Citrus Sinensis ID: 035732

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
LVIKGCEELSVSVSSLPAFCKLEIDGCKKVLWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHDELLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLTSCHGLVKLPQSSFSLSSLREIEIYNCSSLVSFPEVALPSKLKKIRISYCGALKSLPEAWMCDTNSSLEILNIEHCRWLTFIAAVQLPSSLKKLQIRRCDNIRTLTAEEGIQCSSGRRYTSSLLEELEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLYVYGCSKVESIAERLDNNTSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLTSLQHLTIGGALPSLEEDGLPTNLQLLNIEGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLENKRLGTALPLLASLTSLGISRFPNLERLSSSIVDLQNLTLLQLWGCPKLKYFPKKGLPSSLLELDIVGCPLIEEKCRKDGGQYWDLLTHIPYVLIAGKFVFGD
cEEEccccccccccccccccEEEEcccccccccccccccccccEEEEEcccccEEEccccccccccccEEEEEcccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHccccccccEEEEEcccccEEccccccccccccEEEEEcccccEEcccccccccccEEEEEEcccccEEcccccccccccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccccccccccccEEEEcccccHHHHHHHccccccccccccEEEEEcccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEccccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccEEEEccEEEccc
ccccccccccccccccccccEEEcccccccccccccccccccHHcHHccccccccccHHcccccccccEEEEEcccccccHHHHccHHccccccccEEEccccccHccccccccHHHHHHHccccccccEEEEcccccHHcccccccccccccEEEccccccccccccccccccccEEEEcccccHHcccHHccccccccccEEEEcccccccccccccccccccEEEccccccHcccccHccccHHHHcccccccccEEEccccccHHcccHHcccccccccccccccccccEEEEEcccccHccccccccccccccEEEccccccHccccccccccccccEEEccccccHccccccccccccccEEEEcccHHHHcccccccccccccEEEEccccccccccccccccHHcEHHcHHHHcHHHHHccccccccccccEEEccccccccccccHHHccccHHccccccccEEEEcccccHHHccHHccccccccEEEEcccccHcccccccccccccEEEEcccHHHHHccHHcccccccccccccEEEEcccEEccc
LVIKGCEELSVSVSSLPAFCKLEIDGCKKVLWRSatdhlgsqnsvvcrdasnqvflagplkpripkleeLEIKNIKNETYIWKSHDELLQDICSLkrltidscpklqSLVAEEEKDQQQQLCELSCRLeylgltschglvklpqssfslsslrEIEIYNcsslvsfpevalpsklkKIRISYCGAlkslpeawmcdtnssleilnieHCRWLTFIAAVQLPSSLKKLQIRRCDNIRtltaeegiqcssgrrytsslleeleiwdcpsltcifsknelpatleslevgnlppslkSLYVYGCSKVESIAERldnntslekisikrcgtlkilpsglhNLRQLQEISIQICENlvsfpegglpcakltrleiydckrlealpkglhnltslqhltiggalpsleedglptnlqllNIEGNMEIWKSMIERGRGFHRFSSLRRltisrcdddmvsfplenkrlgtalPLLASLtslgisrfpnlerlsssivdlqnltllqlwgcpklkyfpkkglpsslleldivgcplieekcrkdggqywDLLTHIPYVLIagkfvfgd
lvikgceelsvsvsslpafCKLEIDGCKKVLWRSATDHLGSQNSVVCRDASNQVflagplkpripklEELEIKNIKNETYIWKSHDELLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLTSCHGLVKLPQSSFSLSSLREIEIYNCSSLVSFPEVALPSKLKKIRISYCGALKSLPEAWMCDTNSSLEILNIEHCRWLTFIAAVQLPSSLKKLQIRRCDNIRtltaeegiqcssgrRYTSSLLEELEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLYVYGCSKVESIAerldnntslekisikrcGTLKILPSGLHNLRQLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLTSLQHLTIGGALPSLEEDGLPTNLQLLNIEGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLENKRLGTALPLLASLTSLGISRFPNLERLSSSIVDLQNLTLLQLWGCPKLKYFPKKGLPSSLLELDIVGCPLIEEKCRKDGGQYWDLLTHIPYVLIAGKFVFGD
LVIKGCEELSVSVSSLPAFCKLEIDGCKKVLWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHDELLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLTSCHGLVKLPQSSFSLSSLREIEIYNCSSLVSFPEVALPSKLKKIRISYCGALKSLPEAWMCDTNSSLEILNIEHCRWLTFIAAVQLPSSLKKLQIRRCDNIRTLTAEEGIQCSSGRRYTSSLLEELEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLYVYGCSKVESIAERLDNNTSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLTSLQHLTIGGALPSLEEDGLPTNLQLLNIEGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLENKRlgtalpllasltslgISRFPNLERLSSSIVDLQNLTLLQLWGCPKLKYFPKKGLPSSLLELDIVGCPLIEEKCRKDGGQYWDLLTHIPYVLIAGKFVFGD
*****CEELSVSVSSLPAFCKLEIDGCKKVLWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHDELLQDICSLKRLTIDSCPKLQSLVA*******QQLCELSCRLEYLGLTSCHGLVKLPQSSFSLSSLREIEIYNCSSLVSFPEVALPSKLKKIRISYCGALKSLPEAWMCDTNSSLEILNIEHCRWLTFIAAVQLPSSLKKLQIRRCDNIRTLTAEEGIQCSSGRRYTSSLLEELEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLYVYGCSKVESIAERLDNNTSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLTSLQHLTIGGALPSLEEDGLPTNLQLLNIEGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLENKRLGTALPLLASLTSLGISRFPNLERLSSSIVDLQNLTLLQLWGCPKLKYFPKKGLPSSLLELDIVGCPLIEEKCRKDGGQYWDLLTHIPYVLIAGKFVF**
LVIKGCEELSVSVSSLPAFCKLEIDGCKKVLWR*A**HLGSQNSVVCRDASNQVF*****K*RIPKLEELEIKNIKNETYIWKSHDELLQDICSLKRLTIDSCPKLQSLVAEE*********ELSCRLEYLGLTSCHGLVKLPQSSFSLSSLREIEIYNCSSLVSFPEVALPSKLKKIRISYCGALKSLPEAWMCDTNSSLEILNIEHCRWLTFIAAVQLPSSLKKLQIRRCDNIRTLTAEEGI****GRRYTSSLLEELEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLYVYGCSKVESIAERLDNNTSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLTSLQHLTIGGALPSLEEDGLPTNLQLLNIEGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLENKRLGTALPLLASLTSLGISRFPNLERLSSSIVDLQNLTLLQLWGCPKLKYFPKKGLPSSLLELDIVGCPLIEEKCRKDGGQYWDLLTHIPYVLIAGKFVFGD
LVIKGCEELSVSVSSLPAFCKLEIDGCKKVLWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHDELLQDICSLKRLTIDSCPKLQSLV*********QLCELSCRLEYLGLTSCHGLVKLPQSSFSLSSLREIEIYNCSSLVSFPEVALPSKLKKIRISYCGALKSLPEAWMCDTNSSLEILNIEHCRWLTFIAAVQLPSSLKKLQIRRCDNIRTLTAEEGIQCSSGRRYTSSLLEELEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLYVYGCSKVESIAERLDNNTSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLTSLQHLTIGGALPSLEEDGLPTNLQLLNIEGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLENKRLGTALPLLASLTSLGISRFPNLERLSSSIVDLQNLTLLQLWGCPKLKYFPKKGLPSSLLELDIVGCPLIEEKCRKDGGQYWDLLTHIPYVLIAGKFVFGD
*VIKGCEELSVSVSSLPAFCKLEIDGCKKVLWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHDELLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLTSCHGLVKLPQSSFSLSSLREIEIYNCSSLVSFPEVALPSKLKKIRISYCGALKSLPEAWMCDTNSSLEILNIEHCRWLTFIAAVQLPSSLKKLQIRRCDNIRTLTAEEGIQCSSGRRYTSSLLEELEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLYVYGCSKVESIAERLDNNTSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLTSLQHLTIGGALPSLEEDGLPTNLQLLNIEGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLENKRLGTALPLLASLTSLGISRFPNLERLSSSIVDLQNLTLLQLWGCPKLKYFPKKGLPSSLLELDIVGCPLIEEKCRKDGGQYWDLLTHIPYVLIAGKFVFG*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LVIKGCEELSVSVSSLPAFCKLEIDGCKKVLWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELEIKNIKNETYIWKSHDELLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLTSCHGLVKLPQSSFSLSSLREIEIYNCSSLVSFPEVALPSKLKKIRISYCGALKSLPEAWMCDTNSSLEILNIEHCRWLTFIAAVQLPSSLKKLQIRRCDNIRTLTAEEGIQCSSGRRYTSSLLEELEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLYVYGCSKVESIAERLDNNTSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLTSLQHLTIGGALPSLEEDGLPTNLQLLNIEGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLENKRLGTALPLLASLTSLGISRFPNLERLSSSIVDLQNLTLLQLWGCPKLKYFPKKGLPSSLLELDIVGCPLIEEKCRKDGGQYWDLLTHIPYVLIAGKFVFGD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query559 2.2.26 [Sep-21-2011]
Q9LRR51424 Putative disease resistan yes no 0.588 0.231 0.303 4e-21
O23530 1301 Protein SUPPRESSOR OF npr no no 0.656 0.282 0.263 6e-12
Q7XBQ9970 Disease resistance protei N/A no 0.282 0.162 0.338 3e-10
Q7XA39988 Putative disease resistan N/A no 0.341 0.193 0.302 5e-10
P23799630 Putative adenylate cyclas N/A no 0.618 0.549 0.258 1e-07
P26337630 Putative adenylate cyclas N/A no 0.577 0.512 0.254 8e-07
Q7XA40992 Putative disease resistan N/A no 0.644 0.362 0.239 7e-06
Q9SZ67 1895 Probable WRKY transcripti no no 0.425 0.125 0.269 1e-05
Q7XA42979 Putative disease resistan N/A no 0.425 0.243 0.236 3e-05
Q9FKZ0815 Probable disease resistan no no 0.296 0.203 0.284 9e-05
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  103 bits (256), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 119/392 (30%), Positives = 182/392 (46%), Gaps = 63/392 (16%)

Query: 169  VALPSKLKKIRISYCGALKSLPEAWMCDTNSSLEILNIEHCRWLTFIAAVQLPSSLKKLQ 228
            + LP  L+ + I  C  L SLPE  + ++  +L  L I  C  L        P++LK L 
Sbjct: 1087 MELPQNLQSLHIDSCDGLTSLPEN-LTESYPNLHELLIIACHSLESFPGSHPPTTLKTLY 1145

Query: 229  IRRCDNIRTLTAEEGIQCSSGRRYTSSLLEELEIWD-CPSLTCIFSKNELPATLESLEVG 287
            IR C   + L   E +Q +  R Y  S LE L I   C +L         P +L      
Sbjct: 1146 IRDC---KKLNFTESLQPT--RSY--SQLEYLFIGSSCSNLV------NFPLSLF----- 1187

Query: 288  NLPPSLKSLYVYGCSKVESIAERLDNNTSLEKISIKRCGTLKILPSGLHNLR-QLQEISI 346
               P L+SL +  C   ++ +                      + +GL + R  L+ + I
Sbjct: 1188 ---PKLRSLSIRDCESFKTFS----------------------IHAGLGDDRIALESLEI 1222

Query: 347  QICENLVSFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLTSLQHLTIGG--ALPSLEED 404
            + C NL +FP+GGLP  KL+ + + +CK+L+ALP+ L  LTSL  L I     + ++   
Sbjct: 1223 RDCPNLETFPQGGLPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIETIPGG 1282

Query: 405  GLPTNLQLLNIEGNMEIWKSMIERGR-GFHRFSSLRRLTISRCDDDMVSFPLENKRLGTA 463
            G P+NL+ L I     +   +  R   G     +LR L I   ++D+ SFP E       
Sbjct: 1283 GFPSNLRTLCI----SLCDKLTPRIEWGLRDLENLRNLEIDGGNEDIESFPEEG-----L 1333

Query: 464  LPLLASLTSLGISRFPNLERLS-SSIVDLQNLTLLQLWGCPKLKYFPKKGLPSSLLELDI 522
            LP   S+ SL ISRF NL+ L+     D + +  +++ GC KL+    + LP  L  L I
Sbjct: 1334 LP--KSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDKLQISIDEDLP-PLSCLRI 1390

Query: 523  VGCPLIEEKCRKDGGQYWDLLTHIPYVLIAGK 554
              C L+ E   +   +++ +L +IPYV I G+
Sbjct: 1391 SSCSLLTETFAEVETEFFKVL-NIPYVEIDGE 1421
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|P23799|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1 Back     alignment and function description
>sp|P26337|ESA8C_TRYEQ Putative adenylate cyclase regulatory protein OS=Trypanosoma equiperdum GN=ESAG8C PE=2 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q9FKZ0|DRL43_ARATH Probable disease resistance protein At5g66910 OS=Arabidopsis thaliana GN=At5g66910 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query559
224132254552 predicted protein [Populus trichocarpa] 0.910 0.922 0.390 3e-76
356554923 1399 PREDICTED: putative disease resistance R 0.844 0.337 0.355 1e-66
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.760 0.298 0.401 3e-65
400131587 1388 FB_MR5 [Malus x robusta] 0.858 0.345 0.364 1e-62
45826061 739 resistance protein [Quercus suber] 0.853 0.645 0.348 1e-59
225449649 1418 PREDICTED: putative disease resistance p 0.890 0.351 0.355 2e-56
147766392 1471 hypothetical protein VITISV_007674 [Viti 0.828 0.314 0.327 9e-52
359487225 1373 PREDICTED: putative disease resistance R 0.912 0.371 0.316 3e-51
225450023 1396 PREDICTED: putative disease resistance p 0.821 0.328 0.320 7e-51
451798992 1440 disease resistance protein At3g14460-lik 0.826 0.320 0.323 1e-50
>gi|224132254|ref|XP_002328223.1| predicted protein [Populus trichocarpa] gi|222837738|gb|EEE76103.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  292 bits (748), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 220/563 (39%), Positives = 302/563 (53%), Gaps = 54/563 (9%)

Query: 24  IDGCKKVLWRSATDHLGSQNSVVCRDASNQVFLAGPLKPRIPKLEELEIKNIKNETYIWK 83
           I+GCK+V++     +L S NS+   + S   +LA      + +++ELEI N    T +++
Sbjct: 3   INGCKEVVYEGGV-YLRSLNSMTISNISKLTYLAEGFIQPLAEVQELEIANCMELTSLYE 61

Query: 84  SHDELLQDICSLKRLTIDSCPKLQSLV-AEEEKDQQQQLCELSCRLEYLGLTSCHGLVKL 142
           +   L + + SL +L + +CP++ SL+  E     QQQL   +C+LE L  ++C  L KL
Sbjct: 62  NGVALAKQLTSLLKLEVRNCPQVVSLMEGEVPVYMQQQLA--NCKLESLTFSTCESLKKL 119

Query: 143 PQSSFSLSSLREIEIYNCSSLVSFPEVALPSKLKKIRISYCGALKSLPEA----WMCDTN 198
           PQ   SL SL+E++I  C  L+SFPE  LPS L+ I I  C AL  LP A     MC   
Sbjct: 120 PQWVHSLVSLKELKIQYCPRLLSFPEAGLPSTLRIIEIVGCNALTPLPAAVTYNMMC--- 176

Query: 199 SSLEILNIEHCRWLTFIAAVQLPSSLKKLQIRRCDNIRTL----------TAEEGIQCSS 248
             LE L IE+C  L     +QLP +LKKL+IR C+N+  L           ++E   CS 
Sbjct: 177 --LEQLRIENCESLISFGRIQLPPTLKKLEIRYCENLLCLLDDGEGSSSKKSDENTSCSG 234

Query: 249 GRRYTSSLLEELEIWDCPSLTCIFSKNELPATLESLEV------------GNLPPSLKSL 296
                SSLLE L +  C SLT I    ELP+ L+ L+V              LP  LK L
Sbjct: 235 N---NSSLLEYLYVGICNSLTSI---GELPSALKYLQVCSCSKLKSLSSRDKLPAGLKHL 288

Query: 297 YVYGCSKVESIAERLDNNTSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFP 356
            +  C  +ES+ +R  +N SLE + I  C  L+ LP GLH L  L+EISI  C  LVSF 
Sbjct: 289 AIDSCENLESMPDRFQDNMSLENLKIWFCFNLRSLPEGLHKLCHLREISIWYCPALVSFA 348

Query: 357 EGGLPCAKLTRLEIYDCKRLEALPKGLHNLTSLQHLTIGGA--LPSLEEDGLPTNLQLLN 414
             GLP   L RL I  C  L+A+P  +HNL SL+ L+I     + S  E+G PT+L  L 
Sbjct: 349 AEGLP-INLRRLFIIKCDGLKAIPDHMHNLMSLEELSIYYCPDIVSFPEEGFPTSLTYL- 406

Query: 415 IEGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLENKRLGTALPLLASLTSLG 474
               +++    +    G H+ S+LR L I +     +SFP  +  +G  LP  ++L  L 
Sbjct: 407 --ATVDLKICELLFNWGMHKLSALRTLII-QGGFSHISFP--SVDMGVRLP--SALNRLS 459

Query: 475 ISRFPNLERLS-SSIVDLQNLTLLQLWGCPKLKYFPKKGLPSSLLELDIVGCPLIEEKCR 533
           I  FPNLE LS S   +L +L  L +  CPKL  FP KGLPSSLLEL I  CPL+ ++  
Sbjct: 460 IEDFPNLEYLSYSGFQNLSSLERLSISDCPKLTSFPGKGLPSSLLELRIRACPLLVQQI- 518

Query: 534 KDGGQYWDLLTHIPYVLIAGKFV 556
           K   + W  + HIPY+ I GK V
Sbjct: 519 KGRVKEWLKIRHIPYINIDGKVV 541

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|45826061|gb|AAS77675.1| resistance protein [Quercus suber] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147766392|emb|CAN67818.1| hypothetical protein VITISV_007674 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487225|ref|XP_002268551.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450023|ref|XP_002272823.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] gi|451798994|gb|AGF69195.1| disease resistance protein At3g14460-like protein 2 [Vitis labrusca] Back     alignment and taxonomy information
>gi|451798992|gb|AGF69194.1| disease resistance protein At3g14460-like protein 1 [Vitis labrusca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query559
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.559 0.219 0.309 3.2e-22
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.474 0.223 0.278 2.7e-18
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.488 0.137 0.276 1e-16
TAIR|locus:21292211147 RPP4 "recognition of peronospo 0.631 0.307 0.247 7.5e-13
TAIR|locus:2053405 1215 AT2G14080 [Arabidopsis thalian 0.642 0.295 0.244 8.1e-13
TAIR|locus:2129236 1301 SNC1 "SUPPRESSOR OF NPR1-1, CO 0.749 0.322 0.252 5.1e-12
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.810 0.350 0.246 6.5e-12
TAIR|locus:2098110 1219 AT3G44670 [Arabidopsis thalian 0.357 0.164 0.311 1.6e-11
TAIR|locus:2130250 1304 AT4G16920 [Arabidopsis thalian 0.461 0.197 0.309 2.3e-11
TAIR|locus:21001821007 AT3G44400 [Arabidopsis thalian 0.454 0.252 0.276 5.8e-11
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 261 (96.9 bits), Expect = 3.2e-22, Sum P(2) = 3.2e-22
 Identities = 111/359 (30%), Positives = 174/359 (48%)

Query:   218 VQLPSSLKKLQIRRCDNIRTLTAEEGIQCSSGRRYTSSLLEELEIWDCPSLTCIFSKNEL 277
             ++LP +L+ L I  CD + +L   E +  S    Y +  L EL I  C SL   F  +  
Sbjct:  1087 MELPQNLQSLHIDSCDGLTSLP--ENLTES----YPN--LHELLIIACHSLES-FPGSHP 1137

Query:   278 PATLESLEVGN---------LPPS-----LKSLYV-YGCSKVESIAERLDNNTSLEKISI 322
             P TL++L + +         L P+     L+ L++   CS + +    L     L  +SI
Sbjct:  1138 PTTLKTLYIRDCKKLNFTESLQPTRSYSQLEYLFIGSSCSNLVNFP--LSLFPKLRSLSI 1195

Query:   323 KRCGTLKI--LPSGLHNLR-QLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCKRLEAL 379
             + C + K   + +GL + R  L+ + I+ C NL +FP+GGLP  KL+ + + +CK+L+AL
Sbjct:  1196 RDCESFKTFSIHAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQAL 1255

Query:   380 PKGLHNLTSLQHLTIGGALPSLEE---DGLPTNLQLLNIEGNMEIWKSMIERGRGFHRFS 436
             P+ L  LTSL  L I    P +E     G P+NL+ L I    ++    IE G       
Sbjct:  1256 PEKLFGLTSLLSLFIIKC-PEIETIPGGGFPSNLRTLCISLCDKL-TPRIEWG--LRDLE 1311

Query:   437 SLRRLTISRCDDDMVSFPLENKRXXXXXXXXXXXXXXXISRFPNLERLS-SSIVDLQNLT 495
             +LR L I   ++D+ SFP E                  ISRF NL+ L+     D + + 
Sbjct:  1312 NLRNLEIDGGNEDIESFPEEG-------LLPKSVFSLRISRFENLKTLNRKGFHDTKAIE 1364

Query:   496 LLQLWGCPKLKYFPKKGLPSSLLELDIVGCPLIEEKCRKDGGQYWDLLTHIPYVLIAGK 554
              +++ GC KL+    + LP  L  L I  C L+ E   +   +++ +L +IPYV I G+
Sbjct:  1365 TMEISGCDKLQISIDEDLPP-LSCLRISSCSLLTETFAEVETEFFKVL-NIPYVEIDGE 1421
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129221 RPP4 "recognition of peronospora parasitica 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130250 AT4G16920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100182 AT3G44400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00660113
hypothetical protein (552 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-11
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-10
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-07
PRK15386426 PRK15386, PRK15386, type III secretion protein Gog 4e-06
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 67.2 bits (164), Expect = 1e-11
 Identities = 62/215 (28%), Positives = 96/215 (44%), Gaps = 40/215 (18%)

Query: 315 TSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCK 374
           T+LE + +  C +L  LPS +  L +L+++ +  CENL   P G +    L RL +  C 
Sbjct: 657 TNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTG-INLKSLYRLNLSGCS 715

Query: 375 RLEALPKGLHNLTSLQHLTIGGALPSLEEDGLPTNLQLLNIEGNMEIWKSMIERGRGFHR 434
           RL++ P    N++ L    +     ++EE   P+NL+L N+                   
Sbjct: 716 RLKSFPDISTNISWL---DLDET--AIEE--FPSNLRLENL------------------- 749

Query: 435 FSSLRRLTISRCDDDMVSFPLENKRLGTALPLLA----SLTSLGISRFPNLERLSSSIVD 490
                   +  C+  M S  L  +R+    PL+     SLT L +S  P+L  L SSI +
Sbjct: 750 ------DELILCE--MKSEKLW-ERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQN 800

Query: 491 LQNLTLLQLWGCPKLKYFPKKGLPSSLLELDIVGC 525
           L  L  L++  C  L+  P      SL  LD+ GC
Sbjct: 801 LHKLEHLEIENCINLETLPTGINLESLESLDLSGC 835

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 559
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.79
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.54
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.53
KOG4237498 consensus Extracellular matrix protein slit, conta 99.4
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.36
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.34
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.22
KOG0617264 consensus Ras suppressor protein (contains leucine 99.21
KOG4341483 consensus F-box protein containing LRR [General fu 99.18
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.17
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.16
KOG4341483 consensus F-box protein containing LRR [General fu 99.08
KOG0617264 consensus Ras suppressor protein (contains leucine 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.93
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.74
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.55
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.51
PRK15386 426 type III secretion protein GogB; Provisional 98.5
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.5
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.5
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.46
PRK15386426 type III secretion protein GogB; Provisional 98.45
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.28
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.26
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.21
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.2
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.18
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.94
PLN03150623 hypothetical protein; Provisional 97.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.9
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.86
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.82
PLN03150623 hypothetical protein; Provisional 97.75
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.74
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.55
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.53
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.53
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.51
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.45
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.44
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.33
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.3
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.12
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.51
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.5
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.47
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.32
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.28
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.2
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.1
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.9
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.81
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.32
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.15
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.78
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.02
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.99
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.07
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.87
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 91.89
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 86.84
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.9e-34  Score=321.62  Aligned_cols=467  Identities=19%  Similarity=0.210  Sum_probs=263.6

Q ss_pred             CCccCCCccCccEEeecCCCce-EeeccCC-ccCcccceeeecCCcceeecCCCC-CCCCCccEEEeccccCccEEeccC
Q 035732            9 LSVSVSSLPAFCKLEIDGCKKV-LWRSATD-HLGSQNSVVCRDASNQVFLAGPLK-PRIPKLEELEIKNIKNETYIWKSH   85 (559)
Q Consensus         9 l~~~~~~l~~L~~L~l~~~~~~-~~~~~~~-~~~~~~~~~~~~~~~~~~l~~~~~-~~l~~L~~L~l~~~~~~~~~~~~~   85 (559)
                      +++.|..+++|+.|++++|... ..+...+ .+...+   ..+.++. .+.|.+| ..+++|++|+++++. +..   ..
T Consensus        85 ~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~---~L~Ls~n-~l~~~~p~~~l~~L~~L~Ls~n~-~~~---~~  156 (968)
T PLN00113         85 ISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLR---YLNLSNN-NFTGSIPRGSIPNLETLDLSNNM-LSG---EI  156 (968)
T ss_pred             CChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCC---EEECcCC-ccccccCccccCCCCEEECcCCc-ccc---cC
Confidence            3467889999999999998653 2222222 222222   2222211 1223333 257888888888773 322   33


Q ss_pred             chhhhccCCCcEEEeccCCCccccccchHHHHHhhhhhccCceeEEecccCCCCcccCCCCCCCCccceeeccCCCCccc
Q 035732           86 DELLQDICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLTSCHGLVKLPQSSFSLSSLREIEIYNCSSLVS  165 (559)
Q Consensus        86 ~~~~~~l~~L~~L~L~~c~~l~~l~~~~~~~~l~~L~~~~~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~~~~~~~  165 (559)
                      +..++.+++|++|++++|.-...++     ..+.++    ++|++|++++|.....+|..+..+++|++|++++|.....
T Consensus       157 p~~~~~l~~L~~L~L~~n~l~~~~p-----~~~~~l----~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~  227 (968)
T PLN00113        157 PNDIGSFSSLKVLDLGGNVLVGKIP-----NSLTNL----TSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGE  227 (968)
T ss_pred             ChHHhcCCCCCEEECccCcccccCC-----hhhhhC----cCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCc
Confidence            4556788888888888863222332     245666    8888888888876567777788888888888888766556


Q ss_pred             cC-CCCCCCCccEEEecccCCCcccCcccccCCCCCccEEecCCCCCccccccc-cCCCCcceEEeecccCccccchhhc
Q 035732          166 FP-EVALPSKLKKIRISYCGALKSLPEAWMCDTNSSLEILNIEHCRWLTFIAAV-QLPSSLKKLQIRRCDNIRTLTAEEG  243 (559)
Q Consensus       166 ~~-~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~-~~~~~L~~L~l~~~~~l~~~~~~~~  243 (559)
                      +| .+..+++|++|++++|.....+|..+  ..+++|+.|++++|.....++.. ..+++|+.|++++|.....+|..+.
T Consensus       228 ~p~~l~~l~~L~~L~L~~n~l~~~~p~~l--~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~  305 (968)
T PLN00113        228 IPYEIGGLTSLNHLDLVYNNLTGPIPSSL--GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVI  305 (968)
T ss_pred             CChhHhcCCCCCEEECcCceeccccChhH--hCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHc
Confidence            66 36778888888888877555566553  34577888888877543334332 4567778887777543333443332


Q ss_pred             cccccccccccCCccEEEEecCCCccccccCCCCCccccccccCCCCCCccEEEEcCCCCccchHHhhccCCCCceEEee
Q 035732          244 IQCSSGRRYTSSLLEELEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLYVYGCSKVESIAERLDNNTSLEKISIK  323 (559)
Q Consensus       244 ~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~l~~~~l~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~  323 (559)
                      .       +  ++|+.|++.+ +.+..     ..|..+.     .+ ++|+.|++.+|.....+|..+..+++|+.|+++
T Consensus       306 ~-------l--~~L~~L~l~~-n~~~~-----~~~~~~~-----~l-~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls  364 (968)
T PLN00113        306 Q-------L--QNLEILHLFS-NNFTG-----KIPVALT-----SL-PRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLS  364 (968)
T ss_pred             C-------C--CCCcEEECCC-CccCC-----cCChhHh-----cC-CCCCEEECcCCCCcCcCChHHhCCCCCcEEECC
Confidence            2       2  2377777766 33331     2222222     22 356666666655555555555566666666666


Q ss_pred             ecCccccccccCCCCCccceeecccccCceecCCCCCCCCCccEEeccccccccccccccccCCCcceEEecC-CCCC--
Q 035732          324 RCGTLKILPSGLHNLRQLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLTSLQHLTIGG-ALPS--  400 (559)
Q Consensus       324 ~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~-~l~~--  400 (559)
                      +|.+...+|..+..+++|+.|++.+|.....+|..+..+++|+.|++++|.....+|..+..+++|+.|++++ .+..  
T Consensus       365 ~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~  444 (968)
T PLN00113        365 TNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRI  444 (968)
T ss_pred             CCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCcc
Confidence            6555544555555555555555555544334444444444555555555544444444444445555555444 2222  


Q ss_pred             -----------------------CcCCCCCCCCceeeecCccchhhhhhhcccccccCccccEEEEeecCCCceeecccc
Q 035732          401 -----------------------LEEDGLPTNLQLLNIEGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLEN  457 (559)
Q Consensus       401 -----------------------~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~  457 (559)
                                             ++.....++|+.|++++|+ +....+.   .+..+++|+.|++++|.. ...+|.  
T Consensus       445 ~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~-l~~~~~~---~~~~l~~L~~L~Ls~N~l-~~~~p~--  517 (968)
T PLN00113        445 NSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQ-FSGAVPR---KLGSLSELMQLKLSENKL-SGEIPD--  517 (968)
T ss_pred             ChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCc-cCCccCh---hhhhhhccCEEECcCCcc-eeeCCh--
Confidence                                   2222223455555555555 3222222   355566666666666531 112222  


Q ss_pred             cccccccccccccceeeccccccccccccccccCCCcCeEEecCCCCCcccCCC-CCCCCceEEEecCChh
Q 035732          458 KRLGTALPLLASLTSLGISRFPNLERLSSSIVDLQNLTLLQLWGCPKLKYFPKK-GLPSSLLELDIVGCPL  527 (559)
Q Consensus       458 ~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~-~~~~~L~~L~l~~c~~  527 (559)
                           .+..+++|+.|++++|.....+|..+..+++|++|++++|+....+|.. .-+++|+.+++++|+.
T Consensus       518 -----~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l  583 (968)
T PLN00113        518 -----ELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHL  583 (968)
T ss_pred             -----HHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcc
Confidence                 2445667777777775555556666666777777777775433345542 2245677777777654

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 7e-06
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 68/144 (47%), Gaps = 13/144 (9%)
Query: 257 LEELEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLYVYGC--SKVESIAERLDNN 314
           L EL I  CP LT      ELP  L S +       L +L       + + S+   + N 
Sbjct: 152 LRELSIRACPELT------ELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANL 205
Query: 315 TSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFPE--GGLPCAKLTRLEIYD 372
            +L+ + I R   L  L   +H+L +L+E+ ++ C  L ++P   GG   A L RL + D
Sbjct: 206 QNLKSLKI-RNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGR--APLKRLILKD 262
Query: 373 CKRLEALPKGLHNLTSLQHLTIGG 396
           C  L  LP  +H LT L+ L + G
Sbjct: 263 CSNLLTLPLDIHRLTQLEKLDLRG 286

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query559
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 84.2 bits (209), Expect = 5e-18
 Identities = 52/306 (16%), Positives = 95/306 (31%), Gaps = 41/306 (13%)

Query: 128 LEYLGLTSCHGLVKLPQSSFSLSSLREIEIYNCSSLVSFPEVALPSKLKKIRISYCGALK 187
            E L       L                +     S          S   +I      ALK
Sbjct: 14  RENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQAN----SNNPQIETRTGRALK 69

Query: 188 SLPEAWMCDTNSSLEILNIEHCRWLTFIAAVQLPSSLKKLQIRRCDNIRTLTAEEGIQCS 247
           +  +     T      L +       F       S L+ + I     +  L      Q +
Sbjct: 70  ATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAA-GLMELPDTMQ-QFA 127

Query: 248 SGRRYTSSLLEELEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLYVYGCSKVESI 307
                    LE L +     L        LPA++ SL        L+ L +  C ++  +
Sbjct: 128 G--------LETLTLARN-PLR------ALPASIASLN------RLRELSIRACPELTEL 166

Query: 308 ---------AERLDNNTSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFPEG 358
                    +       +L+ + ++  G ++ LP+ + NL+ L+ + I+    L +    
Sbjct: 167 PEPLASTDASGEHQGLVNLQSLRLEWTG-IRSLPASIANLQNLKSLKIRNS-PLSALGPA 224

Query: 359 GLPCAKLTRLEIYDCKRLEALPKGLHNLTSLQHLTIGGA--LPSL-EEDGLPTNLQLLNI 415
                KL  L++  C  L   P        L+ L +     L +L  +    T L+ L++
Sbjct: 225 IHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDL 284

Query: 416 EGNMEI 421
            G + +
Sbjct: 285 RGCVNL 290
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query559
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.81
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.78
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.75
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.68
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.67
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.67
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.65
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.65
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.65
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.64
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.64
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.63
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.6
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.59
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.59
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.57
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.57
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.55
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.55
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.53
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.47
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.46
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.46
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.46
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.43
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.43
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.4
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.39
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.35
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.35
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.35
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.33
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.33
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.33
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.32
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.31
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.3
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.3
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.28
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.27
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.26
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.26
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.23
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.2
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.2
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.18
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.12
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.03
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.01
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.0
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.0
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.99
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.97
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.96
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.96
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 98.93
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.92
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.92
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.88
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.87
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.83
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.81
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.77
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.59
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.45
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.41
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.3
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.27
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.24
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.08
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.02
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.83
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.4
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.23
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.85
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.62
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 91.42
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 87.84
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 87.81
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.3e-37  Score=333.89  Aligned_cols=484  Identities=17%  Similarity=0.125  Sum_probs=269.1

Q ss_pred             CCCccCccEEeecCCCceEeeccCCccCcccceeeecCCcceeecCCC--CCCCCCccEEEeccccCccEEeccCchhhh
Q 035732           13 VSSLPAFCKLEIDGCKKVLWRSATDHLGSQNSVVCRDASNQVFLAGPL--KPRIPKLEELEIKNIKNETYIWKSHDELLQ   90 (559)
Q Consensus        13 ~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~--~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~   90 (559)
                      +..+++|++|++++|........ ..+...+.+....   .- +.+..  ...+++|++|+++++. ++.   ..+..++
T Consensus       174 ~~~l~~L~~L~Ls~n~l~~~~~~-~~l~~L~~L~Ls~---n~-l~~~~~~l~~l~~L~~L~Ls~n~-l~~---~~~~~l~  244 (768)
T 3rgz_A          174 SDGCGELKHLAISGNKISGDVDV-SRCVNLEFLDVSS---NN-FSTGIPFLGDCSALQHLDISGNK-LSG---DFSRAIS  244 (768)
T ss_dssp             TTCCTTCCEEECCSSEEESCCBC-TTCTTCCEEECCS---SC-CCSCCCBCTTCCSCCEEECCSSC-CCS---CHHHHTT
T ss_pred             hccCCCCCEEECCCCcccccCCc-ccCCcCCEEECcC---Cc-CCCCCcccccCCCCCEEECcCCc-CCC---cccHHHh
Confidence            67888888888888864432221 1122222221111   10 11111  2356777777777763 332   3345567


Q ss_pred             ccCCCcEEEeccCCCccccccchHHHHHhhhhhccCceeEEecccCCCCcccCCCCCCC-CccceeeccCCCCccccC-C
Q 035732           91 DICSLKRLTIDSCPKLQSLVAEEEKDQQQQLCELSCRLEYLGLTSCHGLVKLPQSSFSL-SSLREIEIYNCSSLVSFP-E  168 (559)
Q Consensus        91 ~l~~L~~L~L~~c~~l~~l~~~~~~~~l~~L~~~~~~L~~L~l~~~~~l~~~~~~~~~l-~~L~~L~l~~~~~~~~~~-~  168 (559)
                      .+++|++|++++| .+....+.     . .+    ++|++|++++|.....+|..+... ++|++|++++|.....+| .
T Consensus       245 ~l~~L~~L~Ls~n-~l~~~~~~-----~-~l----~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~  313 (768)
T 3rgz_A          245 TCTELKLLNISSN-QFVGPIPP-----L-PL----KSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPF  313 (768)
T ss_dssp             TCSSCCEEECCSS-CCEESCCC-----C-CC----TTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGG
T ss_pred             cCCCCCEEECCCC-cccCccCc-----c-cc----CCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchH
Confidence            7777777777776 33322221     0 22    666666666665433556555543 666666666665444444 2


Q ss_pred             CCCCCCccEEEecccCCCcccCcccccCCCCCccEEecCCCCCccccccc-cCC-CCcceEEee----------------
Q 035732          169 VALPSKLKKIRISYCGALKSLPEAWMCDTNSSLEILNIEHCRWLTFIAAV-QLP-SSLKKLQIR----------------  230 (559)
Q Consensus       169 ~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~-~~~-~~L~~L~l~----------------  230 (559)
                      +..+++|++|++++|.....+|...+ ..+++|++|++++|.....++.. ... ++|+.|+++                
T Consensus       314 ~~~l~~L~~L~L~~n~l~~~ip~~~l-~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~  392 (768)
T 3rgz_A          314 FGSCSLLESLALSSNNFSGELPMDTL-LKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNP  392 (768)
T ss_dssp             GGGCTTCCEEECCSSEEEEECCHHHH-TTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCST
T ss_pred             HhcCCCccEEECCCCcccCcCCHHHH-hcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcc
Confidence            55566666666666653334444311 33455666666655322222222 111 244444444                


Q ss_pred             ----------cccCccccchhhccccccccccccCCccEEEEecCCCccccccCCCCCccccccccCCCCCCccEEEEcC
Q 035732          231 ----------RCDNIRTLTAEEGIQCSSGRRYTSSLLEELEIWDCPSLTCIFSKNELPATLESLEVGNLPPSLKSLYVYG  300 (559)
Q Consensus       231 ----------~~~~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~l~~~~l~~~L~~L~l~~  300 (559)
                                +|.....++..+..       ++  +|++|++++ +.++     +..|..+.     .+ ++|+.|++++
T Consensus       393 ~~~L~~L~L~~n~l~~~~p~~l~~-------l~--~L~~L~Ls~-N~l~-----~~~p~~l~-----~l-~~L~~L~L~~  451 (768)
T 3rgz_A          393 KNTLQELYLQNNGFTGKIPPTLSN-------CS--ELVSLHLSF-NYLS-----GTIPSSLG-----SL-SKLRDLKLWL  451 (768)
T ss_dssp             TCCCCEEECCSSEEEEECCGGGGG-------CT--TCCEEECCS-SEEE-----SCCCGGGG-----GC-TTCCEEECCS
T ss_pred             cCCccEEECCCCccccccCHHHhc-------CC--CCCEEECcC-Cccc-----CcccHHHh-----cC-CCCCEEECCC
Confidence                      43211122222211       11  266666655 2333     22233332     22 4677777777


Q ss_pred             CCCccchHHhhccCCCCceEEeeecCccccccccCCCCCccceeecccccCceecCCCCCCCCCccEEeccccccccccc
Q 035732          301 CSKVESIAERLDNNTSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCKRLEALP  380 (559)
Q Consensus       301 ~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~  380 (559)
                      |.....+|..+..+++|++|++++|.+.+.+|..+..+++|++|++++|.....+|..+..+++|+.|++++|.....+|
T Consensus       452 n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p  531 (768)
T 3rgz_A          452 NMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIP  531 (768)
T ss_dssp             SCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECC
T ss_pred             CcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCC
Confidence            76666666667777777777777777666667777777777777777776555666666666677777777777666677


Q ss_pred             cccccCCCcceEEecC-CCC-CCc--------------------------------------------------------
Q 035732          381 KGLHNLTSLQHLTIGG-ALP-SLE--------------------------------------------------------  402 (559)
Q Consensus       381 ~~l~~l~~L~~L~l~~-~l~-~~~--------------------------------------------------------  402 (559)
                      ..+..+++|+.|++++ .+. .+|                                                        
T Consensus       532 ~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~  611 (768)
T 3rgz_A          532 AELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRN  611 (768)
T ss_dssp             GGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTC
T ss_pred             HHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhcccccc
Confidence            7777777777777765 221 111                                                        


Q ss_pred             ---------------CCCCCCCCceeeecCccchhhhhhhcccccccCccccEEEEeecCCCceeecccccccccccccc
Q 035732          403 ---------------EDGLPTNLQLLNIEGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLENKRLGTALPLL  467 (559)
Q Consensus       403 ---------------~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~l  467 (559)
                                     ....+++|++|++++|. ++..++.   .+..+++|+.|++++|.. ...+|.       .+..+
T Consensus       612 ~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~-l~g~ip~---~l~~l~~L~~L~Ls~N~l-~g~ip~-------~l~~L  679 (768)
T 3rgz_A          612 PCNITSRVYGGHTSPTFDNNGSMMFLDMSYNM-LSGYIPK---EIGSMPYLFILNLGHNDI-SGSIPD-------EVGDL  679 (768)
T ss_dssp             CSCTTSCEEEEECCCSCSSSBCCCEEECCSSC-CBSCCCG---GGGGCTTCCEEECCSSCC-CSCCCG-------GGGGC
T ss_pred             ccccccceecccCchhhhccccccEEECcCCc-ccccCCH---HHhccccCCEEeCcCCcc-CCCCCh-------HHhCC
Confidence                           01224567778888777 4444443   577788888888887642 113333       26667


Q ss_pred             cccceeeccccccccccccccccCCCcCeEEecCCCCCcccCCCCCCCCceEEEecCChhhh----hhhhccCccccccc
Q 035732          468 ASLTSLGISRFPNLERLSSSIVDLQNLTLLQLWGCPKLKYFPKKGLPSSLLELDIVGCPLIE----EKCRKDGGQYWDLL  543 (559)
Q Consensus       468 ~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~L~~L~l~~c~~l~----~~~~~~~~~~~~~~  543 (559)
                      ++|+.|++++|.....+|..+..+++|++|++++|+--..+|..+.+.++....+.+|+.+-    ..|....+++|+++
T Consensus       680 ~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~  759 (768)
T 3rgz_A          680 RGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHH  759 (768)
T ss_dssp             TTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC-------
T ss_pred             CCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCC
Confidence            88888888886655577877788888888888885433457765555566666666766532    25777888999999


Q ss_pred             CCCceeE
Q 035732          544 THIPYVL  550 (559)
Q Consensus       544 ~~~~~~~  550 (559)
                      +|++..+
T Consensus       760 ~~~~~~~  766 (768)
T 3rgz_A          760 QRSHHHH  766 (768)
T ss_dssp             -------
T ss_pred             CCccccC
Confidence            9998654
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query559
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.72
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.62
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.48
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.44
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.41
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.39
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.38
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.38
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.37
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.36
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.22
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.08
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.05
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.02
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.02
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.99
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.97
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.95
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.68
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.67
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.53
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.53
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.0
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.65
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.38
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.62
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.59
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.08
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.87  E-value=2.2e-20  Score=184.34  Aligned_cols=191  Identities=20%  Similarity=0.214  Sum_probs=122.1

Q ss_pred             hhccCCCCceEEeeecCccccccccCCCCCccceeecccccCceecCCCCCCCCCccEEeccccccccccccccccCCCc
Q 035732          310 RLDNNTSLEKISIKRCGTLKILPSGLHNLRQLQEISIQICENLVSFPEGGLPCAKLTRLEIYDCKRLEALPKGLHNLTSL  389 (559)
Q Consensus       310 ~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L  389 (559)
                      ....+++++.+++++|......+  ....++|++|++++|. ++.++ .+..+++|+.+++++|.. ..++ .+..+++|
T Consensus       192 ~~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~-l~~~~-~l~~l~~L~~L~l~~n~l-~~~~-~~~~~~~L  265 (384)
T d2omza2         192 VLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQ-LKDIG-TLASLTNLTDLDLANNQI-SNLA-PLSGLTKL  265 (384)
T ss_dssp             GGGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSC-CCCCG-GGGGCTTCSEEECCSSCC-CCCG-GGTTCTTC
T ss_pred             ccccccccceeeccCCccCCCCc--ccccCCCCEEECCCCC-CCCcc-hhhcccccchhccccCcc-CCCC-cccccccC
Confidence            34556666666666665444222  3445666777776663 23332 233445677777777653 3332 35666777


Q ss_pred             ceEEecC-CCCCCcCCCCCCCCceeeecCccchhhhhhhcccccccCccccEEEEeecCCCceeeccccccccccccccc
Q 035732          390 QHLTIGG-ALPSLEEDGLPTNLQLLNIEGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLENKRLGTALPLLA  468 (559)
Q Consensus       390 ~~L~l~~-~l~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~l~  468 (559)
                      +.+++++ .+..++....++.++.+.+..|. +.+.     ..+..+++++.|++++|.  +..++.        +..++
T Consensus       266 ~~L~l~~~~l~~~~~~~~~~~l~~l~~~~n~-l~~~-----~~~~~~~~l~~L~ls~n~--l~~l~~--------l~~l~  329 (384)
T d2omza2         266 TELKLGANQISNISPLAGLTALTNLELNENQ-LEDI-----SPISNLKNLTYLTLYFNN--ISDISP--------VSSLT  329 (384)
T ss_dssp             SEEECCSSCCCCCGGGTTCTTCSEEECCSSC-CSCC-----GGGGGCTTCSEEECCSSC--CSCCGG--------GGGCT
T ss_pred             CEeeccCcccCCCCccccccccccccccccc-cccc-----cccchhcccCeEECCCCC--CCCCcc--------cccCC
Confidence            7777776 66666666666777777777776 3321     236677888888888763  333332        55678


Q ss_pred             ccceeeccccccccccccccccCCCcCeEEecCCCCCcccCCCCCCCCceEEEecCC
Q 035732          469 SLTSLGISRFPNLERLSSSIVDLQNLTLLQLWGCPKLKYFPKKGLPSSLLELDIVGC  525 (559)
Q Consensus       469 ~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~L~~L~l~~c  525 (559)
                      +|++|++++| .++.++ .+..+++|++|++++ ++++.+++-.-+++|++|++++|
T Consensus       330 ~L~~L~L~~n-~l~~l~-~l~~l~~L~~L~l~~-N~l~~l~~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         330 KLQRLFFANN-KVSDVS-SLANLTNINWLSAGH-NQISDLTPLANLTRITQLGLNDQ  383 (384)
T ss_dssp             TCCEEECCSS-CCCCCG-GGGGCTTCCEEECCS-SCCCBCGGGTTCTTCSEEECCCE
T ss_pred             CCCEEECCCC-CCCCCh-hHcCCCCCCEEECCC-CcCCCChhhccCCCCCEeeCCCC
Confidence            8888888885 566665 467788888888887 47877766334578888888875
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure