Citrus Sinensis ID: 035653

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MGKRKSRKAKAVGVKKTKGMEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDECERANNS
ccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEcccccccEEEccccccccEEEccHHHHHHHHHccc
cccccccccccccccccccccccccEEcccccccccEEEEEEEccccEEEEEEEEcccEEEEcccccccccHHHHHHHHHHHHHccc
mgkrksrkakavgvkktkgmekldtqfqcpfcghgtsvecridkkiqIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDECERANNS
mgkrksrkakavgvkktkgmekldtqfqcpfcgHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDECERANNS
MGKRKSRkakavgvkktkgMEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDECERANNS
**********************LDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDEC******
*************************QFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDECERAN**
****************TKGMEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDECERANNS
*******************MEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDECERAN**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKRKSRKAKAVGVKKTKGMEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDECERANNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
Q8LHP089 Transcription elongation yes no 0.942 0.921 0.651 1e-24
Q8LEF3120 Transcription elongation yes no 0.954 0.691 0.632 9e-23
Q9XVZ884 Transcription elongation yes no 0.965 1.0 0.459 3e-17
Q8MQI682 Transcription elongation yes no 0.942 1.0 0.470 6e-16
Q9U50182 Transcription elongation N/A no 0.942 1.0 0.447 2e-15
P36053145 Transcription elongation yes no 0.942 0.565 0.418 7e-14
P6000383 Transcription elongation no no 0.724 0.759 0.492 2e-12
P6000283 Transcription elongation yes no 0.724 0.759 0.492 2e-12
A4IFR383 Transcription elongation yes no 0.724 0.759 0.492 2e-12
Q54KR580 Transcription elongation yes no 0.885 0.962 0.426 6e-12
>sp|Q8LHP0|ELOF1_ORYSJ Transcription elongation factor 1 homolog OS=Oryza sativa subsp. japonica GN=Os07g0631100 PE=3 SV=1 Back     alignment and function desciption
 Score =  111 bits (278), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 61/86 (70%), Gaps = 4/86 (4%)

Query: 1  MGKRKSRKAKAVGVKKTKGMEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERF 60
          MGKRKS    A      K M+KLDT F CPFC HG+SVECRID K  IGEA C  C E F
Sbjct: 1  MGKRKS----AAKPPPKKRMDKLDTVFSCPFCNHGSSVECRIDMKNLIGEASCRICQENF 56

Query: 61 CTQIHALTEPIDIYAEWIDECERANN 86
           T ++ALTEPIDIY+EWIDECER NN
Sbjct: 57 STTVNALTEPIDIYSEWIDECERVNN 82
Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q8LEF3|ELOF1_ARATH Transcription elongation factor 1 homolog OS=Arabidopsis thaliana GN=At5g46030 PE=2 SV=1 Back     alignment and function description
>sp|Q9XVZ8|ELOF1_CAEEL Transcription elongation factor 1 homolog OS=Caenorhabditis elegans GN=Y54G11A.11 PE=3 SV=1 Back     alignment and function description
>sp|Q8MQI6|ELOF1_DROME Transcription elongation factor 1 homolog OS=Drosophila melanogaster GN=CG40228 PE=1 SV=1 Back     alignment and function description
>sp|Q9U501|ELOF1_MANSE Transcription elongation factor 1 homolog OS=Manduca sexta PE=3 SV=1 Back     alignment and function description
>sp|P36053|ELF1_YEAST Transcription elongation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELF1 PE=1 SV=1 Back     alignment and function description
>sp|P60003|ELOF1_MOUSE Transcription elongation factor 1 homolog OS=Mus musculus GN=Elof1 PE=1 SV=1 Back     alignment and function description
>sp|P60002|ELOF1_HUMAN Transcription elongation factor 1 homolog OS=Homo sapiens GN=ELOF1 PE=2 SV=1 Back     alignment and function description
>sp|A4IFR3|ELOF1_BOVIN Transcription elongation factor 1 homolog OS=Bos taurus GN=ELOF1 PE=2 SV=1 Back     alignment and function description
>sp|Q54KR5|ELOF1_DICDI Transcription elongation factor 1 homolog OS=Dictyostelium discoideum GN=elof1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
25556300488 Transcription elongation factor, putativ 0.942 0.931 0.686 1e-23
11547352389 Os07g0631100 [Oryza sativa Japonica Grou 0.942 0.921 0.651 5e-23
297740448128 unnamed protein product [Vitis vinifera] 0.942 0.640 0.674 8e-23
22544356295 PREDICTED: transcription elongation fact 0.942 0.863 0.674 9e-23
22406128288 predicted protein [Populus trichocarpa] 0.942 0.931 0.651 2e-22
38627857688 transcription elongation factor 1 [Verni 0.942 0.931 0.662 2e-22
24209471889 hypothetical protein SORBIDRAFT_10g00371 0.931 0.910 0.647 2e-22
35712527689 PREDICTED: transcription elongation fact 0.931 0.910 0.647 2e-22
44945700988 PREDICTED: transcription elongation fact 0.942 0.931 0.674 3e-22
22546157692 PREDICTED: transcription elongation fact 0.931 0.880 0.647 4e-22
>gi|255563004|ref|XP_002522506.1| Transcription elongation factor, putative [Ricinus communis] gi|223538197|gb|EEF39806.1| Transcription elongation factor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/86 (68%), Positives = 63/86 (73%), Gaps = 4/86 (4%)

Query: 1  MGKRKSRKAKAVGVKKTKGMEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERF 60
          MGKRKSR AK    K+   M+KLDT F CPFC HGTSVECRID K  IGEA C  C E F
Sbjct: 1  MGKRKSR-AKPPPKKR---MDKLDTVFSCPFCNHGTSVECRIDMKNLIGEAVCAICQESF 56

Query: 61 CTQIHALTEPIDIYAEWIDECERANN 86
           T I ALTEPID+Y+EWIDECER NN
Sbjct: 57 STTITALTEPIDVYSEWIDECERVNN 82

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|115473523|ref|NP_001060360.1| Os07g0631100 [Oryza sativa Japonica Group] gi|25453308|sp|Q8LHP0.1|ELOF1_ORYSJ RecName: Full=Transcription elongation factor 1 homolog gi|22296365|dbj|BAC10134.1| unknown protein [Oryza sativa Japonica Group] gi|113611896|dbj|BAF22274.1| Os07g0631100 [Oryza sativa Japonica Group] gi|125538787|gb|EAY85182.1| hypothetical protein OsI_06540 [Oryza sativa Indica Group] gi|125601184|gb|EAZ40760.1| hypothetical protein OsJ_25233 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|297740448|emb|CBI30630.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225443562|ref|XP_002277951.1| PREDICTED: transcription elongation factor 1 homolog isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224061282|ref|XP_002300406.1| predicted protein [Populus trichocarpa] gi|222847664|gb|EEE85211.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|386278576|gb|AFJ04520.1| transcription elongation factor 1 [Vernicia fordii] Back     alignment and taxonomy information
>gi|242094718|ref|XP_002437849.1| hypothetical protein SORBIDRAFT_10g003710 [Sorghum bicolor] gi|195604838|gb|ACG24249.1| hypothetical protein [Zea mays] gi|195606448|gb|ACG25054.1| hypothetical protein [Zea mays] gi|195609588|gb|ACG26624.1| hypothetical protein [Zea mays] gi|195615226|gb|ACG29443.1| transcription elongation factor 1 [Zea mays] gi|195618278|gb|ACG30969.1| hypothetical protein [Zea mays] gi|195621712|gb|ACG32686.1| transcription elongation factor 1 [Zea mays] gi|195636870|gb|ACG37903.1| hypothetical protein [Zea mays] gi|195652807|gb|ACG45871.1| transcription elongation factor 1 [Zea mays] gi|195652919|gb|ACG45927.1| transcription elongation factor 1 [Zea mays] gi|224033669|gb|ACN35910.1| unknown [Zea mays] gi|241916072|gb|EER89216.1| hypothetical protein SORBIDRAFT_10g003710 [Sorghum bicolor] gi|413923721|gb|AFW63653.1| transcription elongation factor 1 [Zea mays] gi|414878997|tpg|DAA56128.1| TPA: transcription elongation factor 1 isoform 1 [Zea mays] gi|414878998|tpg|DAA56129.1| TPA: transcription elongation factor 1 isoform 2 [Zea mays] Back     alignment and taxonomy information
>gi|357125276|ref|XP_003564321.1| PREDICTED: transcription elongation factor 1 homolog isoform 1 [Brachypodium distachyon] gi|357125278|ref|XP_003564322.1| PREDICTED: transcription elongation factor 1 homolog isoform 2 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|449457009|ref|XP_004146241.1| PREDICTED: transcription elongation factor 1 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|225461576|ref|XP_002285261.1| PREDICTED: transcription elongation factor 1 homolog isoform 1 [Vitis vinifera] gi|225461578|ref|XP_002285263.1| PREDICTED: transcription elongation factor 1 homolog isoform 2 [Vitis vinifera] gi|302142940|emb|CBI20235.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
TAIR|locus:2161418120 AT5G46030 "AT5G46030" [Arabido 0.954 0.691 0.597 2.4e-21
WB|WBGene0001321984 Y54G11A.11.2 [Caenorhabditis e 0.965 1.0 0.436 2.9e-16
UNIPROTKB|Q9XVZ884 Y54G11A.11 "Transcription elon 0.965 1.0 0.436 2.9e-16
CGD|CAL0003980128 orf19.6623 [Candida albicans ( 0.896 0.609 0.475 3.3e-15
FB|FBgn006367082 CG40228 [Drosophila melanogast 0.942 1.0 0.447 1.1e-14
SGD|S000001643145 ELF1 "Transcription elongation 0.942 0.565 0.406 2.3e-14
UNIPROTKB|A4IFR383 ELOF1 "Transcription elongatio 0.942 0.987 0.423 3e-14
UNIPROTKB|P6000283 ELOF1 "Transcription elongatio 0.942 0.987 0.423 3e-14
MGI|MGI:191337683 Elof1 "elongation factor 1 hom 0.942 0.987 0.423 3e-14
ZFIN|ZDB-GENE-040426-138583 elof1 "elongation factor 1 hom 0.942 0.987 0.423 3.8e-14
TAIR|locus:2161418 AT5G46030 "AT5G46030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 250 (93.1 bits), Expect = 2.4e-21, P = 2.4e-21
 Identities = 52/87 (59%), Positives = 57/87 (65%)

Query:     1 MGKRKSRXXXXXXXXXXXXMEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERF 60
             MGKRKSR            M+KLDT F CPFC HG+SVEC ID K  IG+A C  C E F
Sbjct:     1 MGKRKSRAKPAPTKR----MDKLDTIFSCPFCNHGSSVECIIDMKHLIGKAACRICEESF 56

Query:    61 CTQIHALTEPIDIYAEWIDECERANNS 87
              T I ALTE IDIY+EWIDECER N +
Sbjct:    57 STTITALTEAIDIYSEWIDECERVNTA 83
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
WB|WBGene00013219 Y54G11A.11.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XVZ8 Y54G11A.11 "Transcription elongation factor 1 homolog" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
CGD|CAL0003980 orf19.6623 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
FB|FBgn0063670 CG40228 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
SGD|S000001643 ELF1 "Transcription elongation factor with a conserved zinc finger domain" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|A4IFR3 ELOF1 "Transcription elongation factor 1 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P60002 ELOF1 "Transcription elongation factor 1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1913376 Elof1 "elongation factor 1 homolog (ELF1, S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1385 elof1 "elongation factor 1 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LHP0ELOF1_ORYSJNo assigned EC number0.65110.94250.9213yesno
Q8MQI6ELOF1_DROMENo assigned EC number0.47050.94251.0yesno
Q8LEF3ELOF1_ARATHNo assigned EC number0.63210.95400.6916yesno
Q54KR5ELOF1_DICDINo assigned EC number0.42680.88500.9625yesno
Q9XVZ8ELOF1_CAEELNo assigned EC number0.45970.96551.0yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
OsI_06540
Transcription elongation factor 1 homolog; Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions (By similarity) (89 aa)
(Oryza sativa Indica)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
pfam0512974 pfam05129, Elf1, Transcription elongation factor E 1e-24
COG4888104 COG4888, COG4888, Uncharacterized Zn ribbon-contai 6e-19
PRK1489299 PRK14892, PRK14892, putative transcription elongat 4e-04
>gnl|CDD|218451 pfam05129, Elf1, Transcription elongation factor Elf1 like Back     alignment and domain information 
 Score = 87.3 bits (217), Expect = 1e-24
 Identities = 37/77 (48%), Positives = 46/77 (59%), Gaps = 3/77 (3%)

Query: 7  RKAKAVGVKKTKGMEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHA 66
          +K K    KK     KL T F CPFC H  SV  +IDKK  I +  C  C   F T+I+A
Sbjct: 1  KKRKPPKKKKK---YKLPTVFDCPFCNHKKSVSVKIDKKTGIAKLHCRVCGLSFQTEINA 57

Query: 67 LTEPIDIYAEWIDECER 83
          L+EPID+Y++WID CE 
Sbjct: 58 LSEPIDVYSDWIDACEE 74

This family of short proteins contains a putative zinc binding domain with four conserved cysteines. ELF1 has been identified as a transcription elongation factor in Saccharomyces cerevisiae. Length = 74
>gnl|CDD|227225 COG4888, COG4888, Uncharacterized Zn ribbon-containing protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|184886 PRK14892, PRK14892, putative transcription elongation factor Elf1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
PF0512981 Elf1: Transcription elongation factor Elf1 like; I 100.0
KOG3214109 consensus Uncharacterized Zn ribbon-containing pro 100.0
COG4888104 Uncharacterized Zn ribbon-containing protein [Gene 100.0
PRK1489299 putative transcription elongation factor Elf1; Pro 100.0
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 97.3
PF1435461 Lar_restr_allev: Restriction alleviation protein L 97.04
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 96.75
PRK0971064 lar restriction alleviation and modification prote 96.44
PTZ0025590 60S ribosomal protein L37a; Provisional 96.44
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 96.43
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 96.33
PF0109639 TFIIS_C: Transcription factor S-II (TFIIS); InterP 96.33
COG1327156 Predicted transcriptional regulator, consists of a 96.22
TIGR00244147 transcriptional regulator NrdR. Members of this al 96.2
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 96.05
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 95.79
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 95.62
smart0044040 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo 95.57
PF1425552 Cys_rich_CPXG: Cysteine-rich CPXCG 95.4
PRK00464154 nrdR transcriptional regulator NrdR; Validated 95.3
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 95.05
PF1371937 zinc_ribbon_5: zinc-ribbon domain 94.91
PF14353128 CpXC: CpXC protein 94.76
PF0985564 DUF2082: Nucleic-acid-binding protein containing Z 94.67
smart0077837 Prim_Zn_Ribbon Zinc-binding domain of primase-heli 94.29
PF1371736 zinc_ribbon_4: zinc-ribbon domain 94.21
PRK0967872 DNA-binding transcriptional regulator; Provisional 94.14
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 92.98
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 92.93
TIGR0382989 YokU_near_AblA uncharacterized protein, YokU famil 92.74
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 92.68
PHA0062659 hypothetical protein 92.48
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 92.35
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 92.14
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 91.75
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 91.67
PF0460647 Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: I 91.14
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 91.13
PF06044 254 DRP: Dam-replacing family; InterPro: IPR010324 Dam 90.96
PF1324023 zinc_ribbon_2: zinc-ribbon domain 90.81
PRK1313056 H/ACA RNA-protein complex component Nop10p; Review 90.8
PRK0043250 30S ribosomal protein S27ae; Validated 90.79
PF1345341 zf-TFIIB: Transcription factor zinc-finger 90.61
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 90.58
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 90.14
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 90.07
PF0180797 zf-CHC2: CHC2 zinc finger; InterPro: IPR002694 Zin 89.99
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 89.79
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 89.36
COG347868 Predicted nucleic-acid-binding protein containing 89.36
TIGR00311133 aIF-2beta translation initiation factor aIF-2, bet 88.57
PRK03988138 translation initiation factor IF-2 subunit beta; V 88.56
TIGR0383146 YgiT_finger YgiT-type zinc finger domain. This dom 88.31
PF1420555 Cys_rich_KTR: Cysteine-rich KTR 88.2
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 88.1
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 87.81
smart00531147 TFIIE Transcription initiation factor IIE. 87.65
COG1405 285 SUA7 Transcription initiation factor TFIIIB, Brf1 87.62
KOG040292 consensus 60S ribosomal protein L37 [Translation, 87.6
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 87.48
PF0952671 DUF2387: Probable metal-binding protein (DUF2387); 87.37
TIGR0244359 conserved hypothetical metal-binding protein. Memb 87.27
KOG0478 804 consensus DNA replication licensing factor, MCM4 c 87.06
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 87.01
TIGR01385299 TFSII transcription elongation factor S-II. This m 86.91
PF0827340 Prim_Zn_Ribbon: Zinc-binding domain of primase-hel 86.89
PF01873125 eIF-5_eIF-2B: Domain found in IF2B/IF5; InterPro: 86.65
COG3677129 Transposase and inactivated derivatives [DNA repli 86.4
PRK00420112 hypothetical protein; Validated 86.02
COG205167 RPS27A Ribosomal protein S27E [Translation, riboso 85.56
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 85.48
PF1324826 zf-ribbon_3: zinc-ribbon domain 85.17
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 85.1
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 85.02
PRK00423 310 tfb transcription initiation factor IIB; Reviewed 84.95
PRK05978148 hypothetical protein; Provisional 84.78
smart00653110 eIF2B_5 domain present in translation initiation f 84.24
smart0066152 RPOL9 RNA polymerase subunit 9. 83.99
COG1645131 Uncharacterized Zn-finger containing protein [Gene 83.74
TIGR02159146 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subu 83.73
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 83.72
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 83.64
PRK1228657 rpmF 50S ribosomal protein L32; Reviewed 83.43
PRK03564309 formate dehydrogenase accessory protein FdhE; Prov 82.97
PRK03564309 formate dehydrogenase accessory protein FdhE; Prov 82.82
PHA02998195 RNA polymerase subunit; Provisional 82.71
TIGR01562305 FdhE formate dehydrogenase accessory protein FdhE. 82.68
PF0518066 zf-DNL: DNL zinc finger; InterPro: IPR007853 Zinc 82.6
COG1779 201 C4-type Zn-finger protein [General function predic 82.56
COG0675364 Transposase and inactivated derivatives [DNA repli 82.08
PF0381136 Zn_Tnp_IS1: InsA N-terminal domain; InterPro: IPR0 82.05
PHA02540 337 61 DNA primase; Provisional 81.81
PF03367161 zf-ZPR1: ZPR1 zinc-finger domain; InterPro: IPR004 81.71
COG1326 201 Uncharacterized archaeal Zn-finger protein [Genera 81.61
PF0396668 Trm112p: Trm112p-like protein; InterPro: IPR005651 80.95
PF05502 483 Dynactin_p62: Dynactin p62 family; InterPro: IPR00 80.9
PRK12336201 translation initiation factor IF-2 subunit beta; P 80.31
>PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines Back     alignment and domain information 
Probab=100.00  E-value=4.5e-44  Score=231.25  Aligned_cols=80  Identities=50%  Similarity=0.904  Sum_probs=45.9

Q ss_pred             Cccccccc-cCCCcccccCCCCCCccccCCCCCCCCeEEEEEeccCcEEEEEcCcccceeEeecCCCCchhhhhhhhHHH
Q 035653            2 GKRKSRKA-KAVGVKKTKGMEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDE   80 (87)
Q Consensus         2 GkRK~k~k-~~~~~~~kk~~~kl~~~F~CPfC~~~~sV~v~idk~~~~g~~~C~~C~~~~~~~i~~L~epiDVYs~wiD~   80 (87)
                      ||||++++ +++    +|++++||+.|+||||||++||+|+||++.++|+|+|++||+.|+++|++|+||||||++|||+
T Consensus         1 GkRK~~~k~~~~----kk~~~~l~~~F~CPfC~~~~sV~v~idkk~~~~~~~C~~Cg~~~~~~i~~L~epiDVY~~wiD~   76 (81)
T PF05129_consen    1 GKRKKKRKKPPK----KKKKPKLPKVFDCPFCNHEKSVSVKIDKKEGIGILSCRVCGESFQTKINPLSEPIDVYSEWIDA   76 (81)
T ss_dssp             -----------------------SS----TTT--SS-EEEEEETTTTEEEEEESSS--EEEEE--SS--TTHHHHHHHHH
T ss_pred             CCCcccCCCCCc----cCcCCCCCceEcCCcCCCCCeEEEEEEccCCEEEEEecCCCCeEEEccCccCcccchhHHHHHH
Confidence            89998887 555    7889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhh
Q 035653           81 CERAN   85 (87)
Q Consensus        81 ~e~~n   85 (87)
                      |+++|
T Consensus        77 ~~~~n   81 (81)
T PF05129_consen   77 CEEGN   81 (81)
T ss_dssp             HH---
T ss_pred             HHhcC
Confidence            99998

; PDB: 1WII_A.
>KOG3214 consensus Uncharacterized Zn ribbon-containing protein [Function unknown] Back     alignment and domain information
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription] Back     alignment and domain information
>TIGR00244 transcriptional regulator NrdR Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>smart00440 ZnF_C2C2 C2C2 Zinc finger Back     alignment and domain information
>PF14255 Cys_rich_CPXG: Cysteine-rich CPXCG Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins Back     alignment and domain information
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF04606 Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>PF06044 DRP: Dam-replacing family; InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PF13453 zf-TFIIB: Transcription factor zinc-finger Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01807 zf-CHC2: CHC2 zinc finger; InterPro: IPR002694 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only] Back     alignment and domain information
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative Back     alignment and domain information
>PRK03988 translation initiation factor IF-2 subunit beta; Validated Back     alignment and domain information
>TIGR03831 YgiT_finger YgiT-type zinc finger domain Back     alignment and domain information
>PF14205 Cys_rich_KTR: Cysteine-rich KTR Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>KOG0402 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF09526 DUF2387: Probable metal-binding protein (DUF2387); InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC Back     alignment and domain information
>TIGR02443 conserved hypothetical metal-binding protein Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>TIGR01385 TFSII transcription elongation factor S-II Back     alignment and domain information
>PF08273 Prim_Zn_Ribbon: Zinc-binding domain of primase-helicase; InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4 Back     alignment and domain information
>PF01873 eIF-5_eIF-2B: Domain found in IF2B/IF5; InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology [] Back     alignment and domain information
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5 Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed Back     alignment and domain information
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional Back     alignment and domain information
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional Back     alignment and domain information
>PHA02998 RNA polymerase subunit; Provisional Back     alignment and domain information
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE Back     alignment and domain information
>PF05180 zf-DNL: DNL zinc finger; InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG1779 C4-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF03811 Zn_Tnp_IS1: InsA N-terminal domain; InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases Back     alignment and domain information
>PHA02540 61 DNA primase; Provisional Back     alignment and domain information
>PF03367 zf-ZPR1: ZPR1 zinc-finger domain; InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF03966 Trm112p: Trm112p-like protein; InterPro: IPR005651 This family of short proteins have no known function Back     alignment and domain information
>PF05502 Dynactin_p62: Dynactin p62 family; InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein Back     alignment and domain information
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
1wii_A85 Solution Structure Of Rsgi Ruh-025, A Duf701 Domain 5e-13
>pdb|1WII|A Chain A, Solution Structure Of Rsgi Ruh-025, A Duf701 Domain From Mouse Cdna Length = 85 Back     alignment and structure 
Iteration: 1

 Score = 69.3 bits (168), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%)
Query: 23 LDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDECE 82
          L+TQF CPFC H  S + ++D+    G   C  CLE F T I  L+EP+D+Y++WID CE
Sbjct: 20 LETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACE 79
Query: 83 RANNS 87
             +S
Sbjct: 80 SGPSS 84

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 3e-28
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Length = 85 Back     alignment and structure
 Score = 96.6 bits (240), Expect = 3e-28
 Identities = 35/86 (40%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 2  GKRKSRKAKAVGVKKTKGMEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFC 61
          G   S   K    KK      L+TQF CPFC H  S + ++D+    G   C  CLE F 
Sbjct: 1  GSSGSSGRKPPPKKKMT--GTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQ 58

Query: 62 TQIHALTEPIDIYAEWIDECERANNS 87
          T I  L+EP+D+Y++WID CE   +S
Sbjct: 59 TPITYLSEPVDVYSDWIDACESGPSS 84

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 100.0
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 96.24
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 95.85
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 95.68
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 95.61
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 95.59
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 95.45
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 95.15
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 95.13
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 95.09
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 94.42
1k81_A36 EIF-2-beta, probable translation initiation factor 94.13
3ga8_A78 HTH-type transcriptional regulator MQSA (YGIT/B30; 93.88
1qyp_A57 RNA polymerase II; transcription, RPB9, Zn ribbon, 93.7
1tfi_A50 Transcriptional elongation factor SII; transcripti 93.26
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 92.11
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 91.45
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural 91.28
2fiy_A309 Protein FDHE homolog; FDHE protein, structural gen 90.18
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetr 88.64
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 88.6
2fiy_A309 Protein FDHE homolog; FDHE protein, structural gen 88.2
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein 88.05
1pqv_S309 STP-alpha, transcription elongation factor S-II, D 87.95
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 87.76
4esj_A 257 Type-2 restriction enzyme DPNI; restriction endonu 87.75
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 87.55
2aus_D60 NOP10, ribosome biogenesis protein NOP10; isomeras 86.59
2e9h_A157 EIF-5, eukaryotic translation initiation factor 5; 86.27
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 85.94
1dxg_A36 Desulforedoxin; non-heme iron protein, rubredoxin 85.86
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 85.83
1nui_A 255 DNA primase/helicase; zinc-biding domain, toprim f 85.28
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 84.59
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 84.2
3k1f_M 197 Transcription initiation factor IIB; RNA polymeras 83.85
2xzm_681 RPS27E; ribosome, translation; 3.93A {Tetrahymena 83.67
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 83.06
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 83.01
1gh9_A71 8.3 kDa protein (gene MTH1184); beta+alpha complex 82.86
4bbr_M 345 Transcription initiation factor IIB; RNA polymeras 82.09
1vd4_A62 Transcription initiation factor IIE, alpha subunit 81.78
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 81.53
3po3_S178 Transcription elongation factor S-II; RNA polymera 81.05
2kpi_A56 Uncharacterized protein SCO3027; zinc finger, PSI- 80.98
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 80.66
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 80.64
3k7a_M 345 Transcription initiation factor IIB; RNA polymeras 80.6
2g2k_A170 EIF-5, eukaryotic translation initiation factor 5; 80.51
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 80.41
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Back     alignment and structure
Probab=100.00  E-value=3.7e-45  Score=237.97  Aligned_cols=82  Identities=39%  Similarity=0.786  Sum_probs=73.7

Q ss_pred             CccccccccCCCcccccC-CCCCCccccCCCCCCCCeEEEEEeccCcEEEEEcCcccceeEeecCCCCchhhhhhhhHHH
Q 035653            2 GKRKSRKAKAVGVKKTKG-MEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDE   80 (87)
Q Consensus         2 GkRK~k~k~~~~~~~kk~-~~kl~~~F~CPfC~~~~sV~v~idk~~~~g~~~C~~C~~~~~~~i~~L~epiDVYs~wiD~   80 (87)
                      ||||+++++++    |++ .++|||.|+||||||++||+|+||++.++|+|+|++||++|+++|++|+|||||||+|||+
T Consensus         2 ~rRKs~~k~~~----k~k~~~~L~t~F~CPfCnh~~sV~vkidk~~~~g~l~C~~Cg~~~~~~i~~L~epiDVYs~WiDa   77 (85)
T 1wii_A            2 SSGSSGRKPPP----KKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDA   77 (85)
T ss_dssp             CCCCCCCCCCC----CCCCCCCCSSCCCCTTTCCSSCEEEEEETTTTEEEEEESSSCCEEEEECCSSCCTTHHHHHHHHH
T ss_pred             CCccccCCCCC----CcccCCCCCCeEcCCCCCCCCeEEEEEEccCCEEEEEcccCCCeEEeccCccCcchhhHHHHHHH
Confidence            45555556665    444 4899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhCC
Q 035653           81 CERANNS   87 (87)
Q Consensus        81 ~e~~n~~   87 (87)
                      ||++|+.
T Consensus        78 c~~~~~~   84 (85)
T 1wii_A           78 CESGPSS   84 (85)
T ss_dssp             HHHCCCC
T ss_pred             HHHHhhc
Confidence            9999963
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 Back     alignment and structure
>3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A Back     alignment and structure
>1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 Back     alignment and structure
>1tfi_A Transcriptional elongation factor SII; transcription regulation; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>1pqv_S STP-alpha, transcription elongation factor S-II, DNA; mRNA cleavage, proofreading, BACKTRACKING, gene expression, multiprotein complex; 3.80A {Saccharomyces cerevisiae} SCOP: i.8.1.1 PDB: 1eo0_A Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure
>4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2aus_D NOP10, ribosome biogenesis protein NOP10; isomerase, structural protein, isomerase-structural protein; 2.10A {Pyrococcus abyssi} PDB: 3lwr_B 3lwo_B* 3lwq_B* 3lwp_B 3lwv_B 3hax_C* 2hvy_C* 3hay_C* 2ey4_E 3hjw_B* 2rfk_B* 3hjy_B 3mqk_B Back     alignment and structure
>2e9h_A EIF-5, eukaryotic translation initiation factor 5; zinc binding, C4 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1dxg_A Desulforedoxin; non-heme iron protein, rubredoxin type metal center, electron transport; 1.80A {Desulfovibrio gigas} SCOP: g.41.5.2 PDB: 1dcd_A 1dhg_A 1cfw_A 2lk5_A 2lk6_A Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6 Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 Back     alignment and structure
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>3po3_S Transcription elongation factor S-II; RNA polymerase II, mRNA, transcription, arrest, BACKTRACKING cleavage, transferase-DNA-RNA complex; HET: DNA BRU EPE PGE; 3.30A {Saccharomyces cerevisiae} PDB: 1y1v_S 1y1y_S 3gtm_S* 1enw_A Back     alignment and structure
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2g2k_A EIF-5, eukaryotic translation initiation factor 5; EIF125 fold; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 87
d1wiia_85 g.41.3.4 (A:) Hypothetical UPF0222 protein MGC4549 7e-33
>d1wiia_ g.41.3.4 (A:) Hypothetical UPF0222 protein MGC4549 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure

class: Small proteins
fold: Rubredoxin-like
superfamily: Zinc beta-ribbon
family: Putative zinc binding domain
domain: Hypothetical UPF0222 protein MGC4549
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  106 bits (267), Expect = 7e-33
 Identities = 35/86 (40%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query: 2  GKRKSRKAKAVGVKKTKGMEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFC 61
          G   S   K     K K    L+TQF CPFC H  S + ++D+    G   C  CLE F 
Sbjct: 1  GSSGSSGRKPP--PKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQ 58

Query: 62 TQIHALTEPIDIYAEWIDECERANNS 87
          T I  L+EP+D+Y++WID CE   +S
Sbjct: 59 TPITYLSEPVDVYSDWIDACESGPSS 84

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d1wiia_85 Hypothetical UPF0222 protein MGC4549 {Mouse (Mus m 100.0
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 96.03
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 95.97
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 94.94
d1qypa_57 RBP9 subunit of RNA polymerase II {Archaeon Thermo 94.49
d1twfi272 RBP9 subunit of RNA polymerase II {Baker's yeast ( 93.88
d1tfia_50 Transcriptional factor SII, C-terminal domain {Hum 93.6
d1pfva335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch 92.69
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 92.68
d1k81a_36 Zinc-binding domain of translation initiation fact 91.04
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.22
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 89.62
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 86.71
d1neea237 Zinc-binding domain of translation initiation fact 86.03
d2fiya1290 FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId 85.54
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 85.38
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 83.04
d2jnya159 Uncharacterized protein Cgl1405/cg1592 {Corynebact 82.72
d1d0qa_102 Zinc-binding domain of DNA primase {Bacillus stear 82.15
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 80.84
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 80.72
d1brfa_53 Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 80.43
d2fiya1290 FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId 80.23
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 80.07
>d1wiia_ g.41.3.4 (A:) Hypothetical UPF0222 protein MGC4549 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Zinc beta-ribbon
family: Putative zinc binding domain
domain: Hypothetical UPF0222 protein MGC4549
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=5.4e-46  Score=240.62  Aligned_cols=83  Identities=40%  Similarity=0.789  Sum_probs=75.6

Q ss_pred             Cccccc-cccCCCcccccCCCCCCccccCCCCCCCCeEEEEEeccCcEEEEEcCcccceeEeecCCCCchhhhhhhhHHH
Q 035653            2 GKRKSR-KAKAVGVKKTKGMEKLDTQFQCPFCGHGTSVECRIDKKIQIGEAFCWNCLERFCTQIHALTEPIDIYAEWIDE   80 (87)
Q Consensus         2 GkRK~k-~k~~~~~~~kk~~~kl~~~F~CPfC~~~~sV~v~idk~~~~g~~~C~~C~~~~~~~i~~L~epiDVYs~wiD~   80 (87)
                      |+|+++ |+++++   +|.+++|||.|+||||||++||+|+||++.++|.|+|++||+.|+++|++|+|||||||+|||+
T Consensus         1 g~~~~s~rk~~pk---kk~~~kL~t~F~CPfCnh~~sV~vk~dkk~~~g~l~C~vCg~~~~~~i~~L~epiDVYs~WiDa   77 (85)
T d1wiia_           1 GSSGSSGRKPPPK---KKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDA   77 (85)
T ss_dssp             CCCCCCCCCCCCC---CCCCCCCSSCCCCTTTCCSSCEEEEEETTTTEEEEEESSSCCEEEEECCSSCCTTHHHHHHHHH
T ss_pred             CCCcccCCCCCCC---ccccCCCCceEcCCCCCCCCeEEEEEEecCCEEEEEEecCCCeEEecccccCccHhHHHHHHHH
Confidence            677765 445553   5667899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhCC
Q 035653           81 CERANNS   87 (87)
Q Consensus        81 ~e~~n~~   87 (87)
                      ||++|++
T Consensus        78 ce~~n~~   84 (85)
T d1wiia_          78 CESGPSS   84 (85)
T ss_dssp             HHHCCCC
T ss_pred             HHHhccC
Confidence            9999974
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qypa_ g.41.3.1 (A:) RBP9 subunit of RNA polymerase II {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tfia_ g.41.3.1 (A:) Transcriptional factor SII, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1d0qa_ g.41.3.2 (A:) Zinc-binding domain of DNA primase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure