Citrus Sinensis ID: 035618


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MNNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEISSFIKLEDIGLSINRFISSIPESLGKLLKLHYLDLSKNQFFQELPKELEKVVQLSE
cccccccccHHHHccccccccccccccccccccHHHHccccccccccccccccccccHHHHcccccccEEcccccccccccHHHHccccccccccccccccccccHHHHccccccc
EccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHccHHHccc
mnnstgdipceigksshlHAFDLLFNHLFVeipndlgklnSLTKLILKWnqftgrlppeissfikleDIGLSINRFISSIPESLGKLLKLHYLDLSKNQFFQELPKELEKVVQLSE
MNNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEISSFIKLEDIGLSINRFISSIPESLGKLLKLHYLDLSKNQFFQELPKELEKVVQLSE
MNNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEISSFIKLEDIGLSINRFISSIPESlgkllklhyldlskNQFFQELPKELEKVVQLSE
*********CEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEISSFIKLEDIGLSINRFISSIPESLGKLLKLHYLDLSKNQFFQE*************
MNNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEISSFIKLEDIGLSINRFISSIPESLGKLLKLHYLDLSKNQFFQELPKELEKVVQL**
MNNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEISSFIKLEDIGLSINRFISSIPESLGKLLKLHYLDLSKNQFFQELPKE*********
MNNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEISSFIKLEDIGLSINRFISSIPESLGKLLKLHYLDLSKNQFFQELPKELEKV*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEISSFIKLEDIGLSINRFISSIPESLGKLLKLHYLDLSKNQFFQELPKELEKVVQLSE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query116 2.2.26 [Sep-21-2011]
Q9LP24 1120 Probable leucine-rich rep yes no 0.982 0.101 0.426 6e-18
Q8VZG8 1045 Probable LRR receptor-lik no no 0.974 0.108 0.403 3e-15
Q9ZPS9 1143 Serine/threonine-protein no no 0.974 0.098 0.385 8e-15
Q9SHI2 1101 Leucine-rich repeat recep no no 0.982 0.103 0.373 1e-13
Q9C9H7 847 Receptor-like protein 12 no no 0.956 0.131 0.375 1e-13
Q8L899 1207 Systemin receptor SR160 O N/A no 0.931 0.089 0.381 4e-13
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.922 0.088 0.381 4e-13
Q9LYN8 1192 Leucine-rich repeat recep no no 0.870 0.084 0.362 5e-13
Q9LHP4 1141 Receptor-like protein kin no no 0.931 0.094 0.385 5e-13
C0LGF5 1072 Probable LRR receptor-lik no no 0.939 0.101 0.4 6e-13
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function desciption
 Score = 89.4 bits (220), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 49/115 (42%), Positives = 71/115 (61%), Gaps = 1/115 (0%)

Query: 2   NNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEIS 61
           NN TG IP EI   + L   DL  N+LF E+P  +G L +L++L L  NQ +GR+P  +S
Sbjct: 568 NNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLRLNGNQLSGRVPAGLS 627

Query: 62  SFIKLEDIGLSINRFISSIPESLGKLLKLHYLDLSKNQFFQELPKELEKVVQLSE 116
               LE + LS N F S IP++    LKLH ++LS+N+F   +P+ L K+ QL++
Sbjct: 628 FLTNLESLDLSSNNFSSEIPQTFDSFLKLHDMNLSRNKFDGSIPR-LSKLTQLTQ 681





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
255545702 1008 receptor protein kinase, putative [Ricin 0.974 0.112 0.478 4e-20
225456159 1038 PREDICTED: probable LRR receptor-like se 0.982 0.109 0.478 2e-19
225456161 1037 PREDICTED: probable LRR receptor-like se 0.982 0.109 0.478 3e-19
147772402 996 hypothetical protein VITISV_022117 [Viti 0.784 0.091 0.469 1e-18
359491512 1078 PREDICTED: probable LRR receptor-like se 0.965 0.103 0.443 9e-18
224127210 310 predicted protein [Populus trichocarpa] 0.939 0.351 0.454 3e-17
147767326 1032 hypothetical protein VITISV_008862 [Viti 0.836 0.093 0.458 6e-17
359491509 1032 PREDICTED: probable LRR receptor-like se 0.732 0.082 0.458 6e-17
359484864 1091 PREDICTED: probable LRR receptor-like se 0.965 0.102 0.424 1e-16
297743684 789 unnamed protein product [Vitis vinifera] 0.715 0.105 0.439 1e-16
>gi|255545702|ref|XP_002513911.1| receptor protein kinase, putative [Ricinus communis] gi|223546997|gb|EEF48494.1| receptor protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  102 bits (253), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 74/115 (64%)

Query: 2   NNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEIS 61
           NN +G IP EIG ++ L   D   N L   IP +LGKL SL ++ L+ NQ +  +P E  
Sbjct: 454 NNISGIIPPEIGNAARLQGLDFSSNQLVGRIPKELGKLTSLVRVNLEDNQLSDGVPSEFG 513

Query: 62  SFIKLEDIGLSINRFISSIPESLGKLLKLHYLDLSKNQFFQELPKELEKVVQLSE 116
           S   LE + LS NRF  SIP ++G L+KL+YL+LS NQF QE+P +L K+V LS+
Sbjct: 514 SLTDLESLDLSANRFNQSIPGNIGNLVKLNYLNLSNNQFSQEIPIQLGKLVHLSK 568




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225456159|ref|XP_002278561.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456161|ref|XP_002278590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147772402|emb|CAN73988.1| hypothetical protein VITISV_022117 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491512|ref|XP_002278614.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224127210|ref|XP_002329427.1| predicted protein [Populus trichocarpa] gi|222870477|gb|EEF07608.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147767326|emb|CAN68996.1| hypothetical protein VITISV_008862 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491509|ref|XP_002278522.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359484864|ref|XP_002273966.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743684|emb|CBI36567.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.982 0.101 0.373 3.7e-13
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.922 0.108 0.355 3.7e-12
TAIR|locus:2085537 894 RLP34 "AT3G11010" [Arabidopsis 0.922 0.119 0.355 1.1e-11
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.982 0.120 0.324 1.9e-11
TAIR|locus:2041150 1143 BRL2 "BRI1-like 2" [Arabidopsi 0.982 0.099 0.342 2e-11
TAIR|locus:2078102 875 RLP33 "receptor like protein 3 0.922 0.122 0.345 3.7e-11
TAIR|locus:2090754 711 RLP43 "receptor like protein 4 0.982 0.160 0.307 4.5e-11
TAIR|locus:2205005 1019 RLP7 "AT1G47890" [Arabidopsis 0.956 0.108 0.342 7.4e-11
TAIR|locus:2084016 937 AT3G53590 [Arabidopsis thalian 0.965 0.119 0.312 8.5e-11
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.965 0.132 0.330 9.4e-11
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 186 (70.5 bits), Expect = 3.7e-13, P = 3.7e-13
 Identities = 43/115 (37%), Positives = 62/115 (53%)

Query:     2 NNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEIS 61
             NN TG IP EI   + L   DL  N+LF E+P  +G L +L++L L  NQ +GR+P  +S
Sbjct:   568 NNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLRLNGNQLSGRVPAGLS 627

Query:    62 SFIKLEDIGLSINRFISSIPESXXXXXXXXXXXXXXNQFFQELPKELEKVVQLSE 116
                 LE + LS N F S IP++              N+F   +P+ L K+ QL++
Sbjct:   628 FLTNLESLDLSSNNFSSEIPQTFDSFLKLHDMNLSRNKFDGSIPR-LSKLTQLTQ 681


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041150 BRL2 "BRI1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084016 AT3G53590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-11
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 71.4 bits (175), Expect = 1e-15
 Identities = 44/113 (38%), Positives = 63/113 (55%)

Query: 2   NNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEIS 61
           NN +G+IP EIG  + L+  DL++N+L   IP+ LG L +L  L L  N+ +G +PP I 
Sbjct: 222 NNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIF 281

Query: 62  SFIKLEDIGLSINRFISSIPESLGKLLKLHYLDLSKNQFFQELPKELEKVVQL 114
           S  KL  + LS N     IPE + +L  L  L L  N F  ++P  L  + +L
Sbjct: 282 SLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRL 334


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 116
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.7
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.68
PLN03150 623 hypothetical protein; Provisional 99.56
KOG0617 264 consensus Ras suppressor protein (contains leucine 99.53
PLN03150623 hypothetical protein; Provisional 99.5
KOG0617264 consensus Ras suppressor protein (contains leucine 99.44
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.34
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.27
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.24
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.22
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.21
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.13
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.12
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.99
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.88
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.86
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.78
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.73
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 98.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.69
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.69
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.68
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.66
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.65
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.62
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.59
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.55
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.46
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.46
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.45
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.44
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.42
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.39
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.38
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.38
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.36
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.36
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.05
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.93
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.86
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.68
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.57
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.56
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.45
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.43
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.41
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.37
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.35
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.32
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.32
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.17
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.79
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.62
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.62
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.61
PRK15386 426 type III secretion protein GogB; Provisional 96.42
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.34
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.28
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 96.22
KOG0473 326 consensus Leucine-rich repeat protein [Function un 96.03
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.95
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.76
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.39
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.24
smart0037026 LRR Leucine-rich repeats, outliers. 95.24
KOG2982 418 consensus Uncharacterized conserved protein [Funct 94.27
PRK15386 426 type III secretion protein GogB; Provisional 94.18
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 92.27
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 91.04
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 91.02
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.37
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.2
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 88.99
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 88.28
KOG1947 482 consensus Leucine rich repeat proteins, some prote 80.08
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.70  E-value=5e-17  Score=115.71  Aligned_cols=114  Identities=37%  Similarity=0.496  Sum_probs=66.8

Q ss_pred             CccccccCcCccCCcccceeeccccccccccchhhcCCCCCCeEecccCcceecCchhhhccCCCCeEEeeceeeccCCc
Q 035618            2 NNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEISSFIKLEDIGLSINRFISSIP   81 (116)
Q Consensus         2 n~~~~~~~~~~~~l~~L~~l~l~~n~~~~~~~~~~~~l~~l~~l~l~~~~~~~~~~~~~~~~~~L~~l~l~~n~~~~~~~   81 (116)
                      |.+.+..|..+..+++|+.|++++|.+.+..|..+..+++|+++++++|.+.+.+|..+..+.+|+.+++++|.+.+.+|
T Consensus       150 n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p  229 (968)
T PLN00113        150 NMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIP  229 (968)
T ss_pred             CcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCC
Confidence            34444555556666666666666666555556666666666666666666555555555555666666666665555555


Q ss_pred             HHHhcccCCCEEecccCccccccchHHhhhcCCC
Q 035618           82 ESLGKLLKLHYLDLSKNQFFQELPKELEKVVQLS  115 (116)
Q Consensus        82 ~~~~~~~~l~~l~l~~n~l~~~~p~~~~~l~~L~  115 (116)
                      ..+..+++|++|++++|.+.+.+|..++.++.|+
T Consensus       230 ~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~  263 (968)
T PLN00113        230 YEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQ  263 (968)
T ss_pred             hhHhcCCCCCEEECcCceeccccChhHhCCCCCC
Confidence            5555555666666666655555555555555443



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-07
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 7e-07
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 7e-07
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Iteration: 1

Score = 51.6 bits (122), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 29/83 (34%), Positives = 42/83 (50%) Query: 1 MNNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEI 60 +NN G IP I K + LH + ++ IP+ L ++ +L L +N +G LPP I Sbjct: 86 INNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSI 145 Query: 61 SSFIKLEDIGLSINRFISSIPES 83 SS L I NR +IP+S Sbjct: 146 SSLPNLVGITFDGNRISGAIPDS 168
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-24
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-19
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-22
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 5e-13
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 8e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 9e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 4e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-06
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
3m19_A 251 Variable lymphocyte receptor A diversity region; a 7e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-04
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-04
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 8e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 4e-04
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score = 93.8 bits (234), Expect = 1e-24
 Identities = 35/109 (32%), Positives = 54/109 (49%), Gaps = 1/109 (0%)

Query: 1   MNNSTGDIPCEIGKSSHLHAFDLLFNHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEI 60
           +NN  G IP  I K + LH   +   ++   IP+ L ++ +L  L   +N  +G LPP I
Sbjct: 86  INNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSI 145

Query: 61  SSFIKLEDIGLSINRFISSIPESLGKLLKLH-YLDLSKNQFFQELPKEL 108
           SS   L  I    NR   +IP+S G   KL   + +S+N+   ++P   
Sbjct: 146 SSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTF 194


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.81
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.8
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.77
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.73
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.71
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.71
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.71
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.69
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.68
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.67
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.67
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.67
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 99.67
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.66
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.66
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.65
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.65
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.65
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.64
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.63
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.63
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.62
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.62
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.62
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.62
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.62
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.61
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.61
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.61
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.6
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.6
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.6
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.59
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.59
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.58
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.58
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.58
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.56
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.56
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.56
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.56
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.56
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.56
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.55
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 99.55
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.54
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.54
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.53
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.53
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.53
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.53
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.52
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.51
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.51
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.5
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.5
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 99.47
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.47
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.46
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.44
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 99.44
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.44
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.43
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.41
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 99.41
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.41
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.41
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.4
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.4
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.38
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.36
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.36
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.34
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.3
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.3
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.28
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.28
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.25
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.25
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.22
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.21
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.2
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.19
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.12
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.98
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.9
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.82
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.79
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.77
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.75
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.71
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.65
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.54
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.53
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.52
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.45
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.44
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.38
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.95
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.85
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.85
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.73
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.42
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.36
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.02
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.98
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.95
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.94
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.91
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.61
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.85
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.81  E-value=1.8e-19  Score=113.41  Aligned_cols=114  Identities=21%  Similarity=0.308  Sum_probs=87.6

Q ss_pred             Ccccc--ccCcCccCCcccceeeccc-cccccccchhhcCCCCCCeEecccCcceecCchhhhccCCCCeEEeeceeecc
Q 035618            2 NNSTG--DIPCEIGKSSHLHAFDLLF-NHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEISSFIKLEDIGLSINRFIS   78 (116)
Q Consensus         2 n~~~~--~~~~~~~~l~~L~~l~l~~-n~~~~~~~~~~~~l~~l~~l~l~~~~~~~~~~~~~~~~~~L~~l~l~~n~~~~   78 (116)
                      |.+.+  .+|..+..+++|+.|++++ |.+.+.+|..+..+++|+++++++|.+.+.+|..+..+++|+++++++|.+.+
T Consensus        60 ~~l~~~~~~~~~l~~l~~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~  139 (313)
T 1ogq_A           60 LNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSG  139 (313)
T ss_dssp             CCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEES
T ss_pred             CCccCCcccChhHhCCCCCCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCC
Confidence            45555  6777788888888888884 77767777778788888888888888877777777778888888888888777


Q ss_pred             CCcHHHhcccCCCEEecccCccccccchHHhhhc-CCC
Q 035618           79 SIPESLGKLLKLHYLDLSKNQFFQELPKELEKVV-QLS  115 (116)
Q Consensus        79 ~~~~~~~~~~~l~~l~l~~n~l~~~~p~~~~~l~-~L~  115 (116)
                      .+|..+..+++|+++++++|.+++.+|..++.++ .|+
T Consensus       140 ~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~~L~  177 (313)
T 1ogq_A          140 TLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFT  177 (313)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCC
T ss_pred             cCChHHhcCCCCCeEECcCCcccCcCCHHHhhhhhcCc
Confidence            7777777788888888888888767777777766 544



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 116
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 48.2 bits (113), Expect = 2e-08
 Identities = 14/59 (23%), Positives = 24/59 (40%), Gaps = 1/59 (1%)

Query: 47  LKWNQFTGRLPPEISSFIKLEDIGLSINRFISSIPESLGKLLKLHYLDLSKNQFFQELP 105
           L+ N+  G LP  ++    L  + +S N     IP+  G L +      + N+     P
Sbjct: 251 LRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGSP 308


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.64
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.62
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.61
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.5
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.45
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 99.42
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.38
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.32
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.2
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.2
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.19
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.17
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.1
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.98
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.95
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.89
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.63
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.51
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.48
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.46
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.4
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.31
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.26
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.25
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.2
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.85
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.43
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.92
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.22
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.74  E-value=6.5e-18  Score=104.66  Aligned_cols=113  Identities=22%  Similarity=0.321  Sum_probs=99.1

Q ss_pred             Ccccc--ccCcCccCCcccceeeccc-cccccccchhhcCCCCCCeEecccCcceecCchhhhccCCCCeEEeeceeecc
Q 035618            2 NNSTG--DIPCEIGKSSHLHAFDLLF-NHLFVEIPNDLGKLNSLTKLILKWNQFTGRLPPEISSFIKLEDIGLSINRFIS   78 (116)
Q Consensus         2 n~~~~--~~~~~~~~l~~L~~l~l~~-n~~~~~~~~~~~~l~~l~~l~l~~~~~~~~~~~~~~~~~~L~~l~l~~n~~~~   78 (116)
                      |.+.+  .+|..+..+++|++|++++ |.+++.+|+.+.++++|+++++++|++.+..+..+..+..|+.++++.|.+.+
T Consensus        60 ~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~  139 (313)
T d1ogqa_          60 LNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSG  139 (313)
T ss_dssp             CCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEES
T ss_pred             CCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccc
Confidence            44454  5788999999999999986 78888899999999999999999999998778888889999999999999888


Q ss_pred             CCcHHHhcccCCCEEecccCccccccchHHhhhcCC
Q 035618           79 SIPESLGKLLKLHYLDLSKNQFFQELPKELEKVVQL  114 (116)
Q Consensus        79 ~~~~~~~~~~~l~~l~l~~n~l~~~~p~~~~~l~~L  114 (116)
                      .+|..+..++.++.+++++|.+.+.+|+.++.+..+
T Consensus       140 ~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l  175 (313)
T d1ogqa_         140 TLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKL  175 (313)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTT
T ss_pred             cCchhhccCcccceeecccccccccccccccccccc
Confidence            889999999999999999999988999888877664



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure