Citrus Sinensis ID: 035766

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MWLLTYNTFLEFICFHLLTDLFSSFVQGPLKNAIDWASRPPNVWADKAAAIVSAAGGSGGARAQYHLRQIGVYLDLHFVNKPEYFLNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFTLRLQGIC
cHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHccccccccccEEEEEcccccccHHHHHHHHHHHHHHcccEEccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccc
cHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHHHHHcccccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccc
MWLLTYNTFLEFICFHLLTDLfssfvqgplknaidwasrppnvwaDKAAAIVSAAGGSGGARAQYHLRQIGVYldlhfvnkpeyflnafqppakfdsdgnlidEESKEKLKAVLLALRAFTLRLQGIC
MWLLTYNTFLEFICFHLLTDLFSSFVQGPLKNAIDWASRPPNVWADKAAAIVSAAGGSGGARAQYHLRQIGVYLDLHFVNKPEYFLNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFTLRLQGIC
MWLLTYNTFLEFICFHLLTDLFSSFVQGPLKNAIDWASRPPNVWadkaaaivsaaggsggaraQYHLRQIGVYLDLHFVNKPEYFLNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFTLRLQGIC
*WLLTYNTFLEFICFHLLTDLFSSFVQGPLKNAIDWASRPPNVWADKAAAIVSAAGGSGGARAQYHLRQIGVYLDLHFVNKPEYFLNAFQPPAKF*************KLKAVLLALRAFTLRLQ***
MWLLTYNTFLEFICFHLLTDLFSSFVQGPLKNAIDWASRPPNVWADKAAAIVSAAGGSGGARAQYHLRQIGVYLDLHFVNKPEYFLNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFTLRLQGI*
MWLLTYNTFLEFICFHLLTDLFSSFVQGPLKNAIDWASRPPNVWADKAAAIVSAAGGSGGARAQYHLRQIGVYLDLHFVNKPEYFLNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFTLRLQGIC
MWLLTYNTFLEFICFHLLTDLFSSFVQGPLKNAIDWASRPPNVWADKAAAIVSAAGGSGGARAQYHLRQIGVYLDLHFVNKPEYFLNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFTLRLQGIC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWLLTYNTFLEFICFHLLTDLFSSFVQGPLKNAIDWASRPPNVWADKAAAIVSAAGGSGGARAQYHLRQIGVYLDLHFVNKPEYFLNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFTLRLQGIC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query128 2.2.26 [Sep-21-2011]
Q9LK88196 NADPH:quinone oxidoreduct yes no 0.789 0.515 0.762 4e-40
Q941Y8203 Probable NADPH:quinone ox yes no 0.882 0.556 0.663 1e-35
Q8H9D2194 NAD(P)H:quinone oxidoredu N/A no 0.921 0.608 0.694 3e-34
Q941Z0197 Probable NADPH:quinone ox no no 0.875 0.568 0.633 2e-33
P0AGE8188 Uncharacterized protein Y yes no 0.835 0.569 0.419 3e-12
P0AGE6188 Uncharacterized protein Y N/A no 0.835 0.569 0.419 3e-12
P0AGE7188 Uncharacterized protein Y N/A no 0.835 0.569 0.419 3e-12
>sp|Q9LK88|NQR_ARATH NADPH:quinone oxidoreductase OS=Arabidopsis thaliana GN=NQR PE=1 SV=1 Back     alignment and function desciption
 Score =  162 bits (411), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 90/101 (89%)

Query: 26  VQGPLKNAIDWASRPPNVWADKAAAIVSAAGGSGGARAQYHLRQIGVYLDLHFVNKPEYF 85
           V  PLKNA+DWASRPPNVWADK AAI+S  GG GG R+QYHLRQIGV+LDLHF+NKPE+ 
Sbjct: 95  VSAPLKNALDWASRPPNVWADKPAAIISTGGGFGGGRSQYHLRQIGVFLDLHFINKPEFT 154

Query: 86  LNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFTLRLQG 126
           LNAFQPP KFD++GNL+DE +KE+LK VLL+L+AFTLRLQG
Sbjct: 155 LNAFQPPQKFDAEGNLVDEVTKERLKQVLLSLQAFTLRLQG 195
The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 6EC: .EC: 5EC: .EC: 2
>sp|Q941Y8|NQR2_ORYSJ Probable NADPH:quinone oxidoreductase 2 OS=Oryza sativa subsp. japonica GN=Os01g0954000 PE=2 SV=1 Back     alignment and function description
>sp|Q8H9D2|NQR_SOLTU NAD(P)H:quinone oxidoreductase OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|Q941Z0|NQR1_ORYSJ Probable NADPH:quinone oxidoreductase 1 OS=Oryza sativa subsp. japonica GN=Os01g0953600 PE=2 SV=1 Back     alignment and function description
>sp|P0AGE8|YIEF_SHIFL Uncharacterized protein YieF OS=Shigella flexneri GN=yieF PE=3 SV=1 Back     alignment and function description
>sp|P0AGE6|YIEF_ECOLI Uncharacterized protein YieF OS=Escherichia coli (strain K12) GN=yieF PE=1 SV=1 Back     alignment and function description
>sp|P0AGE7|YIEF_ECO57 Uncharacterized protein YieF OS=Escherichia coli O157:H7 GN=yieF PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
224053250196 predicted protein [Populus trichocarpa] 0.804 0.525 0.825 1e-43
118481717196 unknown [Populus trichocarpa] 0.804 0.525 0.805 2e-42
255543969198 NADPH:quinone oxidoreductase, putative [ 0.804 0.520 0.776 1e-41
255543967195 NADPH:quinone oxidoreductase, putative [ 0.804 0.528 0.757 6e-41
357456791190 NADPH:quinone oxidoreductase [Medicago t 0.789 0.531 0.762 2e-40
357515109192 NADPH:quinone oxidoreductase [Medicago t 0.789 0.526 0.732 6e-40
388516309191 unknown [Medicago truncatula] 0.789 0.528 0.732 8e-40
357456793194 NADPH:quinone oxidoreductase [Medicago t 0.789 0.520 0.732 1e-39
225465847196 PREDICTED: NADPH:quinone oxidoreductase 0.789 0.515 0.782 2e-39
224075870196 predicted protein [Populus trichocarpa] 0.789 0.515 0.772 2e-39
>gi|224053250|ref|XP_002297737.1| predicted protein [Populus trichocarpa] gi|222844995|gb|EEE82542.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/103 (82%), Positives = 91/103 (88%)

Query: 26  VQGPLKNAIDWASRPPNVWADKAAAIVSAAGGSGGARAQYHLRQIGVYLDLHFVNKPEYF 85
           V GPLKNAIDWASRPPN WADKAAAIVSA G  GG RAQYHLRQIGVYLDLHF+NKPE++
Sbjct: 94  VTGPLKNAIDWASRPPNCWADKAAAIVSAGGSFGGGRAQYHLRQIGVYLDLHFINKPEFY 153

Query: 86  LNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFTLRLQGIC 128
           LNAF PPAKFDSDGNLID  SKE+LK VLL+L AFTLRL+G C
Sbjct: 154 LNAFAPPAKFDSDGNLIDPPSKERLKEVLLSLLAFTLRLKGQC 196

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|118481717|gb|ABK92798.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255543969|ref|XP_002513047.1| NADPH:quinone oxidoreductase, putative [Ricinus communis] gi|223548058|gb|EEF49550.1| NADPH:quinone oxidoreductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255543967|ref|XP_002513046.1| NADPH:quinone oxidoreductase, putative [Ricinus communis] gi|223548057|gb|EEF49549.1| NADPH:quinone oxidoreductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357456791|ref|XP_003598676.1| NADPH:quinone oxidoreductase [Medicago truncatula] gi|355487724|gb|AES68927.1| NADPH:quinone oxidoreductase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357515109|ref|XP_003627843.1| NADPH:quinone oxidoreductase [Medicago truncatula] gi|217075486|gb|ACJ86103.1| unknown [Medicago truncatula] gi|355521865|gb|AET02319.1| NADPH:quinone oxidoreductase [Medicago truncatula] gi|388504824|gb|AFK40478.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388516309|gb|AFK46216.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357456793|ref|XP_003598677.1| NADPH:quinone oxidoreductase [Medicago truncatula] gi|355487725|gb|AES68928.1| NADPH:quinone oxidoreductase [Medicago truncatula] Back     alignment and taxonomy information
>gi|225465847|ref|XP_002264859.1| PREDICTED: NADPH:quinone oxidoreductase [Vitis vinifera] gi|296087867|emb|CBI35123.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224075870|ref|XP_002304805.1| predicted protein [Populus trichocarpa] gi|222842237|gb|EEE79784.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
TAIR|locus:2086445196 NQR "AT3G27890" [Arabidopsis t 0.789 0.515 0.643 2.9e-32
UNIPROTKB|P0AGE6188 yieF "chromate reductase monom 0.835 0.569 0.339 2e-08
TAIR|locus:2086445 NQR "AT3G27890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 353 (129.3 bits), Expect = 2.9e-32, P = 2.9e-32
 Identities = 65/101 (64%), Positives = 76/101 (75%)

Query:    26 VQGPLKNAIDWASRPPNVWXXXXXXXXXXXXXXXXXXXQYHLRQIGVYLDLHFVNKPEYF 85
             V  PLKNA+DWASRPPNVW                   QYHLRQIGV+LDLHF+NKPE+ 
Sbjct:    95 VSAPLKNALDWASRPPNVWADKPAAIISTGGGFGGGRSQYHLRQIGVFLDLHFINKPEFT 154

Query:    86 LNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFTLRLQG 126
             LNAFQPP KFD++GNL+DE +KE+LK VLL+L+AFTLRLQG
Sbjct:   155 LNAFQPPQKFDAEGNLVDEVTKERLKQVLLSLQAFTLRLQG 195
GO:0008752 "FMN reductase activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=IEP;RCA
GO:0009651 "response to salt stress" evidence=IEP;RCA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006970 "response to osmotic stress" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
GO:0016045 "detection of bacterium" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0043900 "regulation of multi-organism process" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0050776 "regulation of immune response" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
UNIPROTKB|P0AGE6 yieF "chromate reductase monomer" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LK88NQR_ARATH1, ., 6, ., 5, ., 20.76230.78900.5153yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
pfam03358151 pfam03358, FMN_red, NADPH-dependent FMN reductase 1e-16
COG0431184 COG0431, COG0431, Predicted flavoprotein [General 3e-15
>gnl|CDD|217511 pfam03358, FMN_red, NADPH-dependent FMN reductase Back     alignment and domain information 
 Score = 70.7 bits (174), Expect = 1e-16
 Identities = 27/65 (41%), Positives = 29/65 (44%), Gaps = 2/65 (3%)

Query: 28  GPLKNAIDWASR-PPNVWADKAAAIVSAAGG-SGGARAQYHLRQIGVYLDLHFVNKPEYF 85
           G LKNAIDW SR        K  AIVS  GG SGG RA   LRQ+   L    V      
Sbjct: 86  GALKNAIDWLSRDGGKELRGKPVAIVSVGGGRSGGLRALEQLRQVLAELGAVVVPSGVVA 145

Query: 86  LNAFQ 90
           +    
Sbjct: 146 IGKAA 150

Length = 151
>gnl|CDD|223508 COG0431, COG0431, Predicted flavoprotein [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
TIGR02690219 resist_ArsH arsenical resistance protein ArsH. Mem 99.98
PRK10569191 NAD(P)H-dependent FMN reductase; Provisional 99.95
KOG4530199 consensus Predicted flavoprotein [General function 99.95
TIGR03567171 FMN_reduc_SsuE FMN reductase, SsuE family. Members 99.95
TIGR03566174 FMN_reduc_MsuE FMN reductase, MsuE subfamily. Memb 99.95
COG0431184 Predicted flavoprotein [General function predictio 99.94
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 99.82
PRK13556208 azoreductase; Provisional 99.79
PRK13555208 azoreductase; Provisional 99.72
PRK00170201 azoreductase; Reviewed 99.72
COG1182202 AcpD Acyl carrier protein phosphodiesterase [Lipid 99.7
PRK01355199 azoreductase; Reviewed 99.68
PRK03767200 NAD(P)H:quinone oxidoreductase; Provisional 99.63
TIGR01755197 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV. 99.58
PRK09739199 hypothetical protein; Provisional 99.57
PF02525199 Flavodoxin_2: Flavodoxin-like fold; InterPro: IPR0 99.4
COG0655207 WrbA Multimeric flavodoxin WrbA [General function 99.33
PRK04930184 glutathione-regulated potassium-efflux system anci 99.22
PRK00871176 glutathione-regulated potassium-efflux system anci 99.22
PRK06242150 flavodoxin; Provisional 99.15
PRK05569141 flavodoxin; Provisional 99.03
TIGR01753140 flav_short flavodoxin, short chain. Flavodoxins ar 98.89
PRK05568142 flavodoxin; Provisional 98.86
PRK06703151 flavodoxin; Provisional 98.77
PRK06756148 flavodoxin; Provisional 98.77
PRK11921394 metallo-beta-lactamase/flavodoxin domain-containin 98.72
PRK05452479 anaerobic nitric oxide reductase flavorubredoxin; 98.71
COG2249189 MdaB Putative NADPH-quinone reductase (modulator o 98.58
PRK06934221 flavodoxin; Provisional 98.56
PRK07308146 flavodoxin; Validated 98.47
PRK07116160 flavodoxin; Provisional 98.42
PRK09267169 flavodoxin FldA; Validated 98.37
TIGR01752167 flav_long flavodoxin, long chain. Flavodoxins are 98.31
PF12682156 Flavodoxin_4: Flavodoxin; PDB: 3EDO_B 3KLB_A. 98.16
PRK12359172 flavodoxin FldB; Provisional 97.95
COG0426388 FpaA Uncharacterized flavoproteins [Energy product 97.89
KOG3135203 consensus 1,4-benzoquinone reductase-like; Trp rep 97.82
PRK09004146 FMN-binding protein MioC; Provisional 97.78
PRK09271160 flavodoxin; Provisional 97.77
PF12724143 Flavodoxin_5: Flavodoxin domain 97.74
TIGR01754140 flav_RNR ribonucleotide reductase-associated flavo 97.64
PRK11104177 hemG protoporphyrinogen oxidase; Provisional 97.57
PF00258143 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This 97.12
PRK08105149 flavodoxin; Provisional 96.51
PF12641160 Flavodoxin_3: Flavodoxin domain 96.07
PRK05723151 flavodoxin; Provisional 95.26
PRK03600134 nrdI ribonucleotide reductase stimulatory protein; 95.0
PRK10953 600 cysJ sulfite reductase subunit alpha; Provisional 93.52
COG4635175 HemG Flavodoxin [Energy production and conversion 92.75
COG0716151 FldA Flavodoxins [Energy production and conversion 92.44
TIGR01931 597 cysJ sulfite reductase [NADPH] flavoprotein, alpha 92.0
TIGR00333125 nrdI ribonucleoside-diphosphate reductase 2, opero 82.55
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 81.41
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 80.99
PRK02551154 flavoprotein NrdI; Provisional 80.71
>TIGR02690 resist_ArsH arsenical resistance protein ArsH Back     alignment and domain information 
Probab=99.98  E-value=3.6e-32  Score=205.61  Aligned_cols=120  Identities=18%  Similarity=0.201  Sum_probs=107.4

Q ss_pred             HHHHHHHhcCeEEEEcccCCCCCcHHHHHHHHhhcCCC---CcCCCCeEEEEeecCCCChHHHHHHHHHhhhhcCceeec
Q 035766            4 LTYNTFLEFICFHLLTDLFSSFVQGPLKNAIDWASRPP---NVWADKAAAIVSAAGGSGGARAQYHLRQIGVYLDLHFVN   80 (128)
Q Consensus         4 ~~~~~i~~AD~ii~~tPeYn~~i~~~lKn~iD~l~~~~---~~~~~Kp~~~v~~sg~~gg~~a~~~L~~~l~~~g~~~~~   80 (128)
                      .+.+++++||++||+|||||++|||.|||+|||++++.   +.|.+||++++++||+.+|.+++.+||+++..++++++|
T Consensus        83 ~l~~~v~~ADgvii~TPEYn~sipg~LKNaiDwls~~~~~~~~~~~KpvaivgaSgg~~g~ra~~~LR~vl~~l~a~v~p  162 (219)
T TIGR02690        83 ELRQLSEWSEGQVWCSPERHGAITGSQKDQIDWIPLSVGPVRPTQGKTLAVMQVSGGSQSFNAVNILRRLGRWMRMPTIP  162 (219)
T ss_pred             HHHHHHHhCCEEEEeCCccccCcCHHHHHHHHhcccCcccccccCCCcEEEEEeCCcHhHHHHHHHHHHHHHHCCCcccc
Confidence            46789999999999999999999999999999999852   369999999999995556899999999999999999998


Q ss_pred             cceeeeccCCCCCccCCCCCCCCHHHHHHHHHHHHHHHHHHHHhhc
Q 035766           81 KPEYFLNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFTLRLQG  126 (128)
Q Consensus        81 ~~~~~i~~~~~~~~fd~~g~l~~~~~~~~l~~~~~~l~~~~~~~~~  126 (128)
                      . ++.++..  .+.||++|.+.|++.++++++++++|.+|++..+.
T Consensus       163 ~-~v~i~~a--~~~fd~~G~l~d~~~~~~l~~~l~~~~~~~~~~~~  205 (219)
T TIGR02690       163 N-QSSVAKA--FDEFDEAGRMKPSDYYDRVVDVMEELTKFTLLTRA  205 (219)
T ss_pred             c-hhhhhhh--HhhcCcCCCCCCHHHHHHHHHHHHHHHHHHHHhcc
Confidence            5 5666653  67799999999999999999999999999987653

Members of this protein family occur in arsenate resistance operons that include at least two different types of arsenate reductase. ArsH is not required for arsenate resistance in some systems. This family belongs to the larger family of NADPH-dependent FMN reductases (Pfam model pfam03358). The function of ArsH is not known.
>PRK10569 NAD(P)H-dependent FMN reductase; Provisional Back     alignment and domain information
>KOG4530 consensus Predicted flavoprotein [General function prediction only] Back     alignment and domain information
>TIGR03567 FMN_reduc_SsuE FMN reductase, SsuE family Back     alignment and domain information
>TIGR03566 FMN_reduc_MsuE FMN reductase, MsuE subfamily Back     alignment and domain information
>COG0431 Predicted flavoprotein [General function prediction only] Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information
>PRK13556 azoreductase; Provisional Back     alignment and domain information
>PRK13555 azoreductase; Provisional Back     alignment and domain information
>PRK00170 azoreductase; Reviewed Back     alignment and domain information
>COG1182 AcpD Acyl carrier protein phosphodiesterase [Lipid metabolism] Back     alignment and domain information
>PRK01355 azoreductase; Reviewed Back     alignment and domain information
>PRK03767 NAD(P)H:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR01755 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV Back     alignment and domain information
>PRK09739 hypothetical protein; Provisional Back     alignment and domain information
>PF02525 Flavodoxin_2: Flavodoxin-like fold; InterPro: IPR003680 This family consists of a domain with a flavodoxin-like fold Back     alignment and domain information
>COG0655 WrbA Multimeric flavodoxin WrbA [General function prediction only] Back     alignment and domain information
>PRK04930 glutathione-regulated potassium-efflux system ancillary protein KefG; Provisional Back     alignment and domain information
>PRK00871 glutathione-regulated potassium-efflux system ancillary protein KefF; Provisional Back     alignment and domain information
>PRK06242 flavodoxin; Provisional Back     alignment and domain information
>PRK05569 flavodoxin; Provisional Back     alignment and domain information
>TIGR01753 flav_short flavodoxin, short chain Back     alignment and domain information
>PRK05568 flavodoxin; Provisional Back     alignment and domain information
>PRK06703 flavodoxin; Provisional Back     alignment and domain information
>PRK06756 flavodoxin; Provisional Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>COG2249 MdaB Putative NADPH-quinone reductase (modulator of drug activity B) [General function prediction only] Back     alignment and domain information
>PRK06934 flavodoxin; Provisional Back     alignment and domain information
>PRK07308 flavodoxin; Validated Back     alignment and domain information
>PRK07116 flavodoxin; Provisional Back     alignment and domain information
>PRK09267 flavodoxin FldA; Validated Back     alignment and domain information
>TIGR01752 flav_long flavodoxin, long chain Back     alignment and domain information
>PF12682 Flavodoxin_4: Flavodoxin; PDB: 3EDO_B 3KLB_A Back     alignment and domain information
>PRK12359 flavodoxin FldB; Provisional Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>KOG3135 consensus 1,4-benzoquinone reductase-like; Trp repressor binding protein-like/protoplast-secreted protein [General function prediction only] Back     alignment and domain information
>PRK09004 FMN-binding protein MioC; Provisional Back     alignment and domain information
>PRK09271 flavodoxin; Provisional Back     alignment and domain information
>PF12724 Flavodoxin_5: Flavodoxin domain Back     alignment and domain information
>TIGR01754 flav_RNR ribonucleotide reductase-associated flavodoxin, putative Back     alignment and domain information
>PRK11104 hemG protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PF00258 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This domain is found in a number of proteins including flavodoxin and nitric-oxide synthase Back     alignment and domain information
>PRK08105 flavodoxin; Provisional Back     alignment and domain information
>PF12641 Flavodoxin_3: Flavodoxin domain Back     alignment and domain information
>PRK05723 flavodoxin; Provisional Back     alignment and domain information
>PRK03600 nrdI ribonucleotide reductase stimulatory protein; Reviewed Back     alignment and domain information
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional Back     alignment and domain information
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] Back     alignment and domain information
>COG0716 FldA Flavodoxins [Energy production and conversion] Back     alignment and domain information
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component Back     alignment and domain information
>TIGR00333 nrdI ribonucleoside-diphosphate reductase 2, operon protein nrdI Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK02551 flavoprotein NrdI; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
1rtt_A193 Crystal Structure Determination Of A Putative Nadh- 9e-11
3svl_A193 Structural Basis Of The Improvement Of Chrr - A Mul 3e-08
3s2y_A199 Crystal Structure Of A ChromateURANIUM REDUCTASE FR 1e-05
4h6p_A199 Crystal Structure Of A Putative Chromate Reductase 6e-05
4hs4_A199 Crystal Structure Of A Putative Chromate Reductase 1e-04
>pdb|1RTT|A Chain A, Crystal Structure Determination Of A Putative Nadh-Dependent Reductase Using Sulfur Anomalous Signal Length = 193 Back     alignment and structure 
Iteration: 1

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 4/85 (4%)
Query: 26  VQGPLKNAIDWASRPPN--VWXXXXXXXXXXXXXXXXXXXQYHLRQIGVYLDLHFVNKPE 83
           + G LKNAIDWASRPP                        QYHLRQ  V+LD+H +NKPE
Sbjct: 87  MAGVLKNAIDWASRPPEQPFSGKPAAILGASAGRFGTARAQYHLRQTLVFLDVHPLNKPE 146
Query: 84  YFLNAFQPPAKFDSDGNLIDEESKE 108
             +++ Q    FD+ G L+D++++E
Sbjct: 147 VMISSAQ--NAFDAQGRLLDDKARE 169
>pdb|3SVL|A Chain A, Structural Basis Of The Improvement Of Chrr - A Multi-Purpose Enzyme Length = 193 Back     alignment and structure
>pdb|3S2Y|A Chain A, Crystal Structure Of A ChromateURANIUM REDUCTASE FROM Gluconacetobacter Hansenii Length = 199 Back     alignment and structure
>pdb|4H6P|A Chain A, Crystal Structure Of A Putative Chromate Reductase From Gluconacetobacter Hansenii, Gh-Chrr, Containing A R101a Substitution. Length = 199 Back     alignment and structure
>pdb|4HS4|A Chain A, Crystal Structure Of A Putative Chromate Reductase From Gluconacetobacter Hansenii, Gh-Chrr, Containing A Y129n Substitution. Length = 199 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
1rtt_A193 Conserved hypothetical protein; protein structure 1e-33
3svl_A193 Protein YIEF; E. coli CHRR enzyme, chromate biorem 1e-33
3fvw_A192 Putative NAD(P)H-dependent FMN reductase; Q8DWD8_s 3e-33
3s2y_A199 Chromate reductase; uranium reductase, oxidoreduct 5e-33
3gfs_A174 FMN-dependent NADPH-azoreductase; flavoproteins, q 2e-32
2q62_A247 ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi 7e-31
2fzv_A279 Putative arsenical resistance protein; flavin bind 5e-28
1t0i_A191 YLR011WP; FMN binding protein, flavodoxin, azoredu 3e-27
2vzf_A197 NADH-dependent FMN reductase; oxidoreductase; 2.50 1e-16
3k1y_A191 Oxidoreductase; structural genomics, PSI-2, protei 3e-13
>1rtt_A Conserved hypothetical protein; protein structure initiative, SAD with sulfur, putative REDU PSI; 1.28A {Pseudomonas aeruginosa} SCOP: c.23.5.4 PDB: 1x77_A* Length = 193 Back     alignment and structure
 Score =  115 bits (289), Expect = 1e-33
 Identities = 46/96 (47%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 28  GPLKNAIDWASRPP-NVWADKAAAIVSAAGGS-GGARAQYHLRQIGVYLDLHFVNKPEYF 85
           G LKNAIDWASRPP   ++ K AAI+ A+ G  G ARAQYHLRQ  V+LD+H +NKPE  
Sbjct: 89  GVLKNAIDWASRPPEQPFSGKPAAILGASAGRFGTARAQYHLRQTLVFLDVHPLNKPEVM 148

Query: 86  LNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFT 121
           +++      FD+ G L+D++++E ++  L AL+ + 
Sbjct: 149 ISSA--QNAFDAQGRLLDDKARELIQQQLQALQLWV 182
>3svl_A Protein YIEF; E. coli CHRR enzyme, chromate bioremediation, tetramer role, mutant enzymes, oxidoreductase; HET: FMN; 2.20A {Escherichia coli} Length = 193 Back     alignment and structure
>3fvw_A Putative NAD(P)H-dependent FMN reductase; Q8DWD8_strmu, SMR99, NESG, structural genomics, PSI-2, protein structure initiative; 2.30A {Streptococcus mutans} Length = 192 Back     alignment and structure
>3s2y_A Chromate reductase; uranium reductase, oxidoreductase; HET: FMN PG4; 2.24A {Gluconacetobacter hansenii} Length = 199 Back     alignment and structure
>3gfs_A FMN-dependent NADPH-azoreductase; flavoproteins, quinone reductase, flavodoxin, oligomerization, flavoprotein, oxidoreductase; HET: FMN; 2.10A {Bacillus subtilis} PDB: 1nni_1* 2gsw_A* 3gfr_A* 3gfq_A* Length = 174 Back     alignment and structure
>2q62_A ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobium meliloti} Length = 247 Back     alignment and structure
>2fzv_A Putative arsenical resistance protein; flavin binding protein, structural genomics, PSI, protein ST initiative; 1.70A {Shigella flexneri 2A} SCOP: c.23.5.4 Length = 279 Back     alignment and structure
>1t0i_A YLR011WP; FMN binding protein, flavodoxin, azoreductase, oxidoreductase; HET: FMN; 2.00A {Saccharomyces cerevisiae} SCOP: c.23.5.4 Length = 191 Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Length = 197 Back     alignment and structure
>3k1y_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, CDR100D; 2.50A {Corynebacterium diphtheriae} PDB: 3k20_A Length = 191 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
3u7r_A190 NADPH-dependent FMN reductase; alpha/beta twisted 100.0
4hs4_A199 Chromate reductase; triple-layered, A/B/A structur 100.0
3svl_A193 Protein YIEF; E. coli CHRR enzyme, chromate biorem 99.97
3s2y_A199 Chromate reductase; uranium reductase, oxidoreduct 99.92
2q62_A247 ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi 99.95
2fzv_A279 Putative arsenical resistance protein; flavin bind 99.95
3fvw_A192 Putative NAD(P)H-dependent FMN reductase; Q8DWD8_s 99.93
3gfs_A174 FMN-dependent NADPH-azoreductase; flavoproteins, q 99.93
3k1y_A191 Oxidoreductase; structural genomics, PSI-2, protei 99.93
1rtt_A193 Conserved hypothetical protein; protein structure 99.92
2vzf_A197 NADH-dependent FMN reductase; oxidoreductase; 2.50 99.89
1t0i_A191 YLR011WP; FMN binding protein, flavodoxin, azoredu 99.84
2hpv_A208 FMN-dependent NADH-azoreductase; structural genomi 99.72
3p0r_A211 Azoreductase; structural genomics, center for stru 99.72
3r6w_A212 FMN-dependent NADH-azoreductase 1; nitrofurazone, 99.71
1sqs_A242 Conserved hypothetical protein; structural genomic 99.71
1t5b_A201 Acyl carrier protein phosphodiesterase; structural 99.7
2zki_A199 199AA long hypothetical Trp repressor binding prot 99.7
3u7i_A223 FMN-dependent NADH-azoreductase 1; structural geno 99.69
3lcm_A196 SMU.1420, putative oxidoreductase; NADPH:quinone o 99.69
2a5l_A200 Trp repressor binding protein WRBA; APC5760, PA094 99.69
1rli_A184 Trp repressor binding protein; structural genomics 99.65
1ydg_A211 Trp repressor binding protein WRBA; tetramer, stru 99.64
2amj_A204 Modulator of drug activity B; oxidoreductase, mena 99.63
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 99.63
3f2v_A192 General stress protein 14; alpha-beta protein., st 99.63
3b6i_A198 Flavoprotein WRBA; flavoproteins, NADH:quinone oxi 99.61
2ark_A188 Flavodoxin; FMN, structural genomics, PSI, structu 99.6
1d4a_A273 DT-diaphorase, quinone reductase; flavoprotein, ro 99.58
3d7n_A193 Flavodoxin, WRBA-like protein; structural genomics 99.57
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 99.54
3ha2_A177 NADPH-quinone reductase; structural genomics, PSI- 99.54
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 99.48
3tem_A228 Ribosyldihydronicotinamide dehydrogenase [quinone; 99.47
3rpe_A218 MDAB, modulator of drug activity B; structural gen 99.41
2fz5_A137 Flavodoxin; alpha/beta doubly-wound topology, non- 99.34
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductas 99.31
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.18
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 99.12
4gi5_A280 Quinone reductase; protein structure initiative, F 99.11
1czn_A169 Flavodoxin; FMN binding, redox potential, electron 99.1
5nul_A138 Flavodoxin; electron transport, flavoprotein, FMN; 99.07
3f6r_A148 Flavodoxin; FMN binding, oxidized, electron transp 99.03
1obo_A169 Flavodoxin; electron transfer, flavoprotein, elect 99.02
3fni_A159 Putative diflavin flavoprotein A 3; alpha-beta pro 99.02
1f4p_A147 Flavodoxin; electron transport, flavoprotein, FMN, 98.99
3klb_A162 Putative flavoprotein; structural genomi center fo 98.86
1ag9_A175 Flavodoxin; electron transport, reductive activati 98.84
2wc1_A182 Flavodoxin; electron transport, flavoprotein; HET: 98.81
4ici_A171 Putative flavoprotein; PF12682 family protein, fla 98.75
1yob_A179 Flavodoxin 2, flavodoxin II; alpha-beta fold, non- 98.65
3edo_A151 Flavoprotein, putative Trp repressor binding prote 98.55
4dik_A410 Flavoprotein; TM0755, electron transport, DI-iron 98.53
2fcr_A173 Flavodoxin; electron transport; HET: FMN; 1.80A {C 98.37
1ykg_A167 SIR-FP, sulfite reductase [NADPH] flavoprotein alp 98.15
2bmv_A164 Flavodoxin; electron transport, flavoprotein, FMN, 97.92
1bvy_F191 Protein (cytochrome P450 BM-3); fatty acid monooxy 97.89
2hna_A147 Protein MIOC, flavodoxin; alpha-beta sandwich, fla 97.7
3hr4_A219 Nitric oxide synthase, inducible; inducible nitric 97.28
2xod_A119 NRDI protein, NRDI; flavoprotein, redox protein, r 96.71
2bpo_A 682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 96.4
3qe2_A 618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 96.08
1rlj_A139 NRDI protein; flavoprotein, FMN, thioredoxin, alph 94.92
3n3a_C153 Protein NRDI; ribonucleotide reductase, four-helix 94.68
1tll_A 688 Nitric-oxide synthase, brain; reductase module, FM 93.53
>3u7r_A NADPH-dependent FMN reductase; alpha/beta twisted open-sheet, lavoprotein, quinone reductas oxidoreductase; HET: MSE FNR 2PE; 1.40A {Paracoccus denitrificans} Back     alignment and structure
Probab=100.00  E-value=3.1e-36  Score=222.36  Aligned_cols=120  Identities=26%  Similarity=0.390  Sum_probs=111.5

Q ss_pred             hHHHHHHHhcCeEEEEcccCCCCCcHHHHHHHHhhcCCC--CcCCCCeEEEEeec-CCCChHHHHHHHHHhhhhcCceee
Q 035766            3 LLTYNTFLEFICFHLLTDLFSSFVQGPLKNAIDWASRPP--NVWADKAAAIVSAA-GGSGGARAQYHLRQIGVYLDLHFV   79 (128)
Q Consensus         3 ~~~~~~i~~AD~ii~~tPeYn~~i~~~lKn~iD~l~~~~--~~~~~Kp~~~v~~s-g~~gg~~a~~~L~~~l~~~g~~~~   79 (128)
                      ..+.++|++||++||+|||||+++||.|||+|||++|+.  ++|.|||++++++| |..||.+++.+||++|.++|+.++
T Consensus        59 ~~l~~~i~~aD~~ii~tPeYn~s~pg~LKn~iDwlsr~~~~~~~~gKpv~~v~~S~G~~Gg~~a~~~Lr~vl~~lg~~v~  138 (190)
T 3u7r_A           59 LRLKDRIEHSDAVLAITPEYNRSYPGMIKNAIDWATRPYGQNSWKGKPAAVIGTSPGVIGAALAQARLKNDLLHVGTVMM  138 (190)
T ss_dssp             HHHHHHHHTSSEEEEECCCBTTBCCHHHHHHHHHHHCSTTCCTTTTCEEEEEEEESSTTTTHHHHHHHHHHHHTTTCEEC
T ss_pred             HHHHHHHHhCCcEEEechhhcccCCHHHHHHHHHhcccccCCccCCCEEEEEEeCCchhhHHHHHHHHHHHHHHcCCEEc
Confidence            457899999999999999999999999999999999853  78999999999999 888999999999999999999999


Q ss_pred             ccceeeeccCCCCCccCCCCCCCCHHHHHHHHHHHHHHHHHHHHh
Q 035766           80 NKPEYFLNAFQPPAKFDSDGNLIDEESKEKLKAVLLALRAFTLRL  124 (128)
Q Consensus        80 ~~~~~~i~~~~~~~~fd~~g~l~~~~~~~~l~~~~~~l~~~~~~~  124 (128)
                      +.|+++++..  .+.||++|.++|++++++|++++++|++|+++.
T Consensus       139 ~~p~~~i~~~--~~~fd~~G~l~de~~~~~l~~~~~~~~~~i~~~  181 (190)
T 3u7r_A          139 SMPEAYIQWH--AEAYAADGSVTDEKTAKFLQGFVDAFVDWIEKH  181 (190)
T ss_dssp             CCSCCEEECC--GGGBCTTSCBCSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cCCEEEEecc--HhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHc
Confidence            8888888764  789999999999999999999999999999874
>4hs4_A Chromate reductase; triple-layered, A/B/A structure, NAD(P)H-dependent FMN reduc oxidoreductase; HET: FMN; 2.10A {Gluconacetobacter hansenii} PDB: 3s2y_A* 4h6p_A* Back     alignment and structure
>3svl_A Protein YIEF; E. coli CHRR enzyme, chromate bioremediation, tetramer role, mutant enzymes, oxidoreductase; HET: FMN; 2.20A {Escherichia coli} Back     alignment and structure
>3s2y_A Chromate reductase; uranium reductase, oxidoreductase; HET: FMN PG4; 2.24A {Gluconacetobacter hansenii} Back     alignment and structure
>2q62_A ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>2fzv_A Putative arsenical resistance protein; flavin binding protein, structural genomics, PSI, protein ST initiative; 1.70A {Shigella flexneri 2A} SCOP: c.23.5.4 Back     alignment and structure
>3fvw_A Putative NAD(P)H-dependent FMN reductase; Q8DWD8_strmu, SMR99, NESG, structural genomics, PSI-2, protein structure initiative; 2.30A {Streptococcus mutans} Back     alignment and structure
>3gfs_A FMN-dependent NADPH-azoreductase; flavoproteins, quinone reductase, flavodoxin, oligomerization, flavoprotein, oxidoreductase; HET: FMN; 2.10A {Bacillus subtilis} SCOP: c.23.5.4 PDB: 1nni_1* 2gsw_A* 3gfr_A* 3gfq_A* Back     alignment and structure
>3k1y_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, CDR100D; 2.50A {Corynebacterium diphtheriae} PDB: 3k20_A Back     alignment and structure
>1rtt_A Conserved hypothetical protein; protein structure initiative, SAD with sulfur, putative REDU PSI; 1.28A {Pseudomonas aeruginosa} SCOP: c.23.5.4 PDB: 1x77_A* Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Back     alignment and structure
>1t0i_A YLR011WP; FMN binding protein, flavodoxin, azoreductase, oxidoreductase; HET: FMN; 2.00A {Saccharomyces cerevisiae} SCOP: c.23.5.4 Back     alignment and structure
>2hpv_A FMN-dependent NADH-azoreductase; structural genomics, PS protein structure initiative, southeast collaboratory for S genomics, secsg; HET: FMN; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3p0r_A Azoreductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.80A {Bacillus anthracis} Back     alignment and structure
>3r6w_A FMN-dependent NADH-azoreductase 1; nitrofurazone, P. aeruginosa, nitroreductase, flavodoxin, oxidoreductase; HET: FMN NFZ; 2.08A {Pseudomonas aeruginosa} PDB: 3lt5_A* 2v9c_A* 3keg_A* Back     alignment and structure
>1sqs_A Conserved hypothetical protein; structural genomics, alpha beta protein, PSI, protein struct initiative; HET: TLA; 1.50A {Streptococcus pneumoniae} SCOP: c.23.5.5 PDB: 2oys_A* Back     alignment and structure
>1t5b_A Acyl carrier protein phosphodiesterase; structural genomics, FMN, alpha/beta/alpha sandwich, PSI, protein structure initiative; HET: FMN; 1.40A {Salmonella typhimurium} SCOP: c.23.5.3 PDB: 1tik_A 2z98_A* 2d5i_A* 1v4b_A* 2z9b_A* 2z9c_A* 2z9d_A* Back     alignment and structure
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>3u7i_A FMN-dependent NADH-azoreductase 1; structural genomics, the center for structural genomics of I diseases, csgid, oxidoreductase; HET: MSE; 1.75A {Bacillus anthracis} Back     alignment and structure
>3lcm_A SMU.1420, putative oxidoreductase; NADPH:quinone oxidoreductase, MDAB; HET: FAD NAP; 1.80A {Streptococcus mutans} PDB: 4f8y_A* Back     alignment and structure
>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* Back     alignment and structure
>1rli_A Trp repressor binding protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.80A {Bacillus subtilis} SCOP: c.23.5.6 Back     alignment and structure
>1ydg_A Trp repressor binding protein WRBA; tetramer, structural genomics, PSI, protein structure initiative; 2.00A {Deinococcus radiodurans} SCOP: c.23.5.8 PDB: 1yrh_A* Back     alignment and structure
>2amj_A Modulator of drug activity B; oxidoreductase, menadione, DT-diaphorase, montreal-kingston structural genomics initiative, BSGI; 1.80A {Escherichia coli} PDB: 2b3d_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3f2v_A General stress protein 14; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: FMN; 2.00A {Treponema denticola} Back     alignment and structure
>3b6i_A Flavoprotein WRBA; flavoproteins, NADH:quinone oxidoreductase, FMN; HET: FMN 15P; 1.66A {Escherichia coli} PDB: 2r96_A* 2r97_A 2rg1_A* 3b6j_A* 3b6k_A* 3b6m_A* Back     alignment and structure
>2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8 Back     alignment and structure
>1d4a_A DT-diaphorase, quinone reductase; flavoprotein, rossman fold, oxidoreductase; HET: FAD; 1.70A {Homo sapiens} SCOP: c.23.5.3 PDB: 1dxo_A* 1gg5_A* 1kbo_A* 1kbq_A* 2f1o_A* 3jsx_A* 1h69_A* 1h66_A* 1qbg_A* 1dxq_A* 1qrd_A* Back     alignment and structure
>3d7n_A Flavodoxin, WRBA-like protein; structural genomics, PSI, MCS protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens} Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>3ha2_A NADPH-quinone reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics, consortium, NESG; HET: MSE; 1.80A {Pediococcus pentosaceus atcc 25745} Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>3tem_A Ribosyldihydronicotinamide dehydrogenase [quinone; oxidoreductase-oxidoreductase inhibitor complex; HET: FAD 6A1 IMD; 1.45A {Homo sapiens} SCOP: c.23.5.3 PDB: 3te7_A* 3tzb_A* 3fw1_A* 2qwx_A* 1zx1_A* 3g5m_A* 3gam_A* 3ovm_A* 3owh_A* 3owx_A* 3ox1_A* 3ox2_A* 3ox3_A* 1sg0_A* 1qr2_A* 1xi2_A* 2qmy_A* 2qmz_A* 2qr2_A* 2qx4_A* ... Back     alignment and structure
>3rpe_A MDAB, modulator of drug activity B; structural genomics, center for structural genomics of infec diseases, csgid, flavodoxin-like fold; HET: FAD; 1.10A {Yersinia pestis} Back     alignment and structure
>2fz5_A Flavodoxin; alpha/beta doubly-wound topology, non-covalently bound FMN, electron transport; HET: FNR; NMR {Megasphaera elsdenii} SCOP: c.23.5.1 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>4gi5_A Quinone reductase; protein structure initiative, FAD bound, structural genomics, PSI-biology; HET: FAD; 1.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1czn_A Flavodoxin; FMN binding, redox potential, electron transport; HET: FMN; 1.70A {Synechococcus elongatus} SCOP: c.23.5.1 PDB: 1czl_A* 1czu_A* 1d04_A* 1ofv_A* 1czr_A* 1czk_A* 1czo_A* 1czh_A* 1d03_A* Back     alignment and structure
>5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A* Back     alignment and structure
>3f6r_A Flavodoxin; FMN binding, oxidized, electron transport, flavoprotein, FMN, transport; HET: FMN; 2.00A {Desulfovibrio desulfuricans} SCOP: c.23.5.0 PDB: 3f6s_A* 3f90_A* 3kap_A* 3kaq_A* Back     alignment and structure
>1obo_A Flavodoxin; electron transfer, flavoprotein, electron transport; HET: FMN; 1.2A {Anabaena SP} SCOP: c.23.5.1 PDB: 2v5v_A* 1dx9_A 1rcf_A* 1flv_A* 1obv_A* 2v5u_A* 1ftg_A 1qhe_A 2kqu_A 3esy_A* 3esz_A* 3esx_A* Back     alignment and structure
>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A Back     alignment and structure
>1f4p_A Flavodoxin; electron transport, flavoprotein, FMN, 3D-STRCTURE, anisotropic refinement, redox protein; HET: FMN; 1.30A {Desulfovibrio vulgaris} SCOP: c.23.5.1 PDB: 1bu5_A* 1c7f_A* 1c7e_A* 1akr_A* 1fx1_A* 1akt_A* 1akq_A* 1aku_A* 1akv_A* 1azl_A* 1j8q_A* 2fx2_A* 3fx2_A* 4fx2_A* 5fx2_A* 1akw_A* 1i1o_A* 1wsw_A* 1wsb_A* 1xyv_A* ... Back     alignment and structure
>3klb_A Putative flavoprotein; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: FMN; 1.75A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1ag9_A Flavodoxin; electron transport, reductive activation; HET: FMN BTB; 1.80A {Escherichia coli} SCOP: c.23.5.1 PDB: 1ahn_A* Back     alignment and structure
>2wc1_A Flavodoxin; electron transport, flavoprotein; HET: FMN; 2.17A {Rhodobacter capsulatus} Back     alignment and structure
>4ici_A Putative flavoprotein; PF12682 family protein, flavodoxin_4, structural genomics, J center for structural genomics, JCSG; HET: MSE FMN EPE; 1.40A {Bacteroides eggerthii} Back     alignment and structure
>1yob_A Flavodoxin 2, flavodoxin II; alpha-beta fold, non- covalently bound FMN, electron transport; HET: FMN; 2.25A {Azotobacter vinelandii} SCOP: c.23.5.1 Back     alignment and structure
>3edo_A Flavoprotein, putative Trp repressor binding protein; YP_193882.1, flavoprotein in complex with FMN, structural genomics; HET: MSE FMN; 1.20A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>2fcr_A Flavodoxin; electron transport; HET: FMN; 1.80A {Chondrus crispus} SCOP: c.23.5.1 Back     alignment and structure
>1ykg_A SIR-FP, sulfite reductase [NADPH] flavoprotein alpha- component; electron transport; HET: FMN; NMR {Escherichia coli} SCOP: c.23.5.2 Back     alignment and structure
>2bmv_A Flavodoxin; electron transport, flavoprotein, FMN, transport protein; 2.11A {Helicobacter pylori} PDB: 2w5u_A* 1fue_A* Back     alignment and structure
>1bvy_F Protein (cytochrome P450 BM-3); fatty acid monooxygenase, hemoprotein, flavoprotein, electron transfer, oxidoreductase; HET: HEM FMN; 2.03A {Bacillus megaterium} SCOP: c.23.5.1 Back     alignment and structure
>2hna_A Protein MIOC, flavodoxin; alpha-beta sandwich, flavodoxin fold, electron transport; NMR {Escherichia coli} PDB: 2hnb_A Back     alignment and structure
>3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, CALM binding, FAD, FMN, heme, iron, metal-binding, NADP, oxidore phosphoprotein; HET: FMN; 2.50A {Homo sapiens} Back     alignment and structure
>2xod_A NRDI protein, NRDI; flavoprotein, redox protein, ribonucleotide reductase; HET: FMN; 0.96A {Bacillus anthracis} PDB: 2xoe_A* 2x2o_A* 2x2p_A* Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Back     alignment and structure
>1rlj_A NRDI protein; flavoprotein, FMN, thioredoxin, alpha/beta/alpha sandwich, structural genomics, PSI, protein structure initiative; HET: FMN; 2.00A {Bacillus subtilis} SCOP: c.23.5.7 Back     alignment and structure
>3n3a_C Protein NRDI; ribonucleotide reductase, four-helix bundle, dimanganese CLU flavoprotein, oxidoreductase; HET: FMN; 1.99A {Escherichia coli} PDB: 3n39_C* 3n3b_C* Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 128
d1rtta_174 c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudom 7e-22
d2fzva1233 c.23.5.4 (A:1-233) Putative arsenical resistance p 2e-15
d1nni1_171 c.23.5.4 (1:) Azobenzene reductase {Bacillus subti 6e-14
d1t0ia_185 c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker 1e-12
d1sqsa_232 c.23.5.5 (A:) Hypothetical protein SP1951 {(Strept 5e-09
>d1rtta_ c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudomonas aeruginosa [TaxId: 287]} Length = 174 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Flavoproteins
family: NADPH-dependent FMN reductase
domain: Hypothetical protein PA1204
species: Pseudomonas aeruginosa [TaxId: 287]

 Score = 83.2 bits (205), Expect = 7e-22
 Identities = 47/115 (40%), Positives = 69/115 (60%), Gaps = 4/115 (3%)

Query: 6   YNTFLEFICFHLLTDLFSSFVQGPLKNAIDWASR-PPNVWADKAAAIVSAAGGSGG-ARA 63
                        T  ++  + G LKNAIDWASR P   ++ K AAI+ A+ G  G ARA
Sbjct: 61  REQIRAADALLFATPEYNYSMAGVLKNAIDWASRPPEQPFSGKPAAILGASAGRFGTARA 120

Query: 64  QYHLRQIGVYLDLHFVNKPEYFLNAFQPPAKFDSDGNLIDEESKEKLKAVLLALR 118
           QYHLRQ  V+LD+H +NKPE  +++ Q    FD+ G L+D++++E ++  L AL+
Sbjct: 121 QYHLRQTLVFLDVHPLNKPEVMISSAQ--NAFDAQGRLLDDKARELIQQQLQALQ 173
>d2fzva1 c.23.5.4 (A:1-233) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]} Length = 233 Back     information, alignment and structure
>d1nni1_ c.23.5.4 (1:) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]} Length = 171 Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 185 Back     information, alignment and structure
>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]} Length = 232 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d1rtta_174 Hypothetical protein PA1204 {Pseudomonas aeruginos 99.97
d2fzva1233 Putative arsenical resistance protein {Shigella fl 99.96
d1nni1_171 Azobenzene reductase {Bacillus subtilis [TaxId: 14 99.96
d1t0ia_185 Hypothetical protein Ylr011wp {Baker's yeast (Sacc 99.93
d1sqsa_232 Hypothetical protein SP1951 {(Streptococcus pneumo 99.81
d1rlia_179 Hypothetical protein YwqN {Bacillus subtilis [TaxI 99.71
d2z98a1200 ACP phosphodiesterase AcpD {Escherichia coli [TaxI 99.7
d1ydga_201 Trp repressor binding protein WrbA {Deinococcus ra 99.5
d2qwxa1230 Quinone reductase type 2 (menadione reductase) {Hu 99.49
d2arka1184 Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} 99.48
d1d4aa_273 NAD(P)H:quinone reductase {Human (Homo sapiens) [T 99.34
d2a5la1196 Trp repressor binding protein WrbA {Pseudomonas ae 99.28
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 99.24
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 99.21
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 98.99
d5nula_138 Flavodoxin {Clostridium beijerinckii [TaxId: 1520] 98.53
d2fz5a1137 Flavodoxin {Megasphaera elsdenii [TaxId: 907]} 98.49
d1czna_169 Flavodoxin {Synechococcus elongatus PCC 7942 [TaxI 97.86
d1ag9a_175 Flavodoxin {Escherichia coli [TaxId: 562]} 97.7
d1oboa_169 Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 11 97.67
d1f4pa_147 Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} 97.42
d2fcra_173 Flavodoxin {Chondrus crispus [TaxId: 2769]} 97.37
d1yoba1179 Flavodoxin {Azotobacter vinelandii [TaxId: 354]} 97.22
d1ykga1146 Sulfite reductase alpha-component CysJ N-terminal 96.7
d1bvyf_152 FMN-binding domain of the cytochrome P450bm-3 {Bac 96.09
d1ja1a2177 NADPH-cytochrome p450 reductase, N-terminal domain 95.48
d1fuea_163 Flavodoxin {Helicobacter pylori [TaxId: 210]} 94.59
d1rlja_135 Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423] 91.46
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 89.55
d1tlla2202 Nitric oxide (NO) synthase FMN domain {Rat (Rattus 88.84
>d1rtta_ c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Flavoproteins
family: NADPH-dependent FMN reductase
domain: Hypothetical protein PA1204
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.97  E-value=1.7e-31  Score=192.14  Aligned_cols=113  Identities=42%  Similarity=0.625  Sum_probs=103.4

Q ss_pred             hHHHHHHHhcCeEEEEcccCCCCCcHHHHHHHHhhcCCC-CcCCCCeEEEEeec-CCCChHHHHHHHHHhhhhcCceeec
Q 035766            3 LLTYNTFLEFICFHLLTDLFSSFVQGPLKNAIDWASRPP-NVWADKAAAIVSAA-GGSGGARAQYHLRQIGVYLDLHFVN   80 (128)
Q Consensus         3 ~~~~~~i~~AD~ii~~tPeYn~~i~~~lKn~iD~l~~~~-~~~~~Kp~~~v~~s-g~~gg~~a~~~L~~~l~~~g~~~~~   80 (128)
                      ..+.+++.+||+|||+|||||+++|+.|||+|||++++. ..|.|||++++++| |..|+.++..+||.++.++|++++|
T Consensus        58 ~~~~~~i~~aD~iii~sP~y~~s~~~~lKn~iD~l~~~~~~~~~gK~~~~i~~sgG~~~~~~~~~~l~~~l~~~g~~~i~  137 (174)
T d1rtta_          58 ERFREQIRAADALLFATPEYNYSMAGVLKNAIDWASRPPEQPFSGKPAAILGASAGRFGTARAQYHLRQTLVFLDVHPLN  137 (174)
T ss_dssp             HHHHHHHHHCSEEEEECCEETTEECHHHHHHHHHHTCSSSCTTTTCEEEEEEECSSTTTTHHHHHHHHHHHHHHTCEECC
T ss_pred             HHHHHHhhcCCeEEEEccchhccccHHHHHHHHHHhcccccccCCCEEEEEEECCCccchHHHHHHHHHHHHHCCCEEcC
Confidence            357899999999999999999999999999999998754 78999999999999 6678899999999999999999998


Q ss_pred             cceeeeccCCCCCccCCCCCCCCHHHHHHHHHHHHHH
Q 035766           81 KPEYFLNAFQPPAKFDSDGNLIDEESKEKLKAVLLAL  117 (128)
Q Consensus        81 ~~~~~i~~~~~~~~fd~~g~l~~~~~~~~l~~~~~~l  117 (128)
                      .+++.++..  .+.||++|++.||+.++++++++++|
T Consensus       138 ~~~~~v~~~--~~~fd~~g~l~de~~~~~l~~~~~~l  172 (174)
T d1rtta_         138 KPEVMISSA--QNAFDAQGRLLDDKARELIQQQLQAL  172 (174)
T ss_dssp             SSCEEECSG--GGTBCSTTCBCCHHHHHHHHHHHHHH
T ss_pred             CCEEEEech--HhccCCCCCcCCHHHHHHHHHHHHHh
Confidence            778888764  78999999999999999999999886
>d2fzva1 c.23.5.4 (A:1-233) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1nni1_ c.23.5.4 (1:) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]} Back     information, alignment and structure
>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2z98a1 c.23.5.3 (A:1-200) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2qwxa1 c.23.5.3 (A:1-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1d4aa_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d5nula_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1czna_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]} Back     information, alignment and structure
>d1ag9a_ c.23.5.1 (A:) Flavodoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oboa_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]} Back     information, alignment and structure
>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]} Back     information, alignment and structure
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ykga1 c.23.5.2 (A:63-208) Sulfite reductase alpha-component CysJ N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bvyf_ c.23.5.1 (F:) FMN-binding domain of the cytochrome P450bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ja1a2 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fuea_ c.23.5.1 (A:) Flavodoxin {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1rlja_ c.23.5.7 (A:) Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1tlla2 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FMN domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure