Citrus Sinensis ID: 035577

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660--
MRKSLEDFAAIQAMKDSPNSLNAKTILLSTPGHTQINDDAKHVASSSSIEHVWKSDEITGIINSENDVGIRKLGRLKKSQSLGSRLCWEGKYPGENDTEEETEGFSSDSHDQNGQTTQNGRNDPVVSPPSEYEKAPHLMLAHINNESIFSIGDPLNSEKEGHKNDAPISGHGDSADNYTGLMPYTPPLIIKSFSMPNIKGFMCPSEECFTLKHFAPRSRSSDDLQILGMWEKDTSVQNIDGQVMEEQERYAYMCKMEKTNLGILADDCYDSCNYSALAKDWVMPDENSVKKLQGESLHEQWDKLPSKHFKIKRIKEWVNDLQHCSPLEESDETSVSNDQVKRDPKVLNGSTAVKVDGKVTAGMEAVTKYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRITAGALPRGLHILNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPAQKNVGDEQLKKNLQSLLPHLVYFNWQPMKASTLKDASDRSVRLGISAHLFDRGLRSDNKAARKSTHRSSLSTHGRKSQAAFSPPKKSRSRHAHLPPIGTKATTNNRHNYFDTGSRLLNLKSEFSMRRSRSEEMLGGGL
ccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccHHHHHHccccccEEEccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHcccccccccccc
ccccccccHHHHccccccccccccccccccccccccccccccccccccEEEccccHHHccccccccccccccccEEEEccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccEHHHcccccEEEcccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccHHHccccccccHHHHHHcccccccccccccHHHHHcHcHcccccccccccccccccccccccccHHHHHHHccccHccHHHccccccccHHEEccccccHHHHHHHHHHHHcccccHHHccccccccccccccccHccccccccHHHcccHHHHHHHHHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHcccccccEEEcccccccccHHHcccccccEEEcccccHccccccHHHcccccEEEcccccccccHHHcccccccEEEcccccccccHHHcccccccEcccEEEcccccHHHcccHHHHHHHHEEEccccEEccccccccccHHHHHHHHHHccHHHHHHHHcccHHHHcccccccHHHHHHHHHcHHHHccccccccccccccccccccccccccccccccccccccccccHEEEEccccccccccc
MRKSLEDFAAIQAmkdspnslnaktillstpghtqinddakhvassSSIEHVWKSDEITGIINSENDVGIRKLGRlkksqslgsrlcwegkypgendteeetegfssdshdqngqttqngrndpvvsppseyekapHLMLAHInnesifsigdplnsekeghkndapisghgdsadnytglmpytppliiksfsmpnikgfmcpseecftlkhfaprsrssddlqilgmwekdtsvqnidgQVMEEQERYAYMCKMEKtnlgiladdcydscnysalakdwvmpdensvkklqgeslheqwdklpskhfKIKRIKEWVNdlqhcspleesdetsvsndqvkrdpkvlngstavkvdgkVTAGMEAVTKYISSLSASATtvqlsnhglvviPFLSAFVSLKVLNLSGNAIVRITAGALPRGLHILNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAIslegnpaqknvgdEQLKKNLQSLLphlvyfnwqpmkastlkdasdrsVRLGISAhlfdrglrsdnkaarksthrsslsthgrksqaafsppkksrsrhahlppigtkattnnrhnyfdtgSRLLNLKSEFSMRRSRSEEMLGGGL
MRKSLEDFAAIqamkdspnslNAKTILLSTPGHTQINDDAKHVASSSSIEhvwksdeitgiinsendvgirklgrlkksqslgsrlcwegkypGENDTEEETEGFssdshdqngqttqngrndpvvSPPSEYEKAPHLMLAHINNESIFSIGDPLNSEKEGHKNDAPISGHGDSADNYTGLMPYTPPLIIKSFSMPNIKGFMCPSEECFTLKHFAPRSRSSDDLQILGMWEkdtsvqnidgQVMEEQERYAYMCKMEKTNLGILADDCYDSCNYSALAKDWVMPDENSVKKLQGeslheqwdklpsKHFKIKRIKEWVNDLQHCSPleesdetsvsndqvkrdpkvlngstavkvdgkvtAGMEAVTKYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRITAGALPRGLHILNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPAQKNVGDEQLKKNLQSLLPHLVYFNWQPMKASTLKDASDRSVRLGISahlfdrglrsdnkaarksthrsslsthgrksqaafsppkksrsrhahlppigtkattnnrhnyfdtgsrllnlksefsmrrsrseemlgggl
MRKSLEDFAAIQAMKDSPNSLNAKTILLSTPGHTQINDDAKHVASSSSIEHVWKSDEITGIINSENDVGIRKLGRLKKSQSLGSRLCWEGKYPGENDTEEETEGFSSDSHDQNGQTTQNGRNDPVVSPPSEYEKAPHLMLAHINNESIFSIGDPLNSEKEGHKNDAPISGHGDSADNYTGLMPYTPPLIIKSFSMPNIKGFMCPSEECFTLKHFAPRSRSSDDLQILGMWEKDTSVQNIDGQVMEEQERYAYMCKMEKTNLGILADDCYDSCNYSALAKDWVMPDENSVKKLQGESLHEQWDKLPSKHFKIKRIKEWVNDLQHCSPLEESDETSVSNDQVKRDPKVLNGSTAVKVDGKVTAGMEAVTKYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRITAGALPRGLHILNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPAQKNVGDEQLKKNLQSLLPHLVYFNWQPMKASTLKDASDRSVRLGISAHLFDRGLRSDNKAARKSTHRSSLSTHGRKSQAAFSPPKKSRSRHAHLPPIGTKATTNNRHNYFDTGSRLLNLKsefsmrrsrseemLGGGL
*************************************************EHVWKSDEITGIINSENDVGIRKLGRL*******SRLCWE**************************************************LAHIN***I*****************************YTGLMPYTPPLIIKSFSMPNIKGFMCPSEECFTLKHFAP******DLQILGMWEKDTSVQNIDGQVMEEQERYAYMCKMEKTNLGILADDCYDSCNYSALAKDWVMPD**************QWDKLPSKHFKIKRIKEWVNDLQHC****************************VKVDGKVTAGMEAVTKYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRITAGALPRGLHILNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISL****************NLQSLLPHLVYFNWQPMKA***********RLGISAHLF****************************************************************************************
************************************************************IINSE*******************************************************************************************************************************************************************MWEKDT**************************LGILADDCYDSCNYSALAKDWVMPDENSVKKLQGESLHEQWDKLPSKHFKIKRIKEWVNDLQHCSPLEESDETSVSNDQVKRDPKVLNGSTAVKVDGKVTAGMEAVTKYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRITAGALPRGLHILNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPAQKNVGDEQLKKNLQSLLPHLVYFNWQPMKASTL**AS***V*********************************************************************************************G***
MRKSLEDFAAIQAMKDSPNSLNAKTILLSTPGHTQINDD**********EHVWKSDEITGIINSENDVGIRKLGRLKKSQSLGSRLCWEGKYPG***************************************KAPHLMLAHINNESIFSIGDPLNSEKEGHKNDAPISGHGDSADNYTGLMPYTPPLIIKSFSMPNIKGFMCPSEECFTLKHFAPRSRSSDDLQILGMWEKDTSVQNIDGQVMEEQERYAYMCKMEKTNLGILADDCYDSCNYSALAKDWVMPDENSVKKLQGESLHEQWDKLPSKHFKIKRIKEWVNDLQHCSP**************KRDPKVLNGSTAVKVDGKVTAGMEAVTKYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRITAGALPRGLHILNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPAQKNVGDEQLKKNLQSLLPHLVYFNWQPMKASTLKDASDRSVRLGISAHLFDRGLRSD***********************************HLPPIGTKATTNNRHNYFDTGSRLLNLKSEFS**************
***********************************************SIEHVWKSDEITGIINSENDVGIRKLGRLKKSQSLGSRLCWEGKYPGE******************GQTTQNGRNDPVVSPPSEYEKAPHLMLAHINNESIFSIGDP**S****HKNDAPISGHGDSADNYTGLMPYTPPLIIKSFSMPNIKGFMCPSEECFTLKHFAPRSRSSDDLQILGMWEKDTSVQNIDGQVMEEQERYAYMCKMEKTNLGILADDCYDSCNYSALAKDWVMPDENSVKKLQGESLHEQWDKLPSKHFKIKRIKEWVNDLQHCSPLEESDETSVSNDQVKRDPKVLNGSTAVKVDGKVTAGMEAVTKYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRITAGALPRGLHILNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPAQKNVGDEQLKKNLQSLLPHLVYFNWQPMKASTLKDASDRSVRLGISAH*****************************************************************SRLLNLKSEFSMRR***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKSLEDFAAIQAMKDSPNSLNAKTILLSTPGHTQINDDAKHVASSSSIEHVWKSDEITGIINSENDVGIRKLGRLKKSQSLGSRLCWEGKYPGENDTEEETEGFSSDSHDQNGQTTQNGRNDPVVSPPSEYEKAPHLMLAHINNESIFSIGDPLNSEKEGHKNDAPISGHGDSADNYTGLMPYTPPLIIKSFSMPNIKGFMCPSEECFTLKHFAPRSRSSDDLQILGMWEKDTSVQNIDGQVMEEQERYAYMCKMEKTNLGILADDCYDSCNYSALAKDWVMPDENSVKKLQGESLHEQWDKLPSKHFKIKRIKEWVNDLQHCSPLEESDETSVSNDQVKRDPKVLNGSTAVKVDGKVTAGMEAVTKYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRITAGALPRGLHILNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPAQKNVGDEQLKKNLQSLLPHLVYFNWQPMKASTLKDASDRSVRLGISAHLFDRGLRSDNKAARKSTHRSSLSTHGRKSQAAFSPPKKSRSRHAHLPPIGTKATTNNRHNYFDTGSRLLNLKSEFSMRRSRSEEMLGGGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query662 2.2.26 [Sep-21-2011]
Q9D5S7 820 Leucine-rich repeat and g yes no 0.232 0.187 0.354 4e-11
P45969326 Uncharacterized protein T yes no 0.228 0.463 0.358 2e-10
Q54Q39336 Protein phosphatase 1 reg yes no 0.190 0.375 0.362 3e-10
Q9D5E4 523 Leucine-rich repeat-conta no no 0.217 0.275 0.369 8e-10
Q6DIQ3346 Protein phosphatase 1 reg no no 0.273 0.523 0.311 6e-09
Q3T0W4360 Protein phosphatase 1 reg no no 0.237 0.436 0.324 6e-09
Q3UM45361 Protein phosphatase 1 reg no no 0.237 0.434 0.329 9e-09
Q96M69 825 Leucine-rich repeat and g yes no 0.256 0.206 0.315 1e-08
Q8BGI7337 Leucine-rich repeat-conta no no 0.288 0.566 0.313 1e-08
Q5RFS7360 Protein phosphatase 1 reg yes no 0.237 0.436 0.329 1e-08
>sp|Q9D5S7|LRGUK_MOUSE Leucine-rich repeat and guanylate kinase domain-containing protein OS=Mus musculus GN=Lrguk PE=2 SV=1 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 86/161 (53%), Gaps = 7/161 (4%)

Query: 380 VQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRITAGALPRGLHILNLSKNNISTIEGLRE 439
           + LS+  LV I  L  +V L+ LNLSGN I  ++  +    L  LN S+N ++T    + 
Sbjct: 132 LNLSHCELVDISILCGYVHLQKLNLSGNRIEDLSCVSCMPYLLELNASQNKLTTFFNFKP 191

Query: 440 LTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKIS 499
              L+ +D S N I  + + L++  +L +L L  N+I E+ GL   + LT L L  NKI+
Sbjct: 192 PQNLKKVDFSSNLISEM-YDLSAYHTLTQLILDNNEIEEITGLENCISLTHLSLAGNKIT 250

Query: 500 TAKCLGQLAANYNSLQAISLEGNPAQKNVGDEQLKKNLQSL 540
           T K LG L      ++ +SL  N  +   G E+LK  LQ+L
Sbjct: 251 TIKGLGTLP-----IKVLSLSNNMIETITGLEELKA-LQNL 285

Mus musculus (taxid: 10090)
>sp|P45969|YNZ9_CAEEL Uncharacterized protein T09A5.9 OS=Caenorhabditis elegans GN=T09A5.9 PE=4 SV=1 Back     alignment and function description
>sp|Q54Q39|PP1R7_DICDI Protein phosphatase 1 regulatory subunit pprA OS=Dictyostelium discoideum GN=pprA PE=3 SV=1 Back     alignment and function description
>sp|Q9D5E4|LRC48_MOUSE Leucine-rich repeat-containing protein 48 OS=Mus musculus GN=Lrrc48 PE=2 SV=1 Back     alignment and function description
>sp|Q6DIQ3|PP1R7_XENTR Protein phosphatase 1 regulatory subunit 7 OS=Xenopus tropicalis GN=ppp1r7 PE=2 SV=1 Back     alignment and function description
>sp|Q3T0W4|PP1R7_BOVIN Protein phosphatase 1 regulatory subunit 7 OS=Bos taurus GN=PPP1R7 PE=1 SV=1 Back     alignment and function description
>sp|Q3UM45|PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus GN=Ppp1r7 PE=1 SV=2 Back     alignment and function description
>sp|Q96M69|LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens GN=LRGUK PE=2 SV=1 Back     alignment and function description
>sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFS7|PP1R7_PONAB Protein phosphatase 1 regulatory subunit 7 OS=Pongo abelii GN=PPP1R7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query662
255563429673 Protein phosphatase 1 regulatory subunit 0.992 0.976 0.614 0.0
224145542680 predicted protein [Populus trichocarpa] 0.972 0.947 0.568 0.0
225447711672 PREDICTED: uncharacterized protein LOC10 0.953 0.938 0.563 0.0
147801953730 hypothetical protein VITISV_039451 [Viti 0.953 0.864 0.559 0.0
356542868689 PREDICTED: uncharacterized protein LOC10 0.965 0.927 0.524 1e-167
356515236679 PREDICTED: uncharacterized protein LOC10 0.957 0.933 0.519 1e-165
224146698448 predicted protein [Populus trichocarpa] 0.661 0.977 0.658 1e-156
297813977680 leucine-rich repeat family protein [Arab 0.966 0.941 0.508 1e-154
30679417677 Outer arm dynein light chain 1 protein [ 0.960 0.939 0.505 1e-152
449453658592 PREDICTED: uncharacterized protein LOC10 0.853 0.954 0.526 1e-148
>gi|255563429|ref|XP_002522717.1| Protein phosphatase 1 regulatory subunit, putative [Ricinus communis] gi|223538067|gb|EEF39679.1| Protein phosphatase 1 regulatory subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/675 (61%), Positives = 491/675 (72%), Gaps = 18/675 (2%)

Query: 1   MRKSLEDFAAIQAMKDSPNSLNAKTILLSTPGHTQINDDAKHVASSSSIEHVWKSDEITG 60
           M K+L+D + I+    S  + + +++ L+   +   +   K V S    E  WKS+EI G
Sbjct: 1   MHKTLQDSSQIKVPMVSSKAASLESLHLNEQANYDNDGRTKDVPSCVISERGWKSEEIKG 60

Query: 61  IINSENDVGIRKLGRLKKSQSLGSRLCWEGKYPGENDTEEET-EGFSSDSHDQNGQTTQN 119
            ++ END GI + G +KKSQSLGS LC EG+   +++ E+E  +GFSS+S +QNG   ++
Sbjct: 61  KLDMENDTGIHQKGLVKKSQSLGSALCHEGRVHFDDEIEDEIDQGFSSESLEQNGLVGRD 120

Query: 120 GRNDPVVSPPSEYEKAPHLMLAHI-----NNESIFSIGDPLNSEKEGHKNDAPISGHGDS 174
           G N   VSP S+ E AP      +     NN+SIFSIG+P + E+E   N + I   G+ 
Sbjct: 121 GTNARGVSPVSQQENAPQSESVQVSSELVNNKSIFSIGEPQHLEQEDPAN-SEILLSGEG 179

Query: 175 ADNYTGLMPYTPPLIIKSFSMPNIKGFMCPSEECFTLKHFAPRSRSSDDLQILGMWEKDT 234
           A+      P T  ++ KS SMPN+   +     C +  + AP SRSS+DL IL M  K+ 
Sbjct: 180 ANESYNHTPRTHLMLAKSSSMPNMGPSLLFPGGC-SYNYMAPHSRSSEDLSILCMRWKEV 238

Query: 235 SVQNIDGQVMEEQERYAYMCKMEKTNLGILADDCYDSCNYSALAKDWVMP--DE-NSVKK 291
           S   ++ + ++E ER    CK EK N     DD YDS NYSALAKDW++P  DE  SVK+
Sbjct: 239 SFHEVEKREIQEHERNDSGCKTEKINFENSLDDGYDSYNYSALAKDWIVPVTDEITSVKR 298

Query: 292 LQGESLHEQWDKLPSKHFKIKRIKEWVNDLQHCSPLEESDETSVSNDQVKRDPKVLNGST 351
            QGESL +Q D+L  K FKIKRI+EWV DLQHC+PLEE++E S S   + RD  V+NG T
Sbjct: 299 FQGESLIQQADELQGKDFKIKRIEEWVIDLQHCNPLEETNELSDSIHPLNRDSNVMNGLT 358

Query: 352 AVKVDGKVTAGMEAVTKYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVR 411
           A+K D KVT GME   +YISSL ASATT QLSNHGL VIPFL AFVSL+VLNLSGNAIVR
Sbjct: 359 AIKRDNKVTPGMETAKRYISSLGASATTAQLSNHGLAVIPFLGAFVSLRVLNLSGNAIVR 418

Query: 412 ITAGALPRGLHILNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGLASCSSLKELYL 471
           ITAG+LPRGLH+LNLSKN ISTIEGLRELTRLRVLDLSYNRI RIGHGLASCSSLKELYL
Sbjct: 419 ITAGSLPRGLHVLNLSKNKISTIEGLRELTRLRVLDLSYNRIFRIGHGLASCSSLKELYL 478

Query: 472 AGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPAQKNVGDE 531
           AGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPAQKNVGDE
Sbjct: 479 AGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPAQKNVGDE 538

Query: 532 QLKKNLQSLLPHLVYFNWQPMKASTLKDASDRSVRLGISAHLFDRGLRSDNKAARKSTHR 591
           QLKK LQSLLPHLVYFN QP+K STLKDA+DRSVRLGI+AH FDRG+RSDNKAARK +H 
Sbjct: 539 QLKKYLQSLLPHLVYFNRQPIKVSTLKDAADRSVRLGINAHQFDRGIRSDNKAARKGSHG 598

Query: 592 ------SSLSTHGRKSQAAFSPPKKSRSRHAHLPPIGTKATTNNRHNYFDTGSRLLNLKS 645
                 +S STHGRKSQA  S PK SR RHA LPP GTKA T +RH+YFD GS+LLNL+S
Sbjct: 599 LGGTRPTSSSTHGRKSQALVS-PKPSRGRHARLPPTGTKAITGHRHHYFDIGSKLLNLRS 657

Query: 646 EFSMRRSRSEEMLGG 660
           E S+RRSRSE  LG 
Sbjct: 658 ELSIRRSRSEGTLGA 672

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224145542|ref|XP_002325679.1| predicted protein [Populus trichocarpa] gi|222862554|gb|EEF00061.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225447711|ref|XP_002272885.1| PREDICTED: uncharacterized protein LOC100257895 [Vitis vinifera] gi|296081251|emb|CBI17995.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147801953|emb|CAN75055.1| hypothetical protein VITISV_039451 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356542868|ref|XP_003539887.1| PREDICTED: uncharacterized protein LOC100790061 [Glycine max] Back     alignment and taxonomy information
>gi|356515236|ref|XP_003526307.1| PREDICTED: uncharacterized protein LOC100778703 [Glycine max] Back     alignment and taxonomy information
>gi|224146698|ref|XP_002326103.1| predicted protein [Populus trichocarpa] gi|222862978|gb|EEF00485.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297813977|ref|XP_002874872.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297320709|gb|EFH51131.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30679417|ref|NP_192235.3| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] gi|186511493|ref|NP_001118925.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] gi|27311715|gb|AAO00823.1| putative protein phosphatase regulatory subunit [Arabidopsis thaliana] gi|30725504|gb|AAP37774.1| At4g03260 [Arabidopsis thaliana] gi|332656898|gb|AEE82298.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] gi|332656899|gb|AEE82299.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449453658|ref|XP_004144573.1| PREDICTED: uncharacterized protein LOC101220128 [Cucumis sativus] gi|449493191|ref|XP_004159217.1| PREDICTED: uncharacterized LOC101220128 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query662
TAIR|locus:2125507677 AT4G03260 [Arabidopsis thalian 0.960 0.939 0.497 5.9e-144
TAIR|locus:2032040681 AT1G78230 [Arabidopsis thalian 0.451 0.439 0.487 4.2e-67
TAIR|locus:2176397452 AT5G22320 [Arabidopsis thalian 0.380 0.557 0.312 7.5e-15
MGI|MGI:1921604 820 Lrguk "leucine-rich repeats an 0.302 0.243 0.325 1.8e-12
UNIPROTKB|F1N0Q0 522 LRRC48 "Uncharacterized protei 0.333 0.423 0.302 1e-11
DICTYBASE|DDB_G0284039336 pprA "Protein phosphatase 1 re 0.243 0.479 0.321 3.1e-11
FB|FBgn0032163 566 TbCMF46 "TbCMF46" [Drosophila 0.249 0.291 0.333 4.2e-11
WB|WBGene00011637326 T09A5.9 [Caenorhabditis elegan 0.246 0.5 0.349 6.2e-11
ZFIN|ZDB-GENE-061103-349 513 lrrc48 "leucine rich repeat co 0.200 0.259 0.355 1.6e-10
ZFIN|ZDB-GENE-051113-288345 ppp1r7 "protein phosphatase 1, 0.327 0.628 0.275 1.7e-10
TAIR|locus:2125507 AT4G03260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1407 (500.3 bits), Expect = 5.9e-144, P = 5.9e-144
 Identities = 339/681 (49%), Positives = 443/681 (65%)

Query:     2 RKSLEDFAAIQAMKDSPNSLNAKTILLSTPGHTQINDDAKHVASSSSIEHVWKSDEI--T 59
             +KS+E F+     +D   S    +I+        +++++K  A    +E VWKS+EI  +
Sbjct:    17 KKSVEGFSERVIKEDGSKSKGLSSIIFGR-NIASVSENSKPAA----VERVWKSEEIKPS 71

Query:    60 GIINSENDVGIRKLGRLKKSQSLGSRLCWEGKYPGENDTEEETEGFSS-DSHDQNGQTTQ 118
             GI+  E+ +G  ++  LKKSQS G+ L  +G+   EN T++ ++  +S +S +Q     +
Sbjct:    72 GIL--EHGIGTHQVLHLKKSQSHGNELYLDGRDATENGTDDASDRITSPNSLEQQSGIHE 129

Query:   119 NGRNDPVVSPPSEYEKAPHLMLAHI--NNE----SIFSIGDPLNSEKEGHKNDAPISGHG 172
              G +  V   P+ Y++ P   ++    +N+    SIFS+GD  +++K+  + D   S +G
Sbjct:   130 AGSSKRVDESPNLYQQGPRASVSAYQGSNQALCGSIFSVGDLHHTDKDSRQLD-DTSLYG 188

Query:   173 DSADNYTGLMPYTPPLIIKSFSMPNIKGFMCPSEECFTLKHFAPRSRSSDDLQILGMWEK 232
             +  DN     P+  PL+++S S+PNI      SE+    K+ +  SRSSDDL  L   + 
Sbjct:   189 EQMDNSNSQTPHDSPLMVRSNSLPNIAD--SSSEKSSPFKYSSHHSRSSDDLHALDTRQT 246

Query:   233 DTSVQNIDGQVMEE--QERYAYMCKMEKTNLGILADDCYD-SCNYSALAKDWVMP--DEN 287
             D SV   D +V +E  Q+R   M      N   L +D YD S +YS+LAKDW++P  DE 
Sbjct:   247 DKSVHETDEEVKQEEDQDRDYDMHNSGDNNKENLVEDGYDDSYDYSSLAKDWIVPPTDEL 306

Query:   288 SVKK-LQGESLHEQWDKLPSKHFKIKRIKEWVNDLQHCSPLEESDETSVSNDQVKRDPKV 346
              + K L+GE+ ++Q +    K  K KRI++WVNDLQH +  EE+DE +  +D++ R+P V
Sbjct:   307 KLSKFLEGETTNQQAE-FSGKDSKFKRIEDWVNDLQHVNLSEEADEITGYDDELPREPVV 365

Query:   347 LN--GSTAVKVDG-KVTAGMEAVTKYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLN 403
             LN   +++ KVD  K+T GMEA  KYISSLSASATT QL +HGLVVIPFLSAFV L+VLN
Sbjct:   366 LNEQATSSAKVDAIKLTPGMEAAKKYISSLSASATTAQLVSHGLVVIPFLSAFVGLRVLN 425

Query:   404 LSGNAIVRITAGALPRGLHILNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGLASC 463
             LSGNAIVRITAGALPRGLH LNLSKN+IS IEGLRELTRLRVLDLSYNRILR+GHGLASC
Sbjct:   426 LSGNAIVRITAGALPRGLHALNLSKNSISVIEGLRELTRLRVLDLSYNRILRLGHGLASC 485

Query:   464 SSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNP 523
             SSLKELYLAGNKISE+EGLHRLLKLTVLDLRFNK ST KCLGQLAANY+SLQAISLEGNP
Sbjct:   486 SSLKELYLAGNKISEIEGLHRLLKLTVLDLRFNKFSTTKCLGQLAANYSSLQAISLEGNP 545

Query:   524 AQKNVGDEQLKKNLQSLLPHLVYFNWQPMKASTLKDASDRSVRLGISAHLFDRGLRSDNK 583
             AQKNVGDEQL+K L  LLP+LVY+N Q     T KDA     RLG S H  DRGLRS+ K
Sbjct:   546 AQKNVGDEQLRKYLLGLLPNLVYYNRQ----GT-KDA-----RLGTSTHQLDRGLRSELK 595

Query:   584 -AARKSTHRSSLSTHGRKSQAAFSPP---KKSRSRHAHLPPIGTKATTNNRHNYF-DTGS 638
              ++RKS+H +S S+H   S  A   P   K+S+ R + LPP+G K +     NY   TG 
Sbjct:   596 NSSRKSSHGAS-SSHKPGSSTARKAPALQKRSKERRSRLPPVGHKLSPAAYENYHVATGD 654

Query:   639 RLLNLKXXXXXXXXXXXXXLG 659
             RL +L+             LG
Sbjct:   655 RLSSLRTELSMRRSRSEGTLG 675
GO:0005634 "nucleus" evidence=ISM
GO:0004674 "protein serine/threonine kinase activity" evidence=IDA
GO:0046777 "protein autophosphorylation" evidence=IDA
TAIR|locus:2032040 AT1G78230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176397 AT5G22320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1921604 Lrguk "leucine-rich repeats and guanylate kinase domain containing" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0Q0 LRRC48 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284039 pprA "Protein phosphatase 1 regulatory subunit 7" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0032163 TbCMF46 "TbCMF46" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00011637 T09A5.9 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-349 lrrc48 "leucine rich repeat containing 48" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051113-288 ppp1r7 "protein phosphatase 1, regulatory (inhibitor) subunit 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query662
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-08
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 1e-06
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-06
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 3e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information 
 Score = 64.6 bits (157), Expect = 6e-11
 Identities = 53/177 (29%), Positives = 79/177 (44%), Gaps = 7/177 (3%)

Query: 368 KYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRITA--GALPRGLHILN 425
           + + +L    +     N     I  L    +L  L+L  N I  I    G L   L  L+
Sbjct: 87  ENLLNLLPLPSLDLNLNRLRSNISELLELTNLTSLDLDNNNITDIPPLIGLLKSNLKELD 146

Query: 426 LSKNNISTI-EGLRELTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLH- 483
           LS N I ++   LR L  L+ LDLS+N +  +   L++ S+L  L L+GNKIS++     
Sbjct: 147 LSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIE 206

Query: 484 RLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPAQKNVGDEQLKKNLQSL 540
            L  L  LDL  N I   + L  L +N  +L  + L  N  +          NL++L
Sbjct: 207 LLSALEELDLSNNSII--ELLSSL-SNLKNLSGLELSNNKLEDLPESIGNLSNLETL 260

Length = 394
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 662
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.77
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.75
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.75
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.75
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.72
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.71
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.65
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.63
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.58
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.58
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.58
KOG4237498 consensus Extracellular matrix protein slit, conta 99.57
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.55
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.54
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.4
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.39
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.38
KOG4237498 consensus Extracellular matrix protein slit, conta 99.37
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.32
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.31
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.27
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.26
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.19
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.09
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.08
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.95
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.89
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.85
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.84
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.69
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.56
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.49
KOG2123 388 consensus Uncharacterized conserved protein [Funct 98.42
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.4
PLN03150623 hypothetical protein; Provisional 98.39
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.39
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.32
PLN03150623 hypothetical protein; Provisional 98.29
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.29
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.12
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.95
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.87
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.87
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.87
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.87
PRK15386426 type III secretion protein GogB; Provisional 97.79
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.74
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.7
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.54
PRK15386 426 type III secretion protein GogB; Provisional 97.43
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.42
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.32
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.3
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.94
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.93
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.81
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.75
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.99
KOG4308478 consensus LRR-containing protein [Function unknown 94.33
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 94.24
KOG4308478 consensus LRR-containing protein [Function unknown 94.14
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.77
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.77
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 90.43
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.29
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.2
smart0037026 LRR Leucine-rich repeats, outliers. 88.39
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.39
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 87.55
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 85.45
smart0037026 LRR Leucine-rich repeats, outliers. 83.12
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.12
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information 
Probab=99.84  E-value=5.8e-22  Score=215.50  Aligned_cols=252  Identities=21%  Similarity=0.221  Sum_probs=157.5

Q ss_pred             cccCCCCCccCCC--CCCCCCCceeecCCccCCCcchhhhcCCCCCCCCcccCCCCCCCCccCCc----ccCCCCCceee
Q 035577          282 VMPDENSVKKLQG--ESLHEQWDKLPSKHFKIKRIKEWVNDLQHCSPLEESDETSVSNDQVKRDP----KVLNGSTAVKV  355 (662)
Q Consensus       282 L~ls~N~I~~L~~--~s~l~~L~~L~l~~~si~~L~~~~~~L~~l~~L~~L~~l~ls~n~L~~~p----~~l~~L~~L~l  355 (662)
                      |.++.|.|+.+..  |..+..|..|.+..|.++.++..     .++.|..|..+++..|.|....    ..+.+|+.|++
T Consensus       178 L~La~N~It~l~~~~F~~lnsL~tlkLsrNrittLp~r-----~Fk~L~~L~~LdLnrN~irive~ltFqgL~Sl~nlkl  252 (873)
T KOG4194|consen  178 LNLASNRITTLETGHFDSLNSLLTLKLSRNRITTLPQR-----SFKRLPKLESLDLNRNRIRIVEGLTFQGLPSLQNLKL  252 (873)
T ss_pred             EeeccccccccccccccccchheeeecccCcccccCHH-----HhhhcchhhhhhccccceeeehhhhhcCchhhhhhhh
Confidence            6677777777766  66666777777777777766642     1222222333334444443331    12334444444


Q ss_pred             CCccccchhhhHHHhhhccCCccEEEccCCCCCCCCC--CCCCCCCCEEEccCCCCcccCCCcCC--CCccEEEccCCCC
Q 035577          356 DGKVTAGMEAVTKYISSLSASATTVQLSNHGLVVIPF--LSAFVSLKVLNLSGNAIVRITAGALP--RGLHILNLSKNNI  431 (662)
Q Consensus       356 ~~~~~~~l~~l~~~l~~l~~sL~~L~Ls~N~L~~lp~--l~~L~~L~~L~Ls~N~L~~l~~~~~~--~~L~~L~Ls~N~L  431 (662)
                      -.+   ++..+....+.-...+++|+|+.|+++.+..  +-+|+.|+.|+|++|.|..|....+.  ++|++|+|++|+|
T Consensus       253 qrN---~I~kL~DG~Fy~l~kme~l~L~~N~l~~vn~g~lfgLt~L~~L~lS~NaI~rih~d~WsftqkL~~LdLs~N~i  329 (873)
T KOG4194|consen  253 QRN---DISKLDDGAFYGLEKMEHLNLETNRLQAVNEGWLFGLTSLEQLDLSYNAIQRIHIDSWSFTQKLKELDLSSNRI  329 (873)
T ss_pred             hhc---CcccccCcceeeecccceeecccchhhhhhcccccccchhhhhccchhhhheeecchhhhcccceeEecccccc
Confidence            333   2333333222222336777777777776653  67777777777777777766655444  7777777777777


Q ss_pred             CCCc--CCCCCCCCCEEeCcCCCCcccccc-ccCCCCCcEEEcCCCCCCCc-----ccccCCCCCcEEECCCCccCcccc
Q 035577          432 STIE--GLRELTRLRVLDLSYNRILRIGHG-LASCSSLKELYLAGNKISEV-----EGLHRLLKLTVLDLRFNKISTAKC  503 (662)
Q Consensus       432 ~~lp--~l~~L~~L~~LdLs~N~Ls~Lp~~-l~~L~~L~~L~Ls~N~L~~l-----~~l~~L~~L~~LdLs~N~Ls~l~~  503 (662)
                      +.++  .|..|..|++|+|++|.|+.|.++ |..+.+|++|||++|.|+..     ..|..+++|+.|.|.+|+|..++ 
T Consensus       330 ~~l~~~sf~~L~~Le~LnLs~Nsi~~l~e~af~~lssL~~LdLr~N~ls~~IEDaa~~f~gl~~LrkL~l~gNqlk~I~-  408 (873)
T KOG4194|consen  330 TRLDEGSFRVLSQLEELNLSHNSIDHLAEGAFVGLSSLHKLDLRSNELSWCIEDAAVAFNGLPSLRKLRLTGNQLKSIP-  408 (873)
T ss_pred             ccCChhHHHHHHHhhhhcccccchHHHHhhHHHHhhhhhhhcCcCCeEEEEEecchhhhccchhhhheeecCceeeecc-
Confidence            7775  466777777777777777766655 66667777777777766543     24566667777777777776664 


Q ss_pred             chHhhhcCCCCcEEEccCCCCC-----------------------CCCChHHHHHHHHhhCcc
Q 035577          504 LGQLAANYNSLQAISLEGNPAQ-----------------------KNVGDEQLKKNLQSLLPH  543 (662)
Q Consensus       504 l~~~l~~l~~L~~L~Ls~N~l~-----------------------~~~~~~~l~~~l~~~l~~  543 (662)
                       ..+|..++.|++|+|.+|+|.                       |+|...++.+|+....++
T Consensus       409 -krAfsgl~~LE~LdL~~NaiaSIq~nAFe~m~Lk~Lv~nSssflCDCql~Wl~qWl~~~~lq  470 (873)
T KOG4194|consen  409 -KRAFSGLEALEHLDLGDNAIASIQPNAFEPMELKELVMNSSSFLCDCQLKWLAQWLYRRKLQ  470 (873)
T ss_pred             -hhhhccCcccceecCCCCcceeecccccccchhhhhhhcccceEEeccHHHHHHHHHhcccc
Confidence             555666677777777766653                       578888888998887665

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query662
1m9l_A199 Relaxation-Based Refined Structure Of Chlamydomonas 4e-08
1ds9_A198 Solution Structure Of Chlamydomonas Outer Arm Dynei 4e-08
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-07
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-07
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 5e-07
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 5e-07
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 6e-07
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 7e-07
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 7e-07
3oja_A 487 Crystal Structure Of Lrim1APL1C COMPLEX Length = 48 2e-06
3o53_A317 Crystal Structure Of Lrim1 Leucine-Rich Repeat Doma 2e-06
1xeu_A263 Crystal Structure Of Internalin C From Listeria Mon 5e-06
2z81_A 549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 8e-06
3a79_A 580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 8e-06
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 2e-05
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 3e-05
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-05
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 6e-05
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 8e-05
1dce_A567 Crystal Structure Of Rab Geranylgeranyltransferase 4e-04
1ltx_A567 Structure Of Rab Escort Protein-1 In Complex With R 4e-04
2wqx_A289 Inlb321_4r: S199r, D200r, G206r, A227r, C242a Mutan 4e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 5e-04
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 6e-04
>pdb|1M9L|A Chain A, Relaxation-Based Refined Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 199 Back     alignment and structure 
Iteration: 1

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 72/133 (54%), Gaps = 5/133 (3%)
Query: 424 LNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLH 483
           L LS NNI  I  L  +  LR+L L  N I +I +  A   +L+EL+++ N+I+ + G+ 
Sbjct: 54  LALSTNNIEKISSLSGMENLRILSLGRNLIKKIENLDAVADTLEELWISYNQIASLSGIE 113
Query: 484 RLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPA----QKNVGDEQLKKNLQS 539
           +L+ L VL +  NKI+    + +LAA  + L+ + L GNP     ++N    + +  +  
Sbjct: 114 KLVNLRVLYMSNNKITNWGEIDKLAA-LDKLEDLLLAGNPLYNDYKENNATSEYRIEVVK 172
Query: 540 LLPHLVYFNWQPM 552
            LP+L   +  P+
Sbjct: 173 RLPNLKKLDGMPV 185
>pdb|1DS9|A Chain A, Solution Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 198 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3OJA|A Chain A, Crystal Structure Of Lrim1APL1C COMPLEX Length = 487 Back     alignment and structure
>pdb|3O53|A Chain A, Crystal Structure Of Lrim1 Leucine-Rich Repeat Domain Length = 317 Back     alignment and structure
>pdb|1XEU|A Chain A, Crystal Structure Of Internalin C From Listeria Monocytogenes Length = 263 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|1DCE|A Chain A, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 567 Back     alignment and structure
>pdb|1LTX|A Chain A, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 567 Back     alignment and structure
>pdb|2WQX|A Chain A, Inlb321_4r: S199r, D200r, G206r, A227r, C242a Mutant Of The Listeria Monocytogenes Inlb Internalin Domain Length = 289 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query662
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-29
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-29
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-28
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-27
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-28
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-22
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-27
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-26
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-26
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-26
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-26
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-25
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-23
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-19
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-18
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-19
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-15
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-17
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-19
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-16
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-16
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-13
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-13
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-14
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-14
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-13
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-12
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-07
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-10
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 7e-09
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 9e-09
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 1e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 8e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-07
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 2e-06
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 7e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-04
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
 Score =  134 bits (340), Expect = 2e-36
 Identities = 45/166 (27%), Positives = 79/166 (47%), Gaps = 6/166 (3%)

Query: 402 LNLSGNAIVRITAG-ALPRGLHILNLSKNNISTIEGLRELTRLRVLDLSYNRILRIGHGL 460
           L+     I ++ A  +  +    L LS NNI  I  L  +  LR+L L  N I +I +  
Sbjct: 30  LHGMIPPIEKMDATLSTLKACKHLALSTNNIEKISSLSGMENLRILSLGRNLIKKIENLD 89

Query: 461 ASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAISLE 520
           A   +L+EL+++ N+I+ + G+ +L+ L VL +  NKI+    + +LAA    L+ + L 
Sbjct: 90  AVADTLEELWISYNQIASLSGIEKLVNLRVLYMSNNKITNWGEIDKLAALDK-LEDLLLA 148

Query: 521 GNPAQKNVGDEQLKKN----LQSLLPHLVYFNWQPMKASTLKDASD 562
           GNP   +  +          +   LP+L   +  P+     + A+ 
Sbjct: 149 GNPLYNDYKENNATSEYRIEVVKRLPNLKKLDGMPVDVDEREQANV 194
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query662
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.88
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.86
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.86
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.85
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.83
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.82
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.82
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.82
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.82
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.81
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.81
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.8
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.8
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.8
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.8
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.8
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.8
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.79
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.79
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.78
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.78
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.78
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.78
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.77
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.77
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.77
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.76
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.76
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.76
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.76
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.75
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.67
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.64
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.62
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.62
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.61
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.51
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.49
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.49
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.48
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.46
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.46
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.41
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.41
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.37
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.29
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.27
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.26
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.22
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.21
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.16
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.15
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.01
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.99
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.92
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.91
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.65
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.4
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.37
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.31
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.04
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.99
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.85
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.8
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.71
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.66
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.45
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.38
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.09
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.07
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.48
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.90  E-value=2.1e-22  Score=213.02  Aligned_cols=227  Identities=22%  Similarity=0.272  Sum_probs=104.1

Q ss_pred             cccCCCCCccCCCCCCCCCCceeecCCccCCCcchhhhcCCCCCCCCcccCCCCCCCCccCCc--ccCCCCCceeeCCcc
Q 035577          282 VMPDENSVKKLQGESLHEQWDKLPSKHFKIKRIKEWVNDLQHCSPLEESDETSVSNDQVKRDP--KVLNGSTAVKVDGKV  359 (662)
Q Consensus       282 L~ls~N~I~~L~~~s~l~~L~~L~l~~~si~~L~~~~~~L~~l~~L~~L~~l~ls~n~L~~~p--~~l~~L~~L~l~~~~  359 (662)
                      ++++.|.+..++.+..+++|+.|++.+|.++.++.    +..+..|+.|+   ++.+.+...+  ..+.+|+.|++.++.
T Consensus        71 L~l~~n~i~~~~~~~~l~~L~~L~L~~n~i~~~~~----~~~l~~L~~L~---l~~n~i~~~~~~~~l~~L~~L~l~~n~  143 (347)
T 4fmz_A           71 LNLNGNQITDISPLSNLVKLTNLYIGTNKITDISA----LQNLTNLRELY---LNEDNISDISPLANLTKMYSLNLGANH  143 (347)
T ss_dssp             EECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG----GTTCTTCSEEE---CTTSCCCCCGGGTTCTTCCEEECTTCT
T ss_pred             EEccCCccccchhhhcCCcCCEEEccCCcccCchH----HcCCCcCCEEE---CcCCcccCchhhccCCceeEEECCCCC
Confidence            55555555555555555555555555555554432    23333333322   2223332222  124445555554431


Q ss_pred             -ccchhhhHHHhhhccCCccEEEccCCCCCCCCCCCCCCCCCEEEccCCCCcccCCCcCCCCccEEEccCCCCCCCcCCC
Q 035577          360 -TAGMEAVTKYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRITAGALPRGLHILNLSKNNISTIEGLR  438 (662)
Q Consensus       360 -~~~l~~l~~~l~~l~~sL~~L~Ls~N~L~~lp~l~~L~~L~~L~Ls~N~L~~l~~~~~~~~L~~L~Ls~N~L~~lp~l~  438 (662)
                       ...+.    .+..++. |+.|++++|.+..++.+..+++|++|++++|.+..++.....++|+.|++++|.++.++.+.
T Consensus       144 ~~~~~~----~~~~l~~-L~~L~l~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~l~~L~~L~l~~n~l~~~~~~~  218 (347)
T 4fmz_A          144 NLSDLS----PLSNMTG-LNYLTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISPLASLTSLHYFTAYVNQITDITPVA  218 (347)
T ss_dssp             TCCCCG----GGTTCTT-CCEEECCSSCCCCCGGGGGCTTCSEEECTTSCCCCCGGGGGCTTCCEEECCSSCCCCCGGGG
T ss_pred             Cccccc----chhhCCC-CcEEEecCCCcCCchhhccCCCCCEEEccCCcccccccccCCCccceeecccCCCCCCchhh
Confidence             11111    1222222 55555555555544444555555555555555544443222244555555555555444444


Q ss_pred             CCCCCCEEeCcCCCCccccccccCCCCCcEEEcCCCCCCCcccccCCCCCcEEECCCCccCccccchHhhhcCCCCcEEE
Q 035577          439 ELTRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKISTAKCLGQLAANYNSLQAIS  518 (662)
Q Consensus       439 ~L~~L~~LdLs~N~Ls~Lp~~l~~L~~L~~L~Ls~N~L~~l~~l~~L~~L~~LdLs~N~Ls~l~~l~~~l~~l~~L~~L~  518 (662)
                      .+++|++|++++|.++.++. +..+++|++|++++|.++.++.+..+++|+.|++++|.|++++    .+..+++|+.|+
T Consensus       219 ~~~~L~~L~l~~n~l~~~~~-~~~l~~L~~L~l~~n~l~~~~~~~~l~~L~~L~l~~n~l~~~~----~~~~l~~L~~L~  293 (347)
T 4fmz_A          219 NMTRLNSLKIGNNKITDLSP-LANLSQLTWLEIGTNQISDINAVKDLTKLKMLNVGSNQISDIS----VLNNLSQLNSLF  293 (347)
T ss_dssp             GCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCG----GGGGCTTCSEEE
T ss_pred             cCCcCCEEEccCCccCCCcc-hhcCCCCCEEECCCCccCCChhHhcCCCcCEEEccCCccCCCh----hhcCCCCCCEEE
Confidence            44555555555555544443 4444555555555555544444444455555555555444431    123444555555


Q ss_pred             ccCCCCC
Q 035577          519 LEGNPAQ  525 (662)
Q Consensus       519 Ls~N~l~  525 (662)
                      |++|++.
T Consensus       294 L~~n~l~  300 (347)
T 4fmz_A          294 LNNNQLG  300 (347)
T ss_dssp             CCSSCCC
T ss_pred             CcCCcCC
Confidence            5555443
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 662
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-13
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-15
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-08
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 9e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 8e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 1e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.004
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 76.6 bits (187), Expect = 1e-15
 Identities = 40/142 (28%), Positives = 61/142 (42%), Gaps = 5/142 (3%)

Query: 381 QLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRITAGALPRGLHILNLSKNNISTIEGLREL 440
            L+N+ +  +  LS    L  L L  N I  I+  A    L  L L++N +  I  +  L
Sbjct: 247 DLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNL 306

Query: 441 TRLRVLDLSYNRILRIGHGLASCSSLKELYLAGNKISEVEGLHRLLKLTVLDLRFNKIST 500
             L  L L +N I  I   ++S + L+ L+ A NK+S+V  L  L  +  L    N+IS 
Sbjct: 307 KNLTYLTLYFNNISDI-SPVSSLTKLQRLFFANNKVSDVSSLANLTNINWLSAGHNQISD 365

Query: 501 AKCLGQLAANYNSLQAISLEGN 522
              L  L      +  + L   
Sbjct: 366 LTPLANL----TRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query662
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.63
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.61
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.61
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.6
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.5
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.5
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.35
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.33
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.25
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.06
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.05
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.93
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.89
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.63
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.77
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.62
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.18
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.85  E-value=1.2e-20  Score=191.31  Aligned_cols=201  Identities=22%  Similarity=0.239  Sum_probs=166.2

Q ss_pred             CCCCCCccCCcccC-CCCCceeeCCccccchhhhHHHhhhccCCccEEEccCCCCCCCCCCCCCCCCCEEEccCCCCccc
Q 035577          334 SVSNDQVKRDPKVL-NGSTAVKVDGKVTAGMEAVTKYISSLSASATTVQLSNHGLVVIPFLSAFVSLKVLNLSGNAIVRI  412 (662)
Q Consensus       334 ~ls~n~L~~~p~~l-~~L~~L~l~~~~~~~l~~l~~~l~~l~~sL~~L~Ls~N~L~~lp~l~~L~~L~~L~Ls~N~L~~l  412 (662)
                      +.+.+.|..+|..+ .+++.|+++++.+..+..  ..+..++. |++|+|++|.|+.+|.++.+++|++|+|++|+|+.+
T Consensus        16 ~C~~~~L~~iP~~lp~~l~~L~Ls~N~i~~l~~--~~f~~l~~-L~~L~L~~N~l~~l~~~~~l~~L~~L~Ls~N~l~~~   92 (266)
T d1p9ag_          16 NCDKRNLTALPPDLPKDTTILHLSENLLYTFSL--ATLMPYTR-LTQLNLDRAELTKLQVDGTLPVLGTLDLSHNQLQSL   92 (266)
T ss_dssp             ECTTSCCSSCCSCCCTTCCEEECTTSCCSEEEG--GGGTTCTT-CCEEECTTSCCCEEECCSCCTTCCEEECCSSCCSSC
T ss_pred             EccCCCCCeeCcCcCcCCCEEECcCCcCCCcCH--HHhhcccc-cccccccccccccccccccccccccccccccccccc
Confidence            33444444454333 568888888876655432  33445554 999999999999999889999999999999999887


Q ss_pred             CCCcCC-CCccEEEccCCCCCCCc--CCCCCCCCCEEeCcCCCCcccccc-ccCCCCCcEEEcCCCCCCCcc--cccCCC
Q 035577          413 TAGALP-RGLHILNLSKNNISTIE--GLRELTRLRVLDLSYNRILRIGHG-LASCSSLKELYLAGNKISEVE--GLHRLL  486 (662)
Q Consensus       413 ~~~~~~-~~L~~L~Ls~N~L~~lp--~l~~L~~L~~LdLs~N~Ls~Lp~~-l~~L~~L~~L~Ls~N~L~~l~--~l~~L~  486 (662)
                      +..... +.|++|++++|.+..++  .+..+.+|++|++++|.++.+|.. +..++.|+.|++++|+|+.++  .+..++
T Consensus        93 ~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~  172 (266)
T d1p9ag_          93 PLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLE  172 (266)
T ss_dssp             CCCTTTCTTCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTTTCT
T ss_pred             ccccccccccccccccccccceeeccccccccccccccccccccceeccccccccccchhcccccccccccCcccccccc
Confidence            654333 89999999999999875  578899999999999999999866 678999999999999999985  588899


Q ss_pred             CCcEEECCCCccCccccchHhhhcCCCCcEEEccCCCCCCCCChHHHHHHHHhh
Q 035577          487 KLTVLDLRFNKISTAKCLGQLAANYNSLQAISLEGNPAQKNVGDEQLKKNLQSL  540 (662)
Q Consensus       487 ~L~~LdLs~N~Ls~l~~l~~~l~~l~~L~~L~Ls~N~l~~~~~~~~l~~~l~~~  540 (662)
                      +|++|+|++|+|+.+   |..+..+++|+.|+|++|||.|+|...++..|+...
T Consensus       173 ~L~~L~Ls~N~L~~l---p~~~~~~~~L~~L~L~~Np~~CdC~~~~l~~wl~~~  223 (266)
T d1p9ag_         173 NLDTLLLQENSLYTI---PKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDN  223 (266)
T ss_dssp             TCCEEECCSSCCCCC---CTTTTTTCCCSEEECCSCCBCCSGGGHHHHHHHHHT
T ss_pred             ccceeecccCCCccc---ChhHCCCCCCCEEEecCCCCCCCcchHHHHHHHHhc
Confidence            999999999999987   444567899999999999999999988888888754
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure