Citrus Sinensis ID: 035707

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710---
MRIKSWISKRFGIRPKIRKMIKCICSREQLRVDELISSSESLATRDYSASGFSSRAGEMDAKVDNSNIEEAESSLRESGYLNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVTSRMKVSLSRRCDQNRRRSQSDAAPPMSMHAVSLLVEAIFLKTKSLQGLGRFEEACQSCKVILDTVEHALPEGLPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNLDIETTARIEKKFAVFLLYSGTDASPPNLRLQMELSFVPRNNIEEAVLLLLILLKKIVLGKIEWDPSIIDHLSFALSVSGELWTLAHQVEELLPGVMGNKKRYCTLALCYLGEENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCLLGVLLSSQSRSVVSDSKRILKQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVKGYLLLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNLVKNRQNHDRSLEMETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAEPNHVPSLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAGASALEAVECFEAAALLEESAPVEPFR
cccccHHHcccccHHHHHHHHHHHccccHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccc
ccHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccc
mrikswiskrfgirPKIRKMIKCICSREQLRVDELISsseslatrdysasgfssragemdakvdnsnIEEAESslresgylNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVTSRMKVSlsrrcdqnrrrsqsdaappmsMHAVSLLVEAIFLKTKSLQGLGRFEEACQSCKVILDTVEhalpeglpgnhsidCKLQETLNKAVELLPELyklagdpdeTILSYRRALLYYWNLDIETTARIEKKFAVFLLYsgtdasppnlrlqmelsfvprnNIEEAVLLLLILLKKIVLgkiewdpsiiDHLSFALSVSGELWTLAHQVEEllpgvmgnkkRYCTLALCYLGEENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCLLGVLLSsqsrsvvsdSKRILKQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVKGYLLLARVLSAQKQFADAEsvindsldqtgkwdqgelLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNLVKnrqnhdrsleMETWHDLANVYTSLSQWRDAEVClskskainpysasgwhstGLLYEAKGLQQEALVSFRKAldaepnhvpSLVSIARVLRQIGGESMATIRCFLTDAlrldrtnttaWYNLGLLYKTYAGASALEAVECFEAAALleesapvepfr
mrikswiskrfgirpkirKMIKCICSREQLRVDELissseslatrdysasgfssragemdakvdnSNIEEAesslresgyLNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVTSRMkvslsrrcdqnrrrsqsdaappmSMHAVSLLVEAIFLKTKSLQGLGRFEEACQSCKVILDTVEHALPEGLPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNLDIETTARIEKKFAVFLLYSGTDASPPNLRLQMELSFVPRNNIEEAVLLLLILLKKIVLGKIEWDPSIIDHLSFALSVSGELWTLAHQVEEllpgvmgnKKRYCTLALCYLGEENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCLLGVLLSSQSRSVVSDSKRILKQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVKGYLLLARVLSAQKQFADAESvindsldqtgkwdqgeLLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNLVKNRQNHDRSLEMETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALdaepnhvpsLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAGASALEAVECFEAAALLeesapvepfr
MRIKSWISKRFGIRPKIRKMIKCICSREQLRVDELISSSESLATRDYSASGFSSRAGEMDAKVDNSNIEEAESSLRESGYLNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVTSRMKVSLSRRCDQNRRRSQSDAAPPMSMHAVSLLVEAIFLKTKSLQGLGRFEEACQSCKVILDTVEHALPEGLPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNLDIETTARIEKKFAVFLLYSGTDASPPNLRLQMELSFVPRNNIEEAvllllillkkivlGKIEWDPSIIDHLSFALSVSGELWTLAHQVEELLPGVMGNKKRYCTLALCYLGEENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCllgvllssqsrsvvsdsKRILKQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVKGYLLLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNLVKNRQNHDRSLEMETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAEPNHVPSLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAGASALEAVECFEAAALLEESAPVEPFR
****SWISKRFGIRPKIRKMIKCICSREQLRVDE*********************************************YLNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVTSRM*************************HAVSLLVEAIFLKTKSLQGLGRFEEACQSCKVILDTVEHALPEGLPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNLDIETTARIEKKFAVFLLYSGTDASPPNLRLQMELSFVPRNNIEEAVLLLLILLKKIVLGKIEWDPSIIDHLSFALSVSGELWTLAHQVEELLPGVMGNKKRYCTLALCYLGEENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCLLGVLLS******************ALVALETA**TMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVKGYLLLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNLV*********LEMETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAEPNHVPSLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAGASALEAVECFEAAALL**********
****************IRKMIKCI************************************************SSLRESGYLNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVTSRM***************************VSLLVEAIFLKTKSLQGLGRFEEACQSCKVILDTVEHALPEGLPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNLDIETTARIEKKFAVFLLYSGTDASPPNLRLQMELSFVPRNNIEEAVLLLLILLKKIVLGKIEWDPSIIDHLSFALSVSGELWTLAHQVEELLPGVMGNKKRYCTLALCYLGEENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCLLGVLLSSQSRSVVSDSKRILKQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVKGYLLLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNLVKNRQNHDRSLEMETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAEPNHVPSLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAGASALEAVECFEAAALLEESAP**PFR
MRIKSWISKRFGIRPKIRKMIKCICSREQLRVDELISSSESLATRDYSASGFSSRAGEMDAKVDNSN*********ESGYLNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVTS************************MSMHAVSLLVEAIFLKTKSLQGLGRFEEACQSCKVILDTVEHALPEGLPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNLDIETTARIEKKFAVFLLYSGTDASPPNLRLQMELSFVPRNNIEEAVLLLLILLKKIVLGKIEWDPSIIDHLSFALSVSGELWTLAHQVEELLPGVMGNKKRYCTLALCYLGEENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCLLGVLLSSQ**********ILKQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVKGYLLLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNLVKNRQNHDRSLEMETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAEPNHVPSLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAGASALEAVECFEAAALLEE********
*********RFGIRPKIRKMIKCICSRE*************************************SN**EAESSLRESGYLNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVTSRMKVSLSRR**************PMSMHAVSLLVEAIFLKTKSLQGLGRFEEACQSCKVILDTVEHALPEGLPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNLDIETTARIEKKFAVFLLYSGTDASPPNLRLQMELSFVPRNNIEEAVLLLLILLKKIVLGKIEWDPSIIDHLSFALSVSGELWTLAHQVEELLPGVMGNKKRYCTLALCYLGEENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCLLGVLLSSQSRSVVSDSKRILKQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVKGYLLLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNLVKNRQNHDRSLEMETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAEPNHVPSLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAGASALEAVECFEAAALLEESAPV**F*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIKSWISKRFGIRPKIRKMIKCICSREQLRVDELISSSESLATRDYSASGFSSRAGEMDAKVDNSNIEEAESSLRESGYLNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVTSRMKVSLSRRCDQNRRRSQSDAAPPMSMHAVSLLVEAIFLKTKSLQGLGRFEEACQSCKVILDTVEHALPEGLPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNLDIETTARIEKKFAVFLLYSGTDASPPNLRLQMELSFVPRNNIEEAVLLLLILLKKIVLGKIEWDPSIIDHLSFALSVSGELWTLAHQVEELLPGVMGNKKRYCTLALCYLGEENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCLLGVLLSSQSRSVVSDSKRILKQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVKGYLLLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNLVKNRQNHDRSLEMETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAEPNHVPSLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAGASALEAVECFEAAALLEESAPVEPFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query713 2.2.26 [Sep-21-2011]
Q8BGB2858 Tetratricopeptide repeat yes no 0.601 0.5 0.249 9e-13
Q9ULT0858 Tetratricopeptide repeat yes no 0.600 0.498 0.248 4e-12
Q86TV6843 Tetratricopeptide repeat no no 0.196 0.166 0.305 6e-10
Q8RVB2 931 Probable UDP-N-acetylgluc N/A no 0.152 0.117 0.313 5e-07
O82039 932 Probable UDP-N-acetylgluc N/A no 0.144 0.110 0.321 2e-06
Q8LP10 918 Probable UDP-N-acetylgluc N/A no 0.151 0.117 0.310 2e-06
P79457 1212 Histone demethylase UTY O no no 0.176 0.103 0.284 3e-06
Q7K4B6 926 Transmembrane and TPR rep no no 0.388 0.299 0.208 6e-06
Q96301 914 Probable UDP-N-acetylgluc no no 0.154 0.120 0.302 6e-06
O14607 1347 Histone demethylase UTY O no no 0.150 0.079 0.297 7e-06
>sp|Q8BGB2|TTC7A_MOUSE Tetratricopeptide repeat protein 7A OS=Mus musculus GN=Ttc7a PE=1 SV=1 Back     alignment and function desciption
 Score = 76.3 bits (186), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 131/526 (24%), Positives = 218/526 (41%), Gaps = 97/526 (18%)

Query: 273 FVPRNNIEEAVLLLLI----LLKKIVLGK-----------IEWDPSIIDHLSFALSVSGE 317
           + P++NIEEA+LLLLI      + +VL +           ++   +I D LS  L   G+
Sbjct: 337 YCPKDNIEEALLLLLISESMATRDVVLSRAPEQAEDRKVSLQNASAIYDLLSITLGRRGQ 396

Query: 318 LWTLAHQVEELLPGVMGNKKRYCTLALCYLGEENSDCNLEL---------------LVAS 362
              L+  +E  +    G    +  +AL  +    S   + L               L+A+
Sbjct: 397 YVMLSECLERAMKCAFGEFHLWYQVALSMVACGKSAYAVSLLRECMKLQPSDPTVPLMAA 456

Query: 363 KICAENKVCIEEGITYARKALSMLQ--GKCRQMASIANCLLGVLLSSQSRSVVSDSKRIL 420
           K+C  +   +EE   +A   + + +  G+      +A   LG+  S Q+      SK+  
Sbjct: 457 KVCIGSLHWLEEAEHFATVVIGLGEEAGESLPKGYLA---LGLTYSLQATDATLKSKQDE 513

Query: 421 KQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVKGYL 480
              +AL  LE A + +   DP II+++ L+ A  R++  A+   ++ L +  R +     
Sbjct: 514 LHRKALQTLERA-RELAPDDPQIIFYVALQLALVRQISSAMERLQEALTM-CRDDANALH 571

Query: 481 LLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKNAIETYVNLLA 540
           LLA + SAQK +  A  VIN ++  T   +   L+ TK KL+      + A+ T   +L 
Sbjct: 572 LLALLFSAQKYYQHALDVINMAI--TEHPENFNLMFTKVKLEQVLKGPEEALVTCRQMLR 629

Query: 541 VLQFRKKSFSAG--------KNLVKNRQN---------HD-------------------- 563
           + Q        G        + L   +QN         HD                    
Sbjct: 630 LWQTLYNFSQLGGLEKDGSFEGLTVKKQNGIHLTLPDAHDADSGSRRASSIAASRLEEAM 689

Query: 564 ----------RSLEMETWHDL-------ANVYTSLSQWRDAEVCLSKSKAINPYSASGWH 606
                     +   M+ W  L       A ++    Q ++A  C+ ++  + P S S  +
Sbjct: 690 SELTLTTSVLKQGPMQLWTTLEQIWLQAAELFMEQRQLKEAGFCIQEAAGLFPTSHSVLY 749

Query: 607 STGLLYEAKGLQQEALVSFRKALDAEPNHVPSLVSIARVLRQIGGESMATIRCFLTDALR 666
             G L E KG  +EA   +++AL   P+ V  + S+  +L Q+G +S+A  +  L DA+ 
Sbjct: 750 MRGRLAEVKGSFEEAKQLYKEALTVNPDGVRIMHSLGLMLSQLGHKSLA--QKVLRDAVE 807

Query: 667 LDRTNTTAWYNLGLLYKTYAGASALEAVECFEAAALLEESAPVEPF 712
              T   AW  LG + +      A  AV+CF  A  LE S+PV PF
Sbjct: 808 RQSTFHEAWQGLGEVLQDQGQNEA--AVDCFLTALELEASSPVLPF 851

Mus musculus (taxid: 10090)
>sp|Q9ULT0|TTC7A_HUMAN Tetratricopeptide repeat protein 7A OS=Homo sapiens GN=TTC7A PE=1 SV=3 Back     alignment and function description
>sp|Q86TV6|TTC7B_HUMAN Tetratricopeptide repeat protein 7B OS=Homo sapiens GN=TTC7B PE=1 SV=3 Back     alignment and function description
>sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q8LP10|SPY_EUSER Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|P79457|UTY_MOUSE Histone demethylase UTY OS=Mus musculus GN=Uty PE=1 SV=2 Back     alignment and function description
>sp|Q7K4B6|TMTC3_DROME Transmembrane and TPR repeat-containing protein CG4050 OS=Drosophila melanogaster GN=CG4050 PE=2 SV=1 Back     alignment and function description
>sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 Back     alignment and function description
>sp|O14607|UTY_HUMAN Histone demethylase UTY OS=Homo sapiens GN=UTY PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query713
359477750731 PREDICTED: tetratricopeptide repeat prot 1.0 0.975 0.735 0.0
296083694725 unnamed protein product [Vitis vinifera] 0.991 0.975 0.737 0.0
255575837731 o-linked n-acetylglucosamine transferase 0.998 0.974 0.740 0.0
224099957721 predicted protein [Populus trichocarpa] 0.971 0.961 0.739 0.0
356533775809 PREDICTED: uncharacterized protein LOC10 0.998 0.880 0.709 0.0
449527818732 PREDICTED: LOW QUALITY PROTEIN: tetratri 0.997 0.971 0.684 0.0
449432526732 PREDICTED: tetratricopeptide repeat prot 0.997 0.971 0.684 0.0
224107467709 predicted protein [Populus trichocarpa] 0.970 0.976 0.734 0.0
357441063745 Tetratricopeptide repeat protein 7B [Med 0.991 0.948 0.658 0.0
357441065748 Tetratricopeptide repeat protein 7B [Med 0.991 0.945 0.655 0.0
>gi|359477750|ref|XP_002285371.2| PREDICTED: tetratricopeptide repeat protein 7B-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/731 (73%), Positives = 618/731 (84%), Gaps = 18/731 (2%)

Query: 1   MRIKSWISKR-FGIRPKIRKMIKCICSREQLRVDELISSSESLATRDYSASGFSSRAGEM 59
           M  K+W++KR F IR ++RKM+KCICS EQLRVDE+I SSESLATRDYSASG+SSRAG+ 
Sbjct: 1   MTSKNWMNKRGFSIRGRLRKMMKCICSGEQLRVDEIIPSSESLATRDYSASGYSSRAGDN 60

Query: 60  DAKVDNSNIEEAESSLRESGYLNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVTSRM 119
           + K D SNIEEAESSLRESG+LNYEEARALLGRLE+QKGNIEAALHVFEGID+AAVT +M
Sbjct: 61  ERKPDTSNIEEAESSLRESGFLNYEEARALLGRLEYQKGNIEAALHVFEGIDIAAVTPKM 120

Query: 120 KVSLSRRCDQNRRRSQSDAAPPMSMHAVSLLVEAIFLKTKSLQGLGRFEEACQSCKVILD 179
           K+S++RRC+ +RRRSQS+A PPMSMHAVSLL+EAIFLK KSLQ LGRF EA QSCKVILD
Sbjct: 121 KLSIARRCELHRRRSQSEAIPPMSMHAVSLLIEAIFLKAKSLQALGRFGEAAQSCKVILD 180

Query: 180 TVEHALPEGLPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNLDI 239
           TVE ALPEGLP N + DCKL ETLNKAVELLPEL+KLAG P E ILSYR+ALL+ WNLD+
Sbjct: 181 TVESALPEGLPENFAADCKLLETLNKAVELLPELWKLAGSPQEAILSYRQALLHNWNLDM 240

Query: 240 ETTARIEKKFAVFLLYSGTDASPPNLRLQMELSFVPRNNIEEAVLLLLILLKKIVLGKIE 299
           ET  +IEK+FA+FLLYSG+DASPPNLR QME SFVPRNNIEEA+LLL+ILL+K VL +I 
Sbjct: 241 ETATKIEKEFAIFLLYSGSDASPPNLRSQMEGSFVPRNNIEEAILLLMILLRKFVLKRIA 300

Query: 300 WDPSIIDHLSFALSVSGELWTLAHQVEELLPGVMGNKKRYCTLALCYLGE---------- 349
           WDPSIIDHLSFALSVSGEL TLAHQVE LLPG+M  K+R+ TLALCY GE          
Sbjct: 301 WDPSIIDHLSFALSVSGELRTLAHQVELLLPGIMERKERFSTLALCYHGEGEDMVALNLL 360

Query: 350 -------ENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCLLG 402
                  +N DC LELL+ASKIC EN  C +EG  YA KALS LQG+C+QMAS+ANCLLG
Sbjct: 361 RNLLNNRDNPDCTLELLLASKICGENVDCTDEGTDYAHKALSKLQGRCKQMASVANCLLG 420

Query: 403 VLLSSQSRSVVSDSKRILKQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALY 462
           V LS++SRS  SD  RIL+Q +AL ALETAE+TM +RDP +++HL LENAEQRKLD AL+
Sbjct: 421 VSLSAKSRSSPSDYDRILRQYEALEALETAERTMIDRDPNVLFHLSLENAEQRKLDAALH 480

Query: 463 YAKKLLNLEARSNVKGYLLLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQ 522
           YA++LL +EA S+VKG++LLAR+LSAQKQF DAE VIN ++DQTGKWDQGELLRTKAKLQ
Sbjct: 481 YARQLLKIEAGSSVKGWILLARILSAQKQFEDAECVINAAMDQTGKWDQGELLRTKAKLQ 540

Query: 523 IAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNLVKNRQNHDRSLEMETWHDLANVYTSLS 582
           IAQGRLKNAIETY +LLAVLQ R K+F  GK L+KNR NH R LEMETWHDLANVYTSLS
Sbjct: 541 IAQGRLKNAIETYTHLLAVLQVRNKNFRVGKQLLKNRANHHRRLEMETWHDLANVYTSLS 600

Query: 583 QWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAEPNHVPSLVSI 642
           QWRDAEVCLSKSKAI  +SAS WHSTGLLYEAKGL +EAL SF KALD EP+HVPSL+S 
Sbjct: 601 QWRDAEVCLSKSKAIGSHSASRWHSTGLLYEAKGLHKEALKSFGKALDVEPSHVPSLIST 660

Query: 643 ARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAGASALEAVECFEAAAL 702
           A VLR++  +S+  +R FLTDALR+DRTN +AWYNLGL+ K   GASA+EA ECFEAAA 
Sbjct: 661 ATVLRKLSDQSLPAVRSFLTDALRIDRTNPSAWYNLGLVCKAEMGASAVEATECFEAAAF 720

Query: 703 LEESAPVEPFR 713
           L+E+APVEPFR
Sbjct: 721 LQETAPVEPFR 731

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296083694|emb|CBI23683.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255575837|ref|XP_002528816.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] gi|223531728|gb|EEF33550.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224099957|ref|XP_002311687.1| predicted protein [Populus trichocarpa] gi|222851507|gb|EEE89054.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356533775|ref|XP_003535435.1| PREDICTED: uncharacterized protein LOC100789469 [Glycine max] Back     alignment and taxonomy information
>gi|449527818|ref|XP_004170906.1| PREDICTED: LOW QUALITY PROTEIN: tetratricopeptide repeat protein 7B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449432526|ref|XP_004134050.1| PREDICTED: tetratricopeptide repeat protein 7B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224107467|ref|XP_002314490.1| predicted protein [Populus trichocarpa] gi|222863530|gb|EEF00661.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357441063|ref|XP_003590809.1| Tetratricopeptide repeat protein 7B [Medicago truncatula] gi|355479857|gb|AES61060.1| Tetratricopeptide repeat protein 7B [Medicago truncatula] Back     alignment and taxonomy information
>gi|357441065|ref|XP_003590810.1| Tetratricopeptide repeat protein 7B [Medicago truncatula] gi|355479858|gb|AES61061.1| Tetratricopeptide repeat protein 7B [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query713
TAIR|locus:2139860739 NPGR2 "AT4G28600" [Arabidopsis 0.981 0.947 0.499 1.5e-170
TAIR|locus:2053707704 NPG1 "no pollen germination 1" 0.935 0.947 0.428 1.8e-135
TAIR|locus:2016029694 NPGR1 "no pollen germination r 0.934 0.959 0.412 2.1e-125
UNIPROTKB|E1BDL2858 TTC7A "Uncharacterized protein 0.200 0.166 0.310 1.3e-15
ZFIN|ZDB-GENE-070105-3844 ttc7b "tetratricopeptide repea 0.196 0.165 0.284 2e-15
UNIPROTKB|Q9ULT0858 TTC7A "Tetratricopeptide repea 0.200 0.166 0.310 1.2e-14
UNIPROTKB|E1C895857 E1C895 "Uncharacterized protei 0.200 0.166 0.304 2.1e-14
UNIPROTKB|F5H4E1504 TTC7A "Tetratricopeptide repea 0.200 0.283 0.310 3.7e-14
FB|FBgn0021847861 l(2)k14710 "lethal (2) k14710" 0.200 0.166 0.285 1.5e-11
RGD|1306211260 Ttc7a "tetratricopeptide repea 0.200 0.55 0.310 8.8e-10
TAIR|locus:2139860 NPGR2 "AT4G28600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1658 (588.7 bits), Expect = 1.5e-170, P = 1.5e-170
 Identities = 362/725 (49%), Positives = 482/725 (66%)

Query:    13 IRPKIRKM-IKCICSREQLRV-DELISSSESLATRDYSASGFSSRAGEMDAK-VDNSNIE 69
             +R  +RK+ +KC+CS EQ+R  +E    SE    RDY+ S   S A   +AK +DN NIE
Sbjct:    16 LRKSLRKIRMKCLCSGEQMRHREEEDKKSEVGVGRDYNGSSALSTAESENAKKLDNGNIE 75

Query:    70 EAESSLRESGYLNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVTSRMKVSLSRRCDQ 129
             EAE SLRE+  LNYEEARALLGR+E+QKGNIEAAL VFEGID+  +T +MK +L+ R D+
Sbjct:    76 EAELSLRETSSLNYEEARALLGRIEYQKGNIEAALRVFEGIDINGITVKMKTALTVREDR 135

Query:   130 -NRRRSQ---SDA-APPMSMHAVSLLVEAIFLKTKSLQGLGRFEEACQSCKVILDTVEHA 184
              +RRRS+   S A +P MS HAVSLL EAIFLK KSLQ LGRF+EA +SC+VILD VE +
Sbjct:   136 KHRRRSKGGFSTAPSPAMSKHAVSLLFEAIFLKAKSLQRLGRFQEAAESCRVILDIVETS 195

Query:   185 LPEGLPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNLDIETTAR 244
             L EG   N + D KLQETL KAVELLPEL+KLA  P + ILSYRRALL +W LD ETTAR
Sbjct:   196 LAEGASDNVTGDIKLQETLTKAVELLPELWKLADSPRDAILSYRRALLNHWKLDPETTAR 255

Query:   245 IEKKFAVFLLYSGTDASPPNLRLQMELSFVPRNNIEEAXXXXXXXXXXXXXGKIEWDPSI 304
             I+K++AVFLLYSG +A PPNLR Q E SF+PRNN+EEA              +I WD +I
Sbjct:   256 IQKEYAVFLLYSGEEAVPPNLRSQTEGSFIPRNNVEEAILLLMLLLRKVNLKRISWDAAI 315

Query:   305 IDHLSFALSVSGELWTLAHQVEELLPGVMGNKKRYCTLALCYLGEENSDCNLELLV---- 360
             +DHLSFAL+++G+L  LA Q EEL P ++  ++ Y TL+LCY G       L LL     
Sbjct:   316 LDHLSFALTIAGDLTALAKQFEELSPELLDQRELYHTLSLCYQGAGEGLVALGLLRKLFS 375

Query:   361 -------ASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCXXXXXXXXXXXXXX 413
                     S +   +K+C E     A + L   +     +    +               
Sbjct:   376 EREDPNRTSGLLMASKICGERS-GLAEEGLDYARKAIGNLGKECSQLDGAARFVLGITLT 434

Query:   414 XXXKRILKQSQALVALETAEKTMRERD---PYIIYHLCLENAEQRKLDVALYYAKKLLNL 470
                +  + +++ +       + +   D   P +++ L LENAEQRKLD AL YAK+ L L
Sbjct:   435 ESSRMAVTETERIARQSEGIQALESADMTNPRVVHRLALENAEQRKLDSALAYAKEALKL 494

Query:   471 EARSNVKGYLLLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKN 530
              A S+++ +LLLARVLSAQK+F+DAE++++ +L++TGKW+QG+LLR KAKL++A+G +K+
Sbjct:   495 GAESDLEVWLLLARVLSAQKRFSDAETIVDAALNETGKWEQGKLLRLKAKLRLAKGEVKD 554

Query:   531 AIETYVNLLAVLQFRKKSFSAGKNLVKNRQNHDRSLEMETWHDLANVYTSLSQWRDAEVC 590
             AI+TY  LLA+LQ + KSF++ K L K       SLE+ TWHDLA++Y +LSQWRDAE C
Sbjct:   555 AIKTYTQLLALLQVQSKSFNSAKKLPKGYVKELMSLELGTWHDLAHIYINLSQWRDAESC 614

Query:   591 LSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAEPNHVPSLVSIARVLRQIG 650
             LS+S+ I PYS+  +H  G+LY  +G  +EA+ +F  ALD +P HVPSL S A +L ++G
Sbjct:   615 LSRSRLIAPYSSVRYHIEGVLYNRRGQLEEAMEAFTTALDIDPMHVPSLTSKAEILLEVG 674

Query:   651 GES-MATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAGASAL-EAVECFEAAALLEESAP 708
               S +A +R FL +ALR+DR N +AWYNLG ++K     S++ EAVECF+AA  LEE+ P
Sbjct:   675 NRSGIAVVRSFLMEALRIDRLNHSAWYNLGKMFKAEGSVSSMQEAVECFQAAVTLEETMP 734

Query:   709 VEPFR 713
             VEPFR
Sbjct:   735 VEPFR 739
GO:0005516 "calmodulin binding" evidence=ISS;TAS
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2053707 NPG1 "no pollen germination 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016029 NPGR1 "no pollen germination related 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDL2 TTC7A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070105-3 ttc7b "tetratricopeptide repeat domain 7B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULT0 TTC7A "Tetratricopeptide repeat protein 7A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C895 E1C895 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F5H4E1 TTC7A "Tetratricopeptide repeat protein 7A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0021847 l(2)k14710 "lethal (2) k14710" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1306211 Ttc7a "tetratricopeptide repeat domain 7A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00020311001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (731 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-05
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 4e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 4e-04
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information 
 Score = 50.8 bits (122), Expect = 5e-08
 Identities = 29/122 (23%), Positives = 50/122 (40%), Gaps = 22/122 (18%)

Query: 513 ELLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNLVKNRQNHDRSLEMETWH 572
           E L     L    G    A+E Y      L+    +  A                   ++
Sbjct: 1   EALLNLGNLYYKLGDYDEALEYY---EKALELDPDNADA-------------------YY 38

Query: 573 DLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAE 632
           +LA  Y  L ++ +A     K+  ++P +A  +++ GL Y   G  +EAL ++ KAL+ +
Sbjct: 39  NLAAAYYKLGKYEEALEDYEKALELDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALELD 98

Query: 633 PN 634
           PN
Sbjct: 99  PN 100

Length = 100
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 713
KOG4162799 consensus Predicted calmodulin-binding protein [Si 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 100.0
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.98
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.97
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.97
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.96
PLN03077 857 Protein ECB2; Provisional 99.95
PLN03077 857 Protein ECB2; Provisional 99.95
KOG1126638 consensus DNA-binding cell division cycle control 99.95
KOG0547606 consensus Translocase of outer mitochondrial membr 99.95
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.94
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.94
KOG0547606 consensus Translocase of outer mitochondrial membr 99.94
KOG1126638 consensus DNA-binding cell division cycle control 99.93
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.92
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.92
PRK14574 822 hmsH outer membrane protein; Provisional 99.92
KOG2003 840 consensus TPR repeat-containing protein [General f 99.91
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.91
KOG2076895 consensus RNA polymerase III transcription factor 99.91
KOG2003 840 consensus TPR repeat-containing protein [General f 99.91
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.91
PLN03218 1060 maturation of RBCL 1; Provisional 99.91
PLN03218 1060 maturation of RBCL 1; Provisional 99.91
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.89
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.88
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.88
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.88
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.87
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.87
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.86
KOG2076 895 consensus RNA polymerase III transcription factor 99.86
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.86
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.85
PRK12370553 invasion protein regulator; Provisional 99.85
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.85
KOG1129478 consensus TPR repeat-containing protein [General f 99.83
PRK12370553 invasion protein regulator; Provisional 99.83
PRK11189296 lipoprotein NlpI; Provisional 99.82
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.82
KOG1129478 consensus TPR repeat-containing protein [General f 99.82
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.82
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.8
KOG1125579 consensus TPR repeat-containing protein [General f 99.8
PRK11189296 lipoprotein NlpI; Provisional 99.8
KOG1125579 consensus TPR repeat-containing protein [General f 99.8
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.8
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.79
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.79
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.76
PLN02789320 farnesyltranstransferase 99.76
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.75
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.75
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.74
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.73
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.73
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.73
PLN02789320 farnesyltranstransferase 99.73
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.73
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.72
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.72
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.71
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.7
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.68
KOG2376652 consensus Signal recognition particle, subunit Srp 99.64
KOG1915677 consensus Cell cycle control protein (crooked neck 99.62
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.61
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.6
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.6
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.57
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.56
PRK15359144 type III secretion system chaperone protein SscB; 99.55
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.55
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.54
PRK15359144 type III secretion system chaperone protein SscB; 99.53
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.53
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.53
PRK10370198 formate-dependent nitrite reductase complex subuni 99.52
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.52
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.52
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.5
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.49
PRK04841 903 transcriptional regulator MalT; Provisional 99.49
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.45
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.45
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.45
PRK10370198 formate-dependent nitrite reductase complex subuni 99.44
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.43
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.42
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.41
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.41
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.41
PRK04841903 transcriptional regulator MalT; Provisional 99.4
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.4
KOG0553304 consensus TPR repeat-containing protein [General f 99.38
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.38
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.37
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.37
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.34
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.34
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.33
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.3
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.27
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.27
KOG4340 459 consensus Uncharacterized conserved protein [Funct 99.25
KOG0553304 consensus TPR repeat-containing protein [General f 99.22
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.19
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.17
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.12
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.11
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.06
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.03
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.03
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.02
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.01
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.0
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.99
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.99
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.98
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.96
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.95
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.95
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.94
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.92
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.9
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.9
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.9
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.89
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.88
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.88
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.88
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.87
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.87
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.87
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.86
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.85
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.83
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.82
PRK11906458 transcriptional regulator; Provisional 98.8
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.8
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.8
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.79
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.79
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.78
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.78
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.78
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.77
PRK11906458 transcriptional regulator; Provisional 98.77
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.77
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.76
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.75
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.74
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.74
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.72
PRK15331165 chaperone protein SicA; Provisional 98.71
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.7
PRK10803263 tol-pal system protein YbgF; Provisional 98.68
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.67
PRK10803263 tol-pal system protein YbgF; Provisional 98.66
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.62
COG3898531 Uncharacterized membrane-bound protein [Function u 98.6
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.59
PRK15331165 chaperone protein SicA; Provisional 98.59
KOG2471696 consensus TPR repeat-containing protein [General f 98.57
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.55
PF12688120 TPR_5: Tetratrico peptide repeat 98.55
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.55
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.54
PF12688120 TPR_5: Tetratrico peptide repeat 98.53
PF1337173 TPR_9: Tetratricopeptide repeat 98.5
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.49
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.46
COG4700251 Uncharacterized protein conserved in bacteria cont 98.45
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.44
COG4700251 Uncharacterized protein conserved in bacteria cont 98.44
KOG2471696 consensus TPR repeat-containing protein [General f 98.44
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.43
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.43
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.39
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.38
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.38
PF13512142 TPR_18: Tetratricopeptide repeat 98.38
KOG4234271 consensus TPR repeat-containing protein [General f 98.37
PF1337173 TPR_9: Tetratricopeptide repeat 98.33
KOG4234271 consensus TPR repeat-containing protein [General f 98.3
PF13512142 TPR_18: Tetratricopeptide repeat 98.29
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.27
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.26
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.25
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.25
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.2
KOG4555175 consensus TPR repeat-containing protein [Function 98.18
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.18
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.17
KOG1586288 consensus Protein required for fusion of vesicles 98.14
KOG4507 886 consensus Uncharacterized conserved protein, conta 98.13
KOG4555175 consensus TPR repeat-containing protein [Function 98.11
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.11
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.04
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.04
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.97
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.95
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.93
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.89
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.88
PF1342844 TPR_14: Tetratricopeptide repeat 97.87
PF1342844 TPR_14: Tetratricopeptide repeat 97.86
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.84
KOG1585308 consensus Protein required for fusion of vesicles 97.84
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.83
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.82
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.8
KOG1586288 consensus Protein required for fusion of vesicles 97.78
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.78
KOG1585308 consensus Protein required for fusion of vesicles 97.77
PF1343134 TPR_17: Tetratricopeptide repeat 97.77
KOG1550552 consensus Extracellular protein SEL-1 and related 97.76
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.75
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.73
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.72
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.66
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.63
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.62
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.61
PF1343134 TPR_17: Tetratricopeptide repeat 97.61
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.59
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.58
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.54
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.49
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.43
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.4
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.39
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.36
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.35
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.34
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.32
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.29
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.28
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.27
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.25
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.24
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.21
KOG1550552 consensus Extracellular protein SEL-1 and related 97.21
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.14
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.14
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.13
KOG1258 577 consensus mRNA processing protein [RNA processing 97.11
KOG2300 629 consensus Uncharacterized conserved protein [Funct 97.08
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.99
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.99
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.94
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.93
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.87
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.85
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.83
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.82
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.8
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.74
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.73
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.73
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.59
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 96.57
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.43
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 96.39
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.34
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.32
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.3
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.3
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.27
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.19
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.18
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.15
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.12
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.11
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.1
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.01
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 95.75
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.75
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.75
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 95.72
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 95.71
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.62
KOG1258577 consensus mRNA processing protein [RNA processing 95.44
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 95.43
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.42
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.4
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.38
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.37
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.37
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 95.36
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.3
PRK10941269 hypothetical protein; Provisional 95.23
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.2
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.16
KOG3783546 consensus Uncharacterized conserved protein [Funct 95.13
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.95
PRK10941269 hypothetical protein; Provisional 94.94
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 94.87
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.85
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 94.69
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.57
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.51
KOG1463411 consensus 26S proteasome regulatory complex, subun 94.49
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 94.41
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.4
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.21
COG4976 287 Predicted methyltransferase (contains TPR repeat) 94.04
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.87
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 93.84
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.64
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.6
KOG0529 421 consensus Protein geranylgeranyltransferase type I 93.43
COG5191 435 Uncharacterized conserved protein, contains HAT (H 93.25
COG5159421 RPN6 26S proteasome regulatory complex component [ 93.24
COG4976 287 Predicted methyltransferase (contains TPR repeat) 93.17
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.1
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.1
KOG3364149 consensus Membrane protein involved in organellar 92.74
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 92.63
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 92.58
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.55
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.49
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 92.45
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 92.44
PF1304150 PPR_2: PPR repeat family 92.41
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 92.36
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 92.08
KOG1310 758 consensus WD40 repeat protein [General function pr 92.07
COG5159421 RPN6 26S proteasome regulatory complex component [ 91.98
COG3629280 DnrI DNA-binding transcriptional activator of the 91.66
KOG1310 758 consensus WD40 repeat protein [General function pr 91.62
KOG3364149 consensus Membrane protein involved in organellar 91.46
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.34
KOG4814 872 consensus Uncharacterized conserved protein [Funct 91.22
KOG0529 421 consensus Protein geranylgeranyltransferase type I 91.21
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 91.18
PF1286294 Apc5: Anaphase-promoting complex subunit 5 90.83
KOG2422 665 consensus Uncharacterized conserved protein [Funct 90.38
COG1747 711 Uncharacterized N-terminal domain of the transcrip 90.19
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 89.4
COG5191 435 Uncharacterized conserved protein, contains HAT (H 89.29
PF1285434 PPR_1: PPR repeat 89.18
KOG2581 493 consensus 26S proteasome regulatory complex, subun 89.11
KOG4814 872 consensus Uncharacterized conserved protein [Funct 88.99
KOG1463411 consensus 26S proteasome regulatory complex, subun 88.85
KOG3783546 consensus Uncharacterized conserved protein [Funct 88.83
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.18
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 87.67
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 87.67
PF1286294 Apc5: Anaphase-promoting complex subunit 5 87.67
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 87.35
COG2912269 Uncharacterized conserved protein [Function unknow 87.21
COG4941415 Predicted RNA polymerase sigma factor containing a 87.0
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 86.85
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 86.53
KOG2422665 consensus Uncharacterized conserved protein [Funct 86.11
COG2912269 Uncharacterized conserved protein [Function unknow 85.97
COG3629280 DnrI DNA-binding transcriptional activator of the 85.88
PF1304150 PPR_2: PPR repeat family 85.11
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 85.03
PF1285434 PPR_1: PPR repeat 83.97
KOG4014248 consensus Uncharacterized conserved protein (conta 83.48
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 83.27
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 83.25
PRK11619 644 lytic murein transglycosylase; Provisional 82.53
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 82.45
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 81.6
COG4941415 Predicted RNA polymerase sigma factor containing a 81.58
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 81.0
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=8.9e-67  Score=535.28  Aligned_cols=670  Identities=41%  Similarity=0.579  Sum_probs=599.1

Q ss_pred             cCccccccccccccccccccCcccccCCCCChHHHhhhhhhhccCCHHHHHHHhhhHhhhcCCHHHHHhhhhcCCccccc
Q 035707           37 SSSESLATRDYSASGFSSRAGEMDAKVDNSNIEEAESSLRESGYLNYEEARALLGRLEFQKGNIEAALHVFEGIDVAAVT  116 (713)
Q Consensus        37 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~l~~~l~~~~~~a~~llg~~~~~~g~~~~Al~~~~~~~~~~~~  116 (713)
                      -.++.-++|+|++++.+...+++..+++.+.+.||+..+++.+++++++++.+.|+..|++||.++|+.+|+++++....
T Consensus        55 ~~~e~~ai~~~~~s~i~~~~~~~~~~~~~~~l~Ea~~il~~glsle~ee~~~~s~~~~~qr~~~e~al~vFe~~~i~~~~  134 (799)
T KOG4162|consen   55 CGEERKAIRNFSASGIDNQYSENLPLLDLRLLAEAEAILREGLSLEYEEARALSGRLEYQRGNDEAALRVFEGIDILAIT  134 (799)
T ss_pred             ccHHHHHHHHHHHhhcccccccccchhhhhhHHHHHHHHhhhcccchhhhhhhhhhHHHhhcCcHHHHHHhcccchhHHH
Confidence            33667778999999999999999999999999999999999999999999999999999999999999999999988877


Q ss_pred             hhhhhhhhhh-ccccccCCC----CCCCCCcchhHHHHHHHHHHHhhhhhhccCchHHHHHHHHHHHHHHHHhcCCCCCC
Q 035707          117 SRMKVSLSRR-CDQNRRRSQ----SDAAPPMSMHAVSLLVEAIFLKTKSLQGLGRFEEACQSCKVILDTVEHALPEGLPG  191 (713)
Q Consensus       117 ~~~~~~~~~~-~~~~~~~~~----~~~~~~~~~~~~~~~~e~~~~~~~~~~~~g~~~eA~~~~~~~l~~~~~~~~~~~~~  191 (713)
                      .+....+... ...-+.+.+    .....+++.|.+.+..++++++.+.+.+.|++.||+..|+.++++++...+.|.++
T Consensus       135 ~~~e~~i~~~s~~s~~~~s~~~~a~~p~~~~s~~~~~Le~~l~~lk~k~L~~~~~iqea~e~cr~~L~~ve~~~t~~~~~  214 (799)
T KOG4162|consen  135 YLQELEIVQNSNSSLRQRSKASFAIEPSTVMSAHGAILEAELIKLKAKSLKRLGRIQEAAEECRSVLDIVETKATQGSKD  214 (799)
T ss_pred             HHHHHHHHhccCccccCCCccccccCCCcHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCcc
Confidence            7766655544 222222221    12225577888999999999999999999999999999999999999999999998


Q ss_pred             CCCcccchHHHHHHHHHHhHHHHHhcCChhHHHHHHHHHhcccCCCChhHHHHHHHHHHHHHhhcCCCCCCCcccccccc
Q 035707          192 NHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNLDIETTARIEKKFAVFLLYSGTDASPPNLRLQMEL  271 (713)
Q Consensus       192 ~~~~~~~~~~~~~~a~~~l~~~~~~~g~~~eA~~~~~~al~~~~~~~~~~~~~i~~~~a~~ll~~~~~~~~~~~~~~~~~  271 (713)
                      +...+-++++++..+++++|.+|...+.+++++..|++++..+|+.++.+.+++++.++.+..+++.+..  .+......
T Consensus       215 ~~s~~~~l~~vl~~~~~~~~~Lw~~~~~~~~~i~s~~~~l~~~w~~~~l~ka~l~~~~~~f~~~~~~Ee~--~Lllli~e  292 (799)
T KOG4162|consen  215 TESGALKLQEVLSRAVELLPILWKKLSGPKEAIKSYRRALLRSWSLDPLTKARLYKGFALFLPKSGQEEV--ILLLLIEE  292 (799)
T ss_pred             hHHHHHHHHHHHHHHHHHhHHHhcCCCCchHHHHhhhHHhhcccccchhHHHHHhhcccccCCCCcHHHH--HHHHHHHh
Confidence            5433348999999999999999999999999999999999999999999999999999999888888753  44567778


Q ss_pred             cccCCchhHHHHHHHHHHHHHHHhhcCCCcHHHHHHHHHHHHhcCcHHHHHHHHHhhCCCCCCchhhHHHHHHHhhcc--
Q 035707          272 SFVPRNNIEEAVLLLLILLKKIVLGKIEWDPSIIDHLSFALSVSGELWTLAHQVEELLPGVMGNKKRYCTLALCYLGE--  349 (713)
Q Consensus       272 ~~~~~~~~eeA~~ll~~~~~~~~l~~~~~~~~~~~~l~~a~~~~g~~~~a~~~~e~~l~~~~~~~~~~~~la~~~~~~--  349 (713)
                      ++.+++|+++++..++..+++.....+.||+.++++|++++.++|+++.+.++||+++++.+.+.++|+++++||.++  
T Consensus       293 s~i~Re~~~d~ilslm~~~~k~r~~~~qnd~ai~d~Lt~al~~~g~f~~lae~fE~~~~~~~~~~e~w~~~als~saag~  372 (799)
T KOG4162|consen  293 SLIPRENIEDAILSLMLLLRKLRLKKFQNDAAIFDHLTFALSRCGQFEVLAEQFEQALPFSFGEHERWYQLALSYSAAGS  372 (799)
T ss_pred             hccccccHHHHHHHHHHHHHHHHHhhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhhhhhHHHHHHHHHHHHHhcc
Confidence            899999999999999999999999999999999999999999999999999999999999999999999999999987  


Q ss_pred             ---------------cCCCChHHHHHHHHHHHhcCCChHHHHHHHHHHHHhhhccCcchHHHHHHHHHHHHhhccccccc
Q 035707          350 ---------------ENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIANCLLGVLLSSQSRSVVS  414 (713)
Q Consensus       350 ---------------~~p~~~~~~~~~a~~~~~~g~~~~~A~~~~~~al~~~~~~~~~~~~~a~~~lg~~~~~~~~~~~~  414 (713)
                                     .+|+++..++..+++|.+.-.+.++++.+.++++........++.+.++..+|.+|+.+.+.+..
T Consensus       373 ~s~Av~ll~~~~~~~~~ps~~s~~Lmasklc~e~l~~~eegldYA~kai~~~~~~~~~l~~~~~l~lGi~y~~~A~~a~~  452 (799)
T KOG4162|consen  373 DSKAVNLLRESLKKSEQPSDISVLLMASKLCIERLKLVEEGLDYAQKAISLLGGQRSHLKPRGYLFLGIAYGFQARQANL  452 (799)
T ss_pred             chHHHHHHHhhcccccCCCcchHHHHHHHHHHhchhhhhhHHHHHHHHHHHhhhhhhhhhhhHHHHHHHHHHhHhhcCCC
Confidence                           45899999999999999988887799999999999777777788899999999999999999999


Q ss_pred             HHHHHhcHHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhhcCCchHHHHHHHHHHHHcCCHHH
Q 035707          415 DSKRILKQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVKGYLLLARVLSAQKQFAD  494 (713)
Q Consensus       415 ~~~~~~~~~~A~~~~~~al~~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~~la~~~~~~g~~~~  494 (713)
                      .+.+.....++++.+++++ +.+|+|+.+.+.++.-|..+++.+.|.++.+++++.++.+...+|..++.++..++++.+
T Consensus       453 ~seR~~~h~kslqale~av-~~d~~dp~~if~lalq~A~~R~l~sAl~~~~eaL~l~~~~~~~~whLLALvlSa~kr~~~  531 (799)
T KOG4162|consen  453 KSERDALHKKSLQALEEAV-QFDPTDPLVIFYLALQYAEQRQLTSALDYAREALALNRGDSAKAWHLLALVLSAQKRLKE  531 (799)
T ss_pred             hHHHHHHHHHHHHHHHHHH-hcCCCCchHHHHHHHHHHHHHhHHHHHHHHHHHHHhcCCccHHHHHHHHHHHhhhhhhHH
Confidence            9999999999999999999 999999999999999999999999999999999999777666999999999999999999


Q ss_pred             HHHHHHHHhhccCCCCcHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHhhhhhhhhhhhh--------------------
Q 035707          495 AESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKN--------------------  554 (713)
Q Consensus       495 A~~~~~~al~~~p~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~--------------------  554 (713)
                      |+.+.+.+++..|  ++.......+.+....++.++|+.+....+......+.+...+..                    
T Consensus       532 Al~vvd~al~E~~--~N~~l~~~~~~i~~~~~~~e~~l~t~~~~L~~we~~~~~q~~~~~g~~~~lk~~l~la~~q~~~a  609 (799)
T KOG4162|consen  532 ALDVVDAALEEFG--DNHVLMDGKIHIELTFNDREEALDTCIHKLALWEAEYGVQQTLDEGKLLRLKAGLHLALSQPTDA  609 (799)
T ss_pred             HHHHHHHHHHHhh--hhhhhchhhhhhhhhcccHHHHHHHHHHHHHHHHhhhhHhhhhhhhhhhhhhcccccCccccccc
Confidence            9999999999998  677788888888888999999999999999887633322211100                    


Q ss_pred             ---------hhhh----------------cccCC--CccHHHHHHHHHHHHHHCCCHHHHHHHHHHHHhcCCCChhHHHH
Q 035707          555 ---------LVKN----------------RQNHD--RSLEMETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHS  607 (713)
Q Consensus       555 ---------~~~~----------------~~~~~--~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~  607 (713)
                               +...                ...++  .......|...+..+...+..++|..|+.++-.++|..+..|+.
T Consensus       610 ~s~sr~ls~l~a~~~~~~~se~~Lp~s~~~~~~~~~~~~~~~lwllaa~~~~~~~~~~~a~~CL~Ea~~~~~l~~~~~~~  689 (799)
T KOG4162|consen  610 ISTSRYLSSLVASQLKSAGSELKLPSSTVLPGPDSLWYLLQKLWLLAADLFLLSGNDDEARSCLLEASKIDPLSASVYYL  689 (799)
T ss_pred             chhhHHHHHHHHhhhhhcccccccCcccccCCCCchHHHHHHHHHHHHHHHHhcCCchHHHHHHHHHHhcchhhHHHHHH
Confidence                     0000                00001  11235678899999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhcCCChHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHhCC
Q 035707          608 TGLLYEAKGLQQEALVSFRKALDAEPNHVPSLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAG  687 (713)
Q Consensus       608 lg~~~~~~g~~~eA~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~l~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~  687 (713)
                      .|.++...|++.+|.+.|..++.++|+++++...+|.++.+.|+..++++..++..+++++|.++++|+.+|.++...|+
T Consensus       690 ~G~~~~~~~~~~EA~~af~~Al~ldP~hv~s~~Ala~~lle~G~~~la~~~~~L~dalr~dp~n~eaW~~LG~v~k~~Gd  769 (799)
T KOG4162|consen  690 RGLLLEVKGQLEEAKEAFLVALALDPDHVPSMTALAELLLELGSPRLAEKRSLLSDALRLDPLNHEAWYYLGEVFKKLGD  769 (799)
T ss_pred             hhHHHHHHHhhHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhCCcchHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHccc
Confidence            99999999999999999999999999999999999999999999986666669999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHccccCCCCCCCC
Q 035707          688 ASALEAVECFEAAALLEESAPVEPFR  713 (713)
Q Consensus       688 ~~~~~A~~~~~~a~~l~p~~~~~~f~  713 (713)
                        .++|.+||+.|+++++++|+.||+
T Consensus       770 --~~~Aaecf~aa~qLe~S~PV~pFs  793 (799)
T KOG4162|consen  770 --SKQAAECFQAALQLEESNPVLPFS  793 (799)
T ss_pred             --hHHHHHHHHHHHhhccCCCccccc
Confidence              999999999999999999999996

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-09
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-06
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-05
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-06
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 7e-06
1w3b_A 388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 2e-04
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-04
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure 
Iteration: 1

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 64/136 (47%), Gaps = 4/136 (2%)
Query: 569 ETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKA 628
           E W++L N Y     + +A     K+  ++P SA  W++ G  Y  +G   EA+  ++KA
Sbjct: 2   EAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKA 61
Query: 629 LDAEPNHVPSLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAGA 688
           L+ +P    +  ++     + G    A    +   AL LD  +  AWYNLG  Y  Y   
Sbjct: 62  LELDPRSAEAWYNLGNAYYKQGDYDEAI--EYYQKALELDPRSAEAWYNLGNAY--YKQG 117
Query: 689 SALEAVECFEAAALLE 704
              EA+E ++ A  L+
Sbjct: 118 DYDEAIEYYQKALELD 133
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-19
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-19
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-16
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-11
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-16
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-15
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-12
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-15
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 7e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-14
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-11
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-14
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-14
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-12
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-09
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-14
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-11
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-10
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-14
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-13
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-13
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-06
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-13
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-12
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-05
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-05
2gw1_A 514 Mitochondrial precursor proteins import receptor; 7e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-13
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-09
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-13
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-12
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-07
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 1e-12
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-12
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 3e-12
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-11
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 7e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-09
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-12
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-11
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-12
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 4e-11
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-12
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-11
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 8e-08
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-07
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 1e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-11
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-04
4g1t_A 472 Interferon-induced protein with tetratricopeptide 4e-11
4g1t_A472 Interferon-induced protein with tetratricopeptide 8e-10
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 6e-11
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-09
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 8e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-11
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-10
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 9e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-10
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 8e-10
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-05
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-09
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-08
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-09
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-09
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-09
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-05
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 8e-09
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 6e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 9e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-07
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-05
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 8e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-07
2kat_A115 Uncharacterized protein; NESG, structure, structur 4e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 9e-06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-04
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 8e-07
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 4e-05
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-06
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 6e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 6e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 7e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-04
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-04
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-04
3q49_B137 STIP1 homology and U box-containing protein 1; E3 5e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 6e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 6e-04
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 6e-04
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
 Score = 90.7 bits (226), Expect = 1e-19
 Identities = 52/268 (19%), Positives = 102/268 (38%), Gaps = 35/268 (13%)

Query: 453 EQRKLDVALYYAKKLLNLEARSNVKGYLLLARVLSAQKQFADAESVINDSLDQTGKWDQ- 511
           +    + A  +  +L   E   N    LLL+ +    ++   +      ++ Q     + 
Sbjct: 11  QAGDFEAAERHCMQLWRQEPD-NTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEA 69

Query: 512 ----GELLRTKAKLQIAQGRLKNAIE-------TYVNLLAVLQFRKKSFSAGKNLVKNRQ 560
               G + + + +LQ A    ++A+         Y+NL A L        A        Q
Sbjct: 70  YSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGA-------VQ 122

Query: 561 NHDRSLEM-----ETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAK 615
            +  +L+          DL N+  +L +  +A+ C  K+    P  A  W + G ++ A+
Sbjct: 123 AYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQ 182

Query: 616 GLQQEALVSFRKALDAEPNHVPSLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAW 675
           G    A+  F KA+  +PN + + +++  VL++      A +  +L  AL L   +    
Sbjct: 183 GEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRA-VAAYLR-ALSLSPNHAVVH 240

Query: 676 YNLGLLYKT---YAGASALEAVECFEAA 700
            NL  +Y             A++ +  A
Sbjct: 241 GNLACVYYEQGLID-----LAIDTYRRA 263
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query713
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.98
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.97
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.96
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.96
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.96
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.96
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.95
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.95
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.95
3u4t_A272 TPR repeat-containing protein; structural genomics 99.94
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.93
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.93
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.93
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.93
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.93
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.93
3u4t_A272 TPR repeat-containing protein; structural genomics 99.92
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.92
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.92
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.92
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.91
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.91
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.91
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.9
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.9
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.9
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.89
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.89
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.89
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.89
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.89
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.89
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.88
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.88
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.88
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.88
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.88
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.87
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.87
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.87
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.87
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.87
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.86
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.86
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.85
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.84
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.84
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.84
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.83
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.83
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.82
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.82
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.82
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.81
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.81
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.81
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.8
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.8
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.8
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.79
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.79
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.79
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.78
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.78
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.78
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.78
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.75
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.75
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.75
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.75
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.74
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.74
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.73
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.71
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.71
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.71
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.7
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.7
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.7
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.69
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.69
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.68
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.68
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.68
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.68
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.67
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.66
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.65
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.64
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.64
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.63
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.63
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.62
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.61
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.61
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.61
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.6
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.59
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.58
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.58
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.57
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.57
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.56
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.56
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.54
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.54
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.54
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.54
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.54
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.53
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.51
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.51
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.51
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.5
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.49
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.48
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.47
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.47
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.46
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.46
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.46
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.45
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.45
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.45
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.45
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.44
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.44
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.44
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.43
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.43
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.43
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.43
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.43
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.43
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.42
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.42
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.41
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.4
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.39
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.39
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.39
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.39
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.37
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.37
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.37
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.36
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.35
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.35
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.35
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.34
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.33
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.32
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.32
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.3
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.29
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.29
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.28
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.28
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.27
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.27
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.27
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.26
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.26
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.26
3k9i_A117 BH0479 protein; putative protein binding protein, 99.25
3k9i_A117 BH0479 protein; putative protein binding protein, 99.24
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.22
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.22
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.22
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.14
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.06
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.06
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.02
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.01
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.0
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.99
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.95
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.88
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.84
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.81
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.8
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.8
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.74
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.74
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.71
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.65
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.62
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.61
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.6
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.59
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.52
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.42
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.36
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.34
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.33
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.28
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.26
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.26
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.22
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.21
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.61
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.55
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.52
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.46
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.24
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.21
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.82
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.58
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.54
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.49
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 96.27
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.22
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.12
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.55
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.27
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.27
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 95.18
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 95.1
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 94.94
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.57
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 94.39
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.37
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.06
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.05
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.84
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 93.82
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 93.71
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.69
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.46
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 93.1
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.97
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 92.25
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 91.86
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.11
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 90.67
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 90.6
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 89.97
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.76
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 89.17
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 86.11
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 80.64
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=1.7e-38  Score=336.74  Aligned_cols=383  Identities=19%  Similarity=0.169  Sum_probs=341.6

Q ss_pred             hhhhhccCchHHHHHHHHHHHHHHHHhcCCCCCCCCCcccchHHHHHHHHHHhHHHHHhcCChhHHHHHHHHHhcccCCC
Q 035707          158 TKSLQGLGRFEEACQSCKVILDTVEHALPEGLPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYWNL  237 (713)
Q Consensus       158 ~~~~~~~g~~~eA~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~l~~~~~~~g~~~eA~~~~~~al~~~~~~  237 (713)
                      |..+++.|++++|++.|+.++..        .|++           ..++..++.++...|++++|+..+++++..    
T Consensus         6 a~~~~~~g~~~~A~~~~~~~~~~--------~p~~-----------~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~----   62 (388)
T 1w3b_A            6 AHREYQAGDFEAAERHCMQLWRQ--------EPDN-----------TGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ----   62 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHH--------CTTC-----------HHHHHHHHHHHHHTTCHHHHHHHHHHHHHH----
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHh--------CCCC-----------HHHHHHHHHHHHHcCCHHHHHHHHHHHHhc----
Confidence            55666777888887777776653        1221           124556777777778877777777766553    


Q ss_pred             ChhHHHHHHHHHHHHHhhcCCCCCCCcccccccccccCCchhHHHHHHHHHHHHHHHhhcCCCcHHHHHHHHHHHHhcCc
Q 035707          238 DIETTARIEKKFAVFLLYSGTDASPPNLRLQMELSFVPRNNIEEAVLLLLILLKKIVLGKIEWDPSIIDHLSFALSVSGE  317 (713)
Q Consensus       238 ~~~~~~~i~~~~a~~ll~~~~~~~~~~~~~~~~~~~~~~~~~eeA~~ll~~~~~~~~l~~~~~~~~~~~~l~~a~~~~g~  317 (713)
                                                                                  .|.++.++..++.++...|+
T Consensus        63 ------------------------------------------------------------~p~~~~~~~~lg~~~~~~g~   82 (388)
T 1w3b_A           63 ------------------------------------------------------------NPLLAEAYSNLGNVYKERGQ   82 (388)
T ss_dssp             ------------------------------------------------------------CTTCHHHHHHHHHHHHHHTC
T ss_pred             ------------------------------------------------------------CCCchHHHHHHHHHHHHCCC
Confidence                                                                        23466677888999999999


Q ss_pred             HHHHHHHHHhhCCCCCCchhhHHHHHHHhhcccCCCChHHHHHHHHHHHhcCCChHHHHHHHHHHHHhhhccCcchHHHH
Q 035707          318 LWTLAHQVEELLPGVMGNKKRYCTLALCYLGEENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMASIA  397 (713)
Q Consensus       318 ~~~a~~~~e~~l~~~~~~~~~~~~la~~~~~~~~p~~~~~~~~~a~~~~~~g~~~~~A~~~~~~al~~~~~~~~~~~~~a  397 (713)
                      ++.|...|++++.                   .+|+++.++..+|.++...|++. +|+..|+++++ ..|.+.    .+
T Consensus        83 ~~~A~~~~~~al~-------------------~~p~~~~~~~~l~~~~~~~g~~~-~A~~~~~~al~-~~p~~~----~~  137 (388)
T 1w3b_A           83 LQEAIEHYRHALR-------------------LKPDFIDGYINLAAALVAAGDME-GAVQAYVSALQ-YNPDLY----CV  137 (388)
T ss_dssp             HHHHHHHHHHHHH-------------------HCTTCHHHHHHHHHHHHHHSCSS-HHHHHHHHHHH-HCTTCT----HH
T ss_pred             HHHHHHHHHHHHH-------------------cCcchHHHHHHHHHHHHHcCCHH-HHHHHHHHHHH-hCCCcH----HH
Confidence            9999999999865                   36889999999999999999999 99999999999 888888    89


Q ss_pred             HHHHHHHHhhcccccccHHHHHhcHHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhhcCCchH
Q 035707          398 NCLLGVLLSSQSRSVVSDSKRILKQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVK  477 (713)
Q Consensus       398 ~~~lg~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~p~~~~~  477 (713)
                      +..+|.++           ...|++++|+..|++++ ..+|+++.++..+|.++...|++++|+..|+++++.+|++. .
T Consensus       138 ~~~l~~~~-----------~~~g~~~~A~~~~~~al-~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~-~  204 (388)
T 1w3b_A          138 RSDLGNLL-----------KALGRLEEAKACYLKAI-ETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFL-D  204 (388)
T ss_dssp             HHHHHHHH-----------HTTSCHHHHHHHHHHHH-HHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCH-H
T ss_pred             HHHHHHHH-----------HHccCHHHHHHHHHHHH-HhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcH-H
Confidence            99999999           77888999999999999 99999999999999999999999999999999999999998 9


Q ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHhhccCCCCcHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHhhhhhhhhhhhhhhh
Q 035707          478 GYLLLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNLVK  557 (713)
Q Consensus       478 ~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~~~~  557 (713)
                      ++..+|.++...|++++|+..|++++..+|  .+..++..+|.++...|++++|+..|++++...|.+            
T Consensus       205 ~~~~lg~~~~~~~~~~~A~~~~~~al~~~p--~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~------------  270 (388)
T 1w3b_A          205 AYINLGNVLKEARIFDRAVAAYLRALSLSP--NHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHF------------  270 (388)
T ss_dssp             HHHHHHHHHHTTTCTTHHHHHHHHHHHHCT--TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSC------------
T ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHHhhCc--CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCC------------
Confidence            999999999999999999999999999998  788999999999999999999999999999986654            


Q ss_pred             hcccCCCccHHHHHHHHHHHHHHCCCHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCHH
Q 035707          558 NRQNHDRSLEMETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAEPNHVP  637 (713)
Q Consensus       558 ~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~eA~~~~~~al~~~p~~~~  637 (713)
                                +.++..+|.++...|++++|+.+|+++++..|.++.++..+|.++...|++++|+..|+++++.+|++..
T Consensus       271 ----------~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~  340 (388)
T 1w3b_A          271 ----------PDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAA  340 (388)
T ss_dssp             ----------HHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHH
T ss_pred             ----------HHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHH
Confidence                      7889999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCCChHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHhCC
Q 035707          638 SLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAG  687 (713)
Q Consensus       638 ~~~~la~~~~~~g~~~l~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~  687 (713)
                      ++..+|.++...|+++  +|+..|+++++++|+++.+|+++|.++...|+
T Consensus       341 ~~~~l~~~~~~~g~~~--~A~~~~~~a~~~~p~~~~a~~~lg~~~~~~~~  388 (388)
T 1w3b_A          341 AHSNLASVLQQQGKLQ--EALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHTTTCCH--HHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHcCCHH--HHHHHHHHHHhhCCCCHHHHHhHHHHHHHccC
Confidence            9999999999999997  99999999999999999999999999988774
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 713
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-17
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-09
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-06
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 8e-10
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-06
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-05
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.002
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-05
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-05
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 5e-04
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 7e-04
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 9e-04
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 0.002
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 81.6 bits (200), Expect = 4e-17
 Identities = 48/248 (19%), Positives = 101/248 (40%), Gaps = 27/248 (10%)

Query: 436 MRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSNVKGYLLLARVLSAQKQFADA 495
            +        +L      Q ++ +A+++ +K + L+  + +  Y+ L  VL   + F  A
Sbjct: 164 TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRA 222

Query: 496 ESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNL 555
            +    +L      +   +    A +   QG +  AI+TY                 +  
Sbjct: 223 VAAYLRALSL--SPNHAVVHGNLACVYYEQGLIDLAIDTY-----------------RRA 263

Query: 556 VKNRQNHDRSLEMETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAK 615
           ++ + +       + + +LAN         +AE C + +  + P  A   ++   +   +
Sbjct: 264 IELQPHFP-----DAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQ 318

Query: 616 GLQQEALVSFRKALDAEPNHVPSLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAW 675
           G  +EA+  +RKAL+  P    +  ++A VL+Q G    A +  +  +A+R+  T   A+
Sbjct: 319 GNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEA-LMHY-KEAIRISPTFADAY 376

Query: 676 YNLGLLYK 683
            N+G   K
Sbjct: 377 SNMGNTLK 384
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query713
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.89
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.88
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.87
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.83
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.82
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.81
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.81
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.78
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.61
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.61
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.58
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.57
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.57
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.56
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.53
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.46
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.45
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.44
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.42
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.41
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.39
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.38
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.37
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.37
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.36
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.36
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.35
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.34
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.33
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.33
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.32
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.28
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.19
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.99
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.98
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.98
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.94
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.89
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.71
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.7
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.67
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.95
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.93
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.82
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.76
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.55
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.48
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.47
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 95.77
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.6e-34  Score=298.84  Aligned_cols=385  Identities=19%  Similarity=0.161  Sum_probs=341.1

Q ss_pred             HhhhhhhccCchHHHHHHHHHHHHHHHHhcCCCCCCCCCcccchHHHHHHHHHHhHHHHHhcCChhHHHHHHHHHhcccC
Q 035707          156 LKTKSLQGLGRFEEACQSCKVILDTVEHALPEGLPGNHSIDCKLQETLNKAVELLPELYKLAGDPDETILSYRRALLYYW  235 (713)
Q Consensus       156 ~~~~~~~~~g~~~eA~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~l~~~~~~~g~~~eA~~~~~~al~~~~  235 (713)
                      .+|..+++.|+|++|++.|++++...        |++           ..++..+|.++...|++++|+..|++++..+|
T Consensus         4 ~la~~~~~~G~~~~A~~~~~~~l~~~--------p~~-----------~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p   64 (388)
T d1w3ba_           4 ELAHREYQAGDFEAAERHCMQLWRQE--------PDN-----------TGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNP   64 (388)
T ss_dssp             THHHHHHHHTCHHHHHHHHHHHHHHC--------TTC-----------HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHhC--------CCC-----------HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC
Confidence            35777888999999999999988732        321           23678899999999999999999999987532


Q ss_pred             CCChhHHHHHHHHHHHHHhhcCCCCCCCcccccccccccCCchhHHHHHHHHHHHHHHHhhcCCCcHHHHHHHHHHHHhc
Q 035707          236 NLDIETTARIEKKFAVFLLYSGTDASPPNLRLQMELSFVPRNNIEEAVLLLLILLKKIVLGKIEWDPSIIDHLSFALSVS  315 (713)
Q Consensus       236 ~~~~~~~~~i~~~~a~~ll~~~~~~~~~~~~~~~~~~~~~~~~~eeA~~ll~~~~~~~~l~~~~~~~~~~~~l~~a~~~~  315 (713)
                                                                                      .++.++..++.+|...
T Consensus        65 ----------------------------------------------------------------~~~~a~~~l~~~~~~~   80 (388)
T d1w3ba_          65 ----------------------------------------------------------------LLAEAYSNLGNVYKER   80 (388)
T ss_dssp             ----------------------------------------------------------------TCHHHHHHHHHHHHHH
T ss_pred             ----------------------------------------------------------------CCHHHHHHHHHHhhhh
Confidence                                                                            2445567788888999


Q ss_pred             CcHHHHHHHHHhhCCCCCCchhhHHHHHHHhhcccCCCChHHHHHHHHHHHhcCCChHHHHHHHHHHHHhhhccCcchHH
Q 035707          316 GELWTLAHQVEELLPGVMGNKKRYCTLALCYLGEENSDCNLELLVASKICAENKVCIEEGITYARKALSMLQGKCRQMAS  395 (713)
Q Consensus       316 g~~~~a~~~~e~~l~~~~~~~~~~~~la~~~~~~~~p~~~~~~~~~a~~~~~~g~~~~~A~~~~~~al~~~~~~~~~~~~  395 (713)
                      |++++|...++.+...                   +|.................... .+......... ..+...    
T Consensus        81 g~~~~A~~~~~~~~~~-------------------~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~-~~~~~~----  135 (388)
T d1w3ba_          81 GQLQEAIEHYRHALRL-------------------KPDFIDGYINLAAALVAAGDME-GAVQAYVSALQ-YNPDLY----  135 (388)
T ss_dssp             TCHHHHHHHHHHHHHH-------------------CTTCHHHHHHHHHHHHHHSCSS-HHHHHHHHHHH-HCTTCT----
T ss_pred             cccccccccccccccc-------------------cccccccccccccccccccccc-ccccccccccc-cccccc----
Confidence            9999999998887653                   4667777777777788888888 77777777776 555555    


Q ss_pred             HHHHHHHHHHhhcccccccHHHHHhcHHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhhcCCc
Q 035707          396 IANCLLGVLLSSQSRSVVSDSKRILKQSQALVALETAEKTMRERDPYIIYHLCLENAEQRKLDVALYYAKKLLNLEARSN  475 (713)
Q Consensus       396 ~a~~~lg~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~p~~~  475 (713)
                      ......+...           ...+....+...+.+.+ ...|+++.++..+|..+...|++++|...+++++..+|++.
T Consensus       136 ~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~  203 (388)
T d1w3ba_         136 CVRSDLGNLL-----------KALGRLEEAKACYLKAI-ETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFL  203 (388)
T ss_dssp             HHHHHHHHHH-----------HTTSCHHHHHHHHHHHH-HHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCH
T ss_pred             cccccccccc-----------cccchhhhhHHHHHHhh-ccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccH
Confidence            6666666666           56777899999999999 99999999999999999999999999999999999999998


Q ss_pred             hHHHHHHHHHHHHcCCHHHHHHHHHHHhhccCCCCcHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHhhhhhhhhhhhhh
Q 035707          476 VKGYLLLARVLSAQKQFADAESVINDSLDQTGKWDQGELLRTKAKLQIAQGRLKNAIETYVNLLAVLQFRKKSFSAGKNL  555 (713)
Q Consensus       476 ~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~~  555 (713)
                       .++..+|.++...|++++|+..++++....+  .....+..+|.++...|++++|+..|+++++.+|++          
T Consensus       204 -~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~--~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~----------  270 (388)
T d1w3ba_         204 -DAYINLGNVLKEARIFDRAVAAYLRALSLSP--NHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHF----------  270 (388)
T ss_dssp             -HHHHHHHHHHHTTTCTTHHHHHHHHHHHHCT--TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSC----------
T ss_pred             -HHHHHHhhhhhccccHHHHHHHHHHhHHHhh--hHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCC----------
Confidence             9999999999999999999999999999988  678899999999999999999999999999987654          


Q ss_pred             hhhcccCCCccHHHHHHHHHHHHHHCCCHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCC
Q 035707          556 VKNRQNHDRSLEMETWHDLANVYTSLSQWRDAEVCLSKSKAINPYSASGWHSTGLLYEAKGLQQEALVSFRKALDAEPNH  635 (713)
Q Consensus       556 ~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~eA~~~~~~al~~~p~~  635 (713)
                                  +.+|..+|.++...|++++|+..+++++...|.+...+..+|.++...|++++|+..|+++++++|++
T Consensus       271 ------------~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~  338 (388)
T d1w3ba_         271 ------------PDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF  338 (388)
T ss_dssp             ------------HHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTC
T ss_pred             ------------HHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCC
Confidence                        88999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhcCCChHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHhCC
Q 035707          636 VPSLVSIARVLRQIGGESMATIRCFLTDALRLDRTNTTAWYNLGLLYKTYAG  687 (713)
Q Consensus       636 ~~~~~~la~~~~~~g~~~l~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~  687 (713)
                      +.++..+|.++...|+++  +|+..|+++++++|+++.+|.+||.+|.++|+
T Consensus       339 ~~~~~~la~~~~~~g~~~--~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         339 AAAHSNLASVLQQQGKLQ--EALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHHHTTTCCH--HHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHHHcCCHH--HHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            999999999999999998  99999999999999999999999999999885
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure