRR receptor-like serine/ no no 0.763 0.294 0.300 2e-28
Q9FRS6 1029 Leucine-rich repeat recep no no 0.937 0.439 0.259 8e-28
O49318 1124 Probable leucine-rich rep no no 0.817 0.350 0.287 1e-27
Q9LVP0 1102 Probable leucine-rich rep no no 0.887 0.388 0.296 5e-27
Q42371 976 LRR receptor-like serine/ no no 0.794 0.392 0.303 7e-27
Q6XAT2 967 LRR receptor-like serine/ no no 0.792 0.395 0.297 8e-27
O49545 1003 Leucine-rich repeat recep no no 0.834 0.400 0.275 2e-26
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  150 bits (379), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 154/575 (26%), Positives = 228/575 (39%), Gaps = 111/575 (19%)

Query: 1   NTSFLGTLPDSIGTLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIP--- 57
           N S  G +P S   L  L+   L S NFT   P  M+    L + D S N FSGP P   
Sbjct: 263 NNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSL 322

Query: 58  -------SLHKSRN-----LNYLDLSSNNLNEIHLLSNNQFENQFPEISNMSSSFSKLRL 105
                  S++   N     + + + SS+   +  +L  N+     PE  +   +  +L +
Sbjct: 323 LLIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDI 382

Query: 106 ASS--KPWVIPILKNQSQLSFFYISNNQISGEIPNWIWEVGGVNLYFLNLSQNLLVSLQE 163
           + +     + P +     L    +S N + GE+P  +W      L  + LS N   S + 
Sbjct: 383 SHNNFTGAIPPTISKLVNLLHLDLSKNNLEGEVPACLWR-----LNTMVLSHNSFSSFEN 437

Query: 164 PYHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACL---------- 213
                         + S  G IP  ICK +    LDLSNN  SGSIP+C+          
Sbjct: 438 TSQEEALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKEL 497

Query: 214 -------------ITKSSTTLGVLNLRRNNL-GVVLKSLANCNMLQVLDLRNNHISDNFP 259
                        I   +T L  L++  N L G   KSL NC  L+++++ +N I D FP
Sbjct: 498 NLGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFP 557

Query: 260 CWLRNAFSLQVLVFRSNNFSERISCPRNNVSWPLLKIVDLASNKFSG------------- 306
            WL +  SL VL  RSN F   +     ++ +  L+I+D++ N FSG             
Sbjct: 558 SWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDM 617

Query: 307 ---------------RLSQKWLLTMMIIQL-------KIPNIFTSIDCSSNNFEGPMPEE 344
                          R +  +   M ++         +I   F +ID S N   G +PE 
Sbjct: 618 TTLTEEMDQYMTEFWRYADSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPES 677

Query: 345 MGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLLMNNLMGKIPT------------- 391
           +G  K L   N+S NA    IP    NL ++E+LD+  N L G+IP              
Sbjct: 678 LGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNF 737

Query: 392 -----------STQLQSFLPTSYEGNKGLY-IPPLTNDIQTHPPESQPLPP---PASSNE 436
                       TQ Q    +S+  N GLY +  +  D     P SQ LP     A  N 
Sbjct: 738 SHNLLQGPVPRGTQFQRQKCSSFLDNPGLYGLEDICRDTGALNPTSQ-LPEDLSEAEENM 796

Query: 437 IDWFFIAISIGFAVSFGAVVSPLMFFVHVKKWYND 471
            +W   AI+ G  V  G V+    +  H  +W+ +
Sbjct: 797 FNWVAAAIAYGPGVLCGLVIGHF-YTSHNHEWFTE 830
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query482
214011438 1128 GbVe [Gossypium barbadense] 0.952 0.406 0.378 4e-83
297735650 2134 unnamed protein product [Vitis vinifera] 0.970 0.219 0.407 3e-82
224139184 1032 predicted protein [Populus trichocarpa] 0.968 0.452 0.360 5e-79
359481298 1070 PREDICTED: LRR receptor-like serine/thre 0.970 0.437 0.348 8e-78
147770395 1003 hypothetical protein VITISV_004262 [Viti 0.989 0.475 0.346 6e-77
359481304 1057 PREDICTED: LRR receptor-like serine/thre 0.937 0.427 0.368 8e-76
147806063 1032 hypothetical protein VITISV_032508 [Viti 0.989 0.462 0.342 3e-75
359481293 1197 PREDICTED: leucine-rich repeat receptor 0.968 0.390 0.348 5e-74
37956237 1051 resistance protein SlVe1 precursor [Sola 0.935 0.429 0.348 8e-74
356506584 1067 PREDICTED: LRR receptor-like serine/thre 0.933 0.421 0.352 1e-73
>gi|214011438|gb|ACJ61469.1| GbVe [Gossypium barbadense] Back     alignment and taxonomy information
 Score =  315 bits (807), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 234/618 (37%), Positives = 298/618 (48%), Gaps = 159/618 (25%)

Query: 4    FLGTLPDSIGTLENLTRVDLRSYNFTR-PIPTSMANLAQLFHMDFSSNHFSGPI--PSLH 60
            F G+L D  G    L      S N  +   P  +  L  L  +  SSN FSG I    + 
Sbjct: 436  FNGSLGDLRGKTTLLLDTLDLSSNMLQGQFPMFVFELQGLKILTISSNKFSGFIQWTDIQ 495

Query: 61   KSRNLNYLDLSSNNLNEIHLLSNNQFENQFPEISNMSSSFSKLRLASSKPWVIP-ILKNQ 119
            K RNL+ LDLS NNL+ I   S N   + FP I+        L+LAS      P  LK Q
Sbjct: 496  KLRNLSNLDLSYNNLS-IDATSTNSALSTFPNITT-------LKLASCNLKKFPGFLKTQ 547

Query: 120  SQLSFFYISNNQISGEIPNWIWEVGGVNLYFLNLSQNLLVSLQEPY-------------- 165
             +L+   +S NQ+SGEIPNW+WE+   NL +LNLSQN L+  + P+              
Sbjct: 548  VKLNHLDLSKNQMSGEIPNWVWEIK--NLAYLNLSQNSLMKFEGPFLSITSTLTVVDLHG 605

Query: 166  -HISGR--------------------------------TYSFSTINKSLIGFIPEYICKA 192
              + G+                                 Y FS  + +  G IPE ICK+
Sbjct: 606  NQLQGQIDRLPQYATYLDYSRNNFSSVLPRDIGDFLQFAYFFSISDNNFHGSIPESICKS 665

Query: 193  TYFQVLDLSNNNLSGSIPACLITKSSTTLGVLNLRRNNL--------------------- 231
            +Y QVLDLSNN+LSGSIP CLI + S +LGVLNLRRNNL                     
Sbjct: 666  SYLQVLDLSNNSLSGSIPECLI-QMSVSLGVLNLRRNNLTGNISDTFPENCLLQTLVLNR 724

Query: 232  ----GVVLKSLANCNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSERISCPRN 287
                G V KSL +C ML+VLDL NN I+D FPC L+N  SL+VLV R N F+  + C   
Sbjct: 725  NLLRGKVPKSLVSCKMLEVLDLGNNQINDTFPCHLKNISSLRVLVLRGNKFNGNVHCSER 784

Query: 288  NVSWPLLKIVDLASNKFSGRLSQKWLLTMMIIQ--------------------------- 320
            +  WP+L+IVDL+SN FSGRL +  L T   ++                           
Sbjct: 785  S-PWPMLQIVDLSSNSFSGRLHEACLSTWKAMRAAESETLSELNHLQFKVLKLNQFYYQD 843

Query: 321  -------------LKIPNIFTSIDCSSNNFEGPMPEEMGRFKSLYAPNMSHNALKGSIPS 367
                         LKI  +FTSID S NNFEGP+PE +G FK+LY  N SHNA  GSIP 
Sbjct: 844  AITVTMKGLELELLKILTVFTSIDISRNNFEGPIPEVIGTFKALYVLNFSHNAFTGSIPP 903

Query: 368  SFGNLKQIESLDLLMNN------------------------LMGKIPTSTQLQSFLPTSY 403
            S GNL Q+ESLDL  N+                        L G+IP STQ+QSF   S+
Sbjct: 904  SLGNLSQLESLDLSSNSFDGEIPIQLANLNFISFLNVSNNKLEGQIPRSTQIQSFSEASF 963

Query: 404  EGNKGLYIPPLTNDI----QTHPPESQPLPPPASSNEIDWFFIAISIGFAVSFGAVVSPL 459
            E NKGL   PLT D        P  +Q   P   ++E DW FI I +GF V     V+PL
Sbjct: 964  ENNKGLCGLPLTTDCVNGTSPKPRTTQEFQP---ADEFDWQFIFIGVGFGVGAALFVAPL 1020

Query: 460  MFFVHVKKWYNDLIYKFI 477
            +F+    KW ++++ K +
Sbjct: 1021 IFWKTASKWVDEIVDKIL 1038

Source: Gossypium barbadense

Species: Gossypium barbadense

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297735650|emb|CBI18144.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224139184|ref|XP_002323001.1| predicted protein [Populus trichocarpa] gi|222867631|gb|EEF04762.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359481298|ref|XP_003632604.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770395|emb|CAN78148.1| hypothetical protein VITISV_004262 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481304|ref|XP_002270356.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147806063|emb|CAN76702.1| hypothetical protein VITISV_032508 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481293|ref|XP_003632602.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|37956237|gb|AAP20228.1| resistance protein SlVe1 precursor [Solanum lycopersicoides] gi|37956239|gb|AAP20229.1| resistance protein SlVe1 precursor [Solanum lycopersicoides] Back     alignment and taxonomy information
>gi|356506584|ref|XP_003522059.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query482
TAIR|locus:2096339 786 RLP30 "receptor like protein 3 0.695 0.426 0.25 1.3e-29
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.645 0.316 0.251 2.7e-28
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.566 0.306 0.299 6.5e-27
TAIR|locus:2094563595 RLP36 "receptor like protein 3 0.751 0.608 0.274 6.9e-27
TAIR|locus:2046357890 RLP23 "receptor like protein 2 0.624 0.338 0.262 1.3e-26
TAIR|locus:2096349 860 RLP31 "receptor like protein 3 0.778 0.436 0.258 2.9e-20
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.788 0.323 0.254 3.8e-26
TAIR|locus:2040035671 RLP20 "receptor like protein 2 0.614 0.441 0.261 2.3e-25
TAIR|locus:2090754711 RLP43 "receptor like protein 4 0.655 0.444 0.283 2.6e-25
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.603 0.336 0.260 3.6e-25
TAIR|locus:2096339 RLP30 "receptor like protein 30" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 238 (88.8 bits), Expect = 1.3e-29, Sum P(2) = 1.3e-29
 Identities = 90/360 (25%), Positives = 138/360 (38%)

Query:     4 FLGTLPDSIGTLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIPSLHKXX 63
             F  TLP  +  L NL   D+R  +F    PTS+  +  L  +    N F GPI       
Sbjct:   220 FKSTLPSDMSGLHNLKYFDVRENSFVGTFPTSLFTIPSLQIVYLEGNQFMGPIK------ 273

Query:    64 XXXXXXXXXXXXXEIHLLSNNQFENQFPE-ISNMXXXXXXXXXXXXXPWVIPI-LKNQSQ 121
                          +++L ++N+F+   PE IS +                IP  +     
Sbjct:   274 --FGNISSSSRLWDLNL-ADNKFDGPIPEYISEIHSLIVLDLSHNNLVGPIPTSISKLVN 330

Query:   122 LSFFYISNNQISGEIPNWIWEVGGVNLYFXXXXXXXXXXXXEPYHISGRTYSFSTI-NKS 180
             L    +SNN + GE+P  +W +  V L                  + G +     + + S
Sbjct:   331 LQHLSLSNNTLEGEVPGCLWGLMTVTLSHNSFNSFGKSSSGA---LDGESMQELDLGSNS 387

Query:   181 LIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTXXXXXXXXXXXXXXXKSLAN 240
             L G  P +ICK  + + LDLSNN  +GSIP CL   +                      N
Sbjct:   388 LGGPFPHWICKQRFLKYLDLSNNLFNGSIPPCLKNSTYWLKGLVLRNNSFSGFLPDVFVN 447

Query:   241 CNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSERISCPRNNVSWPLLKIVDLA 300
              +ML  LD+  N +    P  L N   +++L   SN   +    P   VS P L+++ L 
Sbjct:   448 ASMLLSLDVSYNRLEGKLPKSLINCTGMELLNVGSNIIKDTF--PSWLVSLPSLRVLILR 505

Query:   301 SNKFSGRLSQKWLLTMMIIQLKIPNIFTSIDCSSNNFEGPM-PEEMGRFKSLYAPNMSHN 359
             SN F G L    + +     L++      ID S N F G + P     ++ +    +  N
Sbjct:   506 SNAFYGSLYYDHI-SFGFQHLRL------IDISQNGFSGTLSPLYFSNWREMVTSVLEEN 558
GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0010204 "defense response signaling pathway, resistance gene-independent" evidence=IMP
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0007154 "cell communication" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0009409 "response to cold" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0010583 "response to cyclopentenone" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0043069 "negative regulation of programmed cell death" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094563 RLP36 "receptor like protein 36" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096349 RLP31 "receptor like protein 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040035 RLP20 "receptor like protein 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query482
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-33
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-32
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  133 bits (336), Expect = 3e-33
 Identities = 124/424 (29%), Positives = 192/424 (45%), Gaps = 62/424 (14%)

Query: 1   NTSFLGTLPDSIGTLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIPS-L 59
           N    G +P+ IG+  +L  +DL        IP S+ NL  L  +  +SN   G IP  L
Sbjct: 149 NNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPREL 208

Query: 60  HKSRNLNYLDLSSNNL-----NEI-HLLSNNQFENQFPEISNMSSSFSKLRLASSKPWVI 113
            + ++L ++ L  NNL      EI  L S N  +  +   +N++              + 
Sbjct: 209 GQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVY---NNLTGP------------IP 253

Query: 114 PILKNQSQLSFFYISNNQISGEIPNWIWEVGGVNLYFLNLSQN--------LLVSLQ--E 163
             L N   L + ++  N++SG IP  I+ +    L  L+LS N        L++ LQ  E
Sbjct: 254 SSLGNLKNLQYLFLYQNKLSGPIPPSIFSL--QKLISLDLSDNSLSGEIPELVIQLQNLE 311

Query: 164 PYHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTLGV 223
             H+      FS    +  G IP  +      QVL L +N  SG IP  L   ++ T  V
Sbjct: 312 ILHL------FSN---NFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLT--V 360

Query: 224 LNLRRNNL-GVVLKSLANCNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSERI 282
           L+L  NNL G + + L +   L  L L +N +    P  L    SL+ +  + N+FS  +
Sbjct: 361 LDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGEL 420

Query: 283 SCPRNNVSWPLLKIVDLASNKFSGRL-SQKWLLT-MMIIQL-------KIPNIFTS---- 329
             P      PL+  +D+++N   GR+ S+KW +  + ++ L        +P+ F S    
Sbjct: 421 --PSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLE 478

Query: 330 -IDCSSNNFEGPMPEEMGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLLMNNLMGK 388
            +D S N F G +P ++G    L    +S N L G IP    + K++ SLDL  N L G+
Sbjct: 479 NLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQ 538

Query: 389 IPTS 392
           IP S
Sbjct: 539 IPAS 542

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 482
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.92
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.85
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
PLN03150623 hypothetical protein; Provisional 99.54
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.48
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.4
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.4
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.37
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.32
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.27
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.25
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.25
PLN03150623 hypothetical protein; Provisional 99.24
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.23
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.23
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.96
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.73
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.7
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.66
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.63
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.61
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.57
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.47
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.32
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.26
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.22
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.18
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.16
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.12
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.06
PRK15386426 type III secretion protein GogB; Provisional 97.95
PRK15386426 type III secretion protein GogB; Provisional 97.88
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.8
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.66
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.45
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.34
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.16
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.15
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.13
KOG4341483 consensus F-box protein containing LRR [General fu 97.05
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.02
KOG4341483 consensus F-box protein containing LRR [General fu 96.96
KOG4308478 consensus LRR-containing protein [Function unknown 95.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.42
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.35
KOG4308478 consensus LRR-containing protein [Function unknown 94.88
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.03
KOG1947482 consensus Leucine rich repeat proteins, some prote 91.08
smart0037026 LRR Leucine-rich repeats, outliers. 90.3
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.3
smart0037026 LRR Leucine-rich repeats, outliers. 90.17
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.17
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 90.0
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.91
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 87.98
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.63
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.39
PF0720498 Orthoreo_P10: Orthoreovirus membrane fusion protei 86.69
KOG1947482 consensus Leucine rich repeat proteins, some prote 85.88
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.92
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 82.61
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 80.87
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 80.72
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.8e-48  Score=424.06  Aligned_cols=397  Identities=24%  Similarity=0.355  Sum_probs=285.5

Q ss_pred             CCcceecCCcCCCCCCCCCEEeCCCCcCCCCCchhccCCCCCCEEeCCCCcccCCCCCC-CCCCCCCEEECcCCCCc---
Q 035547            1 NTSFLGTLPDSIGTLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIPSL-HKSRNLNYLDLSSNNLN---   76 (482)
Q Consensus         1 ~n~~~g~~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~-~~l~~L~~L~Ls~N~i~---   76 (482)
                      +|.+.+.+|++|+.+++|++|++++|.+++..|..++++++|++|++++|.+.+..|.. ..+++|++|++++|.++   
T Consensus       173 ~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~  252 (968)
T PLN00113        173 GNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPI  252 (968)
T ss_pred             cCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceecccc
Confidence            46677788888888888888888888887777878888888888888888877666655 77788888888877654   


Q ss_pred             -----------ccccCCCCcccccCCCCCcCCccccEEEccCCCCC-CCCC-CCCCCCCCEEEcccCcccccCChhhhhc
Q 035547           77 -----------EIHLLSNNQFENQFPEISNMSSSFSKLRLASSKPW-VIPI-LKNQSQLSFFYISNNQISGEIPNWIWEV  143 (482)
Q Consensus        77 -----------~l~~l~~n~l~~~~p~~~~~~~~L~~L~l~~n~l~-~l~~-~~~l~~L~~L~Ls~n~l~~~~~~~~~~l  143 (482)
                                 .+ +++.|.+.+.+|..+...++|+.|++++|.+. .+|. +.++++|+.|++++|.+.+..|..+..+
T Consensus       253 p~~l~~l~~L~~L-~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l  331 (968)
T PLN00113        253 PSSLGNLKNLQYL-FLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSL  331 (968)
T ss_pred             ChhHhCCCCCCEE-ECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcC
Confidence                       22 56667777766666555577777777777766 5555 6777777777777777777777777776


Q ss_pred             CCCCccEEeCCCCcccCCC-CCCCCCCCccEEEccCCcccccChhhhhcCCCCCEEeCCCCcccccCChhhhhcCcCccc
Q 035547          144 GGVNLYFLNLSQNLLVSLQ-EPYHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTLG  222 (482)
Q Consensus       144 ~~~~L~~L~L~~n~i~~~~-~~~~~~~~l~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~L~  222 (482)
                      +.  |+.|++++|.++... ..+..+++|+.|++++|.+.+.+|..++.+++|+.|++++|.+.+.+|..+....  +|+
T Consensus       332 ~~--L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~--~L~  407 (968)
T PLN00113        332 PR--LQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACR--SLR  407 (968)
T ss_pred             CC--CCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCC--CCC
Confidence            66  777777777766432 2233566666777776666666666666666666666666666655665555444  566


Q ss_pred             eEEccCCCCC-chhhhcccCCCCCEEeCCCcccCCCcChhhhcCC-----------------------CCcEEEcccCcc
Q 035547          223 VLNLRRNNLG-VVLKSLANCNMLQVLDLRNNHISDNFPCWLRNAF-----------------------SLQVLVFRSNNF  278 (482)
Q Consensus       223 ~L~l~~n~l~-~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~-----------------------~L~~L~L~~N~i  278 (482)
                      .|++++|.++ .+|..+..+++|+.|++++|.+++..+..+..++                       +|+.|++++|++
T Consensus       408 ~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l  487 (968)
T PLN00113        408 RVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQF  487 (968)
T ss_pred             EEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCcc
Confidence            6666666553 3444555555555555555555554444444444                       455555555555


Q ss_pred             ccccCCCCCCCCCCCCCEEecCCCCCcccCCHHHHHHHHHHHhhcCCcceEEeCCCCcccccChHhhhcCCCCCeeeccC
Q 035547          279 SERISCPRNNVSWPLLKIVDLASNKFSGRLSQKWLLTMMIIQLKIPNIFTSIDCSSNNFEGPMPEEMGRFKSLYAPNMSH  358 (482)
Q Consensus       279 ~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~  358 (482)
                      .+..  +..+..+++|+.|+|++|.+.+.+|..+         ..+++|++|++++|.+++.+|..+..+++|+.|+|++
T Consensus       488 ~~~~--~~~~~~l~~L~~L~Ls~N~l~~~~p~~~---------~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~  556 (968)
T PLN00113        488 SGAV--PRKLGSLSELMQLKLSENKLSGEIPDEL---------SSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQ  556 (968)
T ss_pred             CCcc--ChhhhhhhccCEEECcCCcceeeCChHH---------cCccCCCEEECCCCcccccCChhHhCcccCCEEECCC
Confidence            5444  3455666777777777777777776544         5788999999999999999999999999999999999


Q ss_pred             CcCcccccccccCCCCCCEEeCCCCCccccCCCCcccCcCCCCcccCCCCCCCCC
Q 035547          359 NALKGSIPSSFGNLKQIESLDLLMNNLMGKIPTSTQLQSFLPTSYEGNKGLYIPP  413 (482)
Q Consensus       359 N~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~p~~~~~~~~~~~~~~~n~~~~~~~  413 (482)
                      |++++.+|..+..+++|+.+++++|++.+.+|...++..+....+.||+.+|+.+
T Consensus       557 N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        557 NQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             CcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            9999999999999999999999999999999998888888889999999999754

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07204 Orthoreo_P10: Orthoreovirus membrane fusion protein p10; InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query482
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-15
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-06
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-15
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-06
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-06
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 116/453 (25%), Positives = 178/453 (39%), Gaps = 79/453 (17%)
Query: 4   FLGTLP-DSIGTLENLTRVDLRSYNFTRPIPTSMANL-AQLFHMDFSSNHFSGPI-PSLH 60
           F G LP D++  +  L  +DL    F+  +P S+ NL A L  +D SSN+FSGPI P+L 
Sbjct: 327 FSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLC 386
Query: 61  KXXXXXXXXXXXXXXXEIHLLSNNQFENQFP-EISNMXXXXXXXXXXXXXPWVIPI-LKN 118
           +               E++L  NN F  + P  +SN                 IP  L +
Sbjct: 387 QNPKNTLQ--------ELYL-QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 437
Query: 119 QSQLSFFYISNNQISGEIPNWIWEVGGVNLYFXXXXXXXXXXXXEPYHISGRTYS--FST 176
            S+L    +  N + GEIP  +  V  +                 P  +S  T     S 
Sbjct: 438 LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEI---PSGLSNCTNLNWISL 494
Query: 177 INKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTXXXXXXXXXXXXXXXK 236
            N  L G IP++I +     +L LSNN+ SG+IPA                         
Sbjct: 495 SNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPA------------------------- 529
Query: 237 SLANCNMLQVLDLRNNHISDNFPCWL--------RNAFSLQVLVFRSNNFSERISCPRNN 288
            L +C  L  LDL  N  +   P  +         N  + +  V+  N+  ++      N
Sbjct: 530 ELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGN 589
Query: 289 V-------SWPLLKI-----VDLASNKFSGRLSQKWL--LTMMIIQLK-------IPNIF 327
           +       S  L ++      ++ S  + G  S  +    +MM + +        IP   
Sbjct: 590 LLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEI 649
Query: 328 TS------IDCSSNNFEGPMPEEMGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLL 381
            S      ++   N+  G +P+E+G  + L   ++S N L G IP +   L  +  +DL 
Sbjct: 650 GSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLS 709
Query: 382 MNNLMGKIPTSTQLQSFLPTSYEGNKGLYIPPL 414
            NNL G IP   Q ++F P  +  N GL   PL
Sbjct: 710 NNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPL 742
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query482
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-60
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-56
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-45
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-24
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-38
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-31
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-30
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-32
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-27
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-27
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-31
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 7e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  210 bits (537), Expect = 2e-60
 Identities = 98/455 (21%), Positives = 150/455 (32%), Gaps = 125/455 (27%)

Query: 1   NTSFLGTLPDSIG--TLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIP- 57
           + +F G +  ++       L  + L++  FT  IP +++N ++L  +  S N+ SG IP 
Sbjct: 377 SNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPS 436

Query: 58  SLHKSRNLNYLDLSSNNLN-------------EIHLLSNNQFENQFPEISNMSSSFSKLR 104
           SL     L  L L  N L              E  +L  N    + P             
Sbjct: 437 SLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIP------------- 483

Query: 105 LASSKPWVIPILKNQSQLSFFYISNNQISGEIPNWIWEVGGVNLYFLNLSQNLLVSLQEP 164
                      L N + L++  +SNN+++GEIP WI      NL  L LS N        
Sbjct: 484 ---------SGLSNCTNLNWISLSNNRLTGEIPKWIGR--LENLAILKLSNN-------- 524

Query: 165 YHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTLGVL 224
                          S  G IP  +        LDL+ N  +G+IPA +           
Sbjct: 525 ---------------SFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMF---------- 559

Query: 225 NLRRNNLGVVLKSLANCNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSERISC 284
                               Q   +  N I+     +++N    +      N    +   
Sbjct: 560 -------------------KQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIR 600

Query: 285 PRNNVSWPLLKIVDLASNKFSGRLSQKWLLTMMIIQLKIPNIFTSIDCSSNNFEGPMPEE 344
                        ++ S  + G  S                    +D S N   G +P+E
Sbjct: 601 SEQLNRLSTRNPCNITSRVYGGHTSP---------TFDNNGSMMFLDMSYNMLSGYIPKE 651

Query: 345 MGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLLMNNL------------------- 385
           +G    L+  N+ HN + GSIP   G+L+ +  LDL  N L                   
Sbjct: 652 IGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDL 711

Query: 386 -----MGKIPTSTQLQSFLPTSYEGNKGLYIPPLT 415
                 G IP   Q ++F P  +  N GL   PL 
Sbjct: 712 SNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP 746
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query482
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.51
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.22
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.2
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.19
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.84
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.67
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.63
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.59
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.2
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.77
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.72
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.58
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.1
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.9
2knc_B79 Integrin beta-3; transmembrane signaling, protein 80.88
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.9e-51  Score=440.03  Aligned_cols=311  Identities=27%  Similarity=0.360  Sum_probs=251.5

Q ss_pred             cccEEEccCCCCC-CCCC-CCC--CCCCCEEEcccCcccccCChhhhhcCCCCccEEeCCCCcccCCCCCCC-CCCCccE
Q 035547           99 SFSKLRLASSKPW-VIPI-LKN--QSQLSFFYISNNQISGEIPNWIWEVGGVNLYFLNLSQNLLVSLQEPYH-ISGRTYS  173 (482)
Q Consensus        99 ~L~~L~l~~n~l~-~l~~-~~~--l~~L~~L~Ls~n~l~~~~~~~~~~l~~~~L~~L~L~~n~i~~~~~~~~-~~~~l~~  173 (482)
                      +|+.|++++|.+. .+|. +..  +++|++|++++|++++.+|..+..++.  |++|++++|++++..+..+ .+++|+.
T Consensus       369 ~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~--L~~L~Ls~N~l~~~~p~~l~~l~~L~~  446 (768)
T 3rgz_A          369 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSE--LVSLHLSFNYLSGTIPSSLGSLSKLRD  446 (768)
T ss_dssp             TCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTT--CCEEECCSSEEESCCCGGGGGCTTCCE
T ss_pred             CCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCC--CCEEECcCCcccCcccHHHhcCCCCCE
Confidence            5555555555554 3333 333  667777777777777777777777777  8888888887775443333 6778888


Q ss_pred             EEccCCcccccChhhhhcCCCCCEEeCCCCcccccCChhhhhcCcCccceEEccCCCCC-chhhhcccCCCCCEEeCCCc
Q 035547          174 FSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTLGVLNLRRNNLG-VVLKSLANCNMLQVLDLRNN  252 (482)
Q Consensus       174 L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~L~~L~l~~n~l~-~~~~~~~~l~~L~~L~Ls~N  252 (482)
                      |++++|.+.+.+|..+..+++|++|++++|++.+.+|..+....  +|++|++++|.+. .+|.++..+++|++|++++|
T Consensus       447 L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~--~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N  524 (768)
T 3rgz_A          447 LKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCT--NLNWISLSNNRLTGEIPKWIGRLENLAILKLSNN  524 (768)
T ss_dssp             EECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCT--TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSS
T ss_pred             EECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCC--CCCEEEccCCccCCcCChHHhcCCCCCEEECCCC
Confidence            88888888877788888888888888888888877787777666  8888888888885 67777888888888888888


Q ss_pred             ccCCCcChhhhcCCCCcEEEcccCccccccCC------------------------------------------------
Q 035547          253 HISDNFPCWLRNAFSLQVLVFRSNNFSERISC------------------------------------------------  284 (482)
Q Consensus       253 ~l~~~~~~~~~~l~~L~~L~L~~N~i~~~~~~------------------------------------------------  284 (482)
                      .+.+..|..+..+++|++|++++|.+.+.+|.                                                
T Consensus       525 ~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  604 (768)
T 3rgz_A          525 SFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQL  604 (768)
T ss_dssp             CCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGG
T ss_pred             cccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhh
Confidence            88877788888888888888888877654421                                                


Q ss_pred             --------------------CCCCCCCCCCCEEecCCCCCcccCCHHHHHHHHHHHhhcCCcceEEeCCCCcccccChHh
Q 035547          285 --------------------PRNNVSWPLLKIVDLASNKFSGRLSQKWLLTMMIIQLKIPNIFTSIDCSSNNFEGPMPEE  344 (482)
Q Consensus       285 --------------------~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~  344 (482)
                                          +..+..+++|++|||++|.++|.+|..+         ..++.|+.|+|++|.+++.+|..
T Consensus       605 ~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l---------~~l~~L~~L~Ls~N~l~g~ip~~  675 (768)
T 3rgz_A          605 NRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEI---------GSMPYLFILNLGHNDISGSIPDE  675 (768)
T ss_dssp             GGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGG---------GGCTTCCEEECCSSCCCSCCCGG
T ss_pred             hccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHH---------hccccCCEEeCcCCccCCCCChH
Confidence                                2235567889999999999999999765         68999999999999999999999


Q ss_pred             hhcCCCCCeeeccCCcCcccccccccCCCCCCEEeCCCCCccccCCCCcccCcCCCCcccCCCCCCCCCCCCCCCCCCC
Q 035547          345 MGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLLMNNLMGKIPTSTQLQSFLPTSYEGNKGLYIPPLTNDIQTHPP  423 (482)
Q Consensus       345 ~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~p~~~~~~~~~~~~~~~n~~~~~~~~~~~c~~~~~  423 (482)
                      ++++++|+.|+|++|++++.+|..+..+++|++||+++|+++|.+|...++.++....+.|||.+|+.|.. .|.....
T Consensus       676 l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~~  753 (768)
T 3rgz_A          676 VGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSNA  753 (768)
T ss_dssp             GGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC-
T ss_pred             HhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999987 7866543
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2knc_B Integrin beta-3; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 482
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 74.3 bits (181), Expect = 5e-15
 Identities = 67/377 (17%), Positives = 117/377 (31%), Gaps = 30/377 (7%)

Query: 15  LENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIPSLHKSRNLNYLDLSSNN 74
           L    +  L   N T  +  +  +L Q+  +          I  +    NL  ++ S+N 
Sbjct: 21  LAEKMKTVLGKTNVTDTVSQT--DLDQVTTLQADRLGIKS-IDGVEYLNNLTQINFSNNQ 77

Query: 75  LNEIHLLSN-NQFENQFPEISNMSSSFSKLRLASSKPWVIPILKNQSQLSFFYISNNQIS 133
           L +I  L N  +  +     + ++       L +     +   +         ++N    
Sbjct: 78  LTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRL 137

Query: 134 GEIPNWIWEVGGVNLYFLNLSQNLLVSLQEPYHISGRTYSFSTINKSLIGFIPEYICKAT 193
               N I ++  ++        +    + +   ++  T        S        + K T
Sbjct: 138 ELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLT 197

Query: 194 YFQVLDLSNNNLSGSIPACLITKSSTTLGVLNLRRNNLGVVLKSLANCNMLQVLDLRNNH 253
             + L  +NN +S   P  ++T     L  L+L  N L   + +LA+   L  LDL NN 
Sbjct: 198 NLESLIATNNQISDITPLGILTN----LDELSLNGNQLKD-IGTLASLTNLTDLDLANNQ 252

Query: 254 ISDNFPCWLRNAFSLQVLVFRSNNFSERISCPRNNVSWPLLKIVDLASNKFSGRLSQKWL 313
           IS+  P  L     L  L   +                 +  I  LA       L     
Sbjct: 253 ISNLAP--LSGLTKLTELKLGA---------------NQISNISPLAGLTALTNLELNEN 295

Query: 314 LTMMIIQLKIPNIFTSIDCSSNNFEGPMPEEMGRFKSLYAPNMSHNALKGSIPSSFGNLK 373
               I  +      T +    NN     P  +     L     ++N +     SS  NL 
Sbjct: 296 QLEDISPISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLT 351

Query: 374 QIESLDLLMNNLMGKIP 390
            I  L    N +    P
Sbjct: 352 NINWLSAGHNQISDLTP 368
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query482
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.57
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.42
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.3
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.5
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.4
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.91
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.56
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.37
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.97  E-value=4.6e-29  Score=243.11  Aligned_cols=325  Identities=20%  Similarity=0.205  Sum_probs=189.7

Q ss_pred             CCCCCCEEeCCCCcCCCCCchhccCCCCCCEEeCCCCcccCCCCCCCCCCCCCEEECcCCCCcccccCCCCcccccCCCC
Q 035547           14 TLENLTRVDLRSYNFTRPIPTSMANLAQLFHMDFSSNHFSGPIPSLHKSRNLNYLDLSSNNLNEIHLLSNNQFENQFPEI   93 (482)
Q Consensus        14 ~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~l~~L~~L~Ls~N~i~~l~~l~~n~l~~~~p~~   93 (482)
                      .+.+|++|+++++.|+.+  +.++.+++|++|++++|++++++ ....+++|++|++++|+|+.++            . 
T Consensus        42 ~l~~l~~L~l~~~~I~~l--~gl~~L~nL~~L~Ls~N~l~~l~-~l~~L~~L~~L~L~~n~i~~i~------------~-  105 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSI--DGVEYLNNLTQINFSNNQLTDIT-PLKNLTKLVDILMNNNQIADIT------------P-  105 (384)
T ss_dssp             HHTTCCEEECCSSCCCCC--TTGGGCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCSSCCCCCG------------G-
T ss_pred             HhCCCCEEECCCCCCCCc--cccccCCCCCEEeCcCCcCCCCc-cccCCccccccccccccccccc------------c-
Confidence            456788888888888763  45777888888888888887654 3577888888888888777552            1 


Q ss_pred             CcCCccccEEEccCCCCCCCCCCCCCCCCCEEEcccCcccccCChhhhhcCC-----------------CCccEEeCCCC
Q 035547           94 SNMSSSFSKLRLASSKPWVIPILKNQSQLSFFYISNNQISGEIPNWIWEVGG-----------------VNLYFLNLSQN  156 (482)
Q Consensus        94 ~~~~~~L~~L~l~~n~l~~l~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~-----------------~~L~~L~L~~n  156 (482)
                      +..+++|+.|+++++.+..++.......+.......|.+....+........                 ..........|
T Consensus       106 l~~l~~L~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  185 (384)
T d2omza2         106 LANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSN  185 (384)
T ss_dssp             GTTCTTCCEEECCSSCCCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSS
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhcccccccccccccc
Confidence            1112778888888887777766556667777777776664322211111111                 00111222222


Q ss_pred             cccCCCCCCCCCCCccEEEccCCcccccChhhhhcCCCCCEEeCCCCcccccCChhhhhcCcCccceEEccCCCCCchhh
Q 035547          157 LLVSLQEPYHISGRTYSFSTINKSLIGFIPEYICKATYFQVLDLSNNNLSGSIPACLITKSSTTLGVLNLRRNNLGVVLK  236 (482)
Q Consensus       157 ~i~~~~~~~~~~~~l~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~  236 (482)
                      ..... .....++++..+++++|.+.+..|  +..+++|+.|++++|.+. .++ .+....  +|+.+++++|.++.++ 
T Consensus       186 ~~~~~-~~~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~-~~~-~l~~l~--~L~~L~l~~n~l~~~~-  257 (384)
T d2omza2         186 KVSDI-SVLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLK-DIG-TLASLT--NLTDLDLANNQISNLA-  257 (384)
T ss_dssp             CCCCC-GGGGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCC-CCG-GGGGCT--TCSEEECCSSCCCCCG-
T ss_pred             ccccc-cccccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCC-Ccc-hhhccc--ccchhccccCccCCCC-
Confidence            21111 111244566666666666655433  344556666666666665 232 333333  6666666666665554 


Q ss_pred             hcccCCCCCEEeCCCcccCCCcChhhhcCCCCcEEEcccCccccccCCCCCCCCCCCCCEEecCCCCCcccCCHHHHHHH
Q 035547          237 SLANCNMLQVLDLRNNHISDNFPCWLRNAFSLQVLVFRSNNFSERISCPRNNVSWPLLKIVDLASNKFSGRLSQKWLLTM  316 (482)
Q Consensus       237 ~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~i~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~  316 (482)
                      .+..+++|++|++++|.+++..  .+..+..++.++++.|.+.+..    .+..+++++.|++++|++++..+       
T Consensus       258 ~~~~~~~L~~L~l~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~~~----~~~~~~~l~~L~ls~n~l~~l~~-------  324 (384)
T d2omza2         258 PLSGLTKLTELKLGANQISNIS--PLAGLTALTNLELNENQLEDIS----PISNLKNLTYLTLYFNNISDISP-------  324 (384)
T ss_dssp             GGTTCTTCSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCCSCCG----GGGGCTTCSEEECCSSCCSCCGG-------
T ss_pred             cccccccCCEeeccCcccCCCC--cccccccccccccccccccccc----ccchhcccCeEECCCCCCCCCcc-------
Confidence            3555666666666666665532  2455666666666666665432    34556666666666666665432       


Q ss_pred             HHHHhhcCCcceEEeCCCCcccccChHhhhcCCCCCeeeccCCcCcccccccccCCCCCCEEeCCCC
Q 035547          317 MIIQLKIPNIFTSIDCSSNNFEGPMPEEMGRFKSLYAPNMSHNALKGSIPSSFGNLKQIESLDLLMN  383 (482)
Q Consensus       317 ~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~l~~N  383 (482)
                          +..+++|++|++++|++++ ++ .++++++|++|++++|++++..|  +.++++|+.|++++|
T Consensus       325 ----l~~l~~L~~L~L~~n~l~~-l~-~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~N  383 (384)
T d2omza2         325 ----VSSLTKLQRLFFANNKVSD-VS-SLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ  383 (384)
T ss_dssp             ----GGGCTTCCEEECCSSCCCC-CG-GGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECCCE
T ss_pred             ----cccCCCCCEEECCCCCCCC-Ch-hHcCCCCCCEEECCCCcCCCChh--hccCCCCCEeeCCCC
Confidence                1455666666666666663 23 46666666666666666664332  566666666666665
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure