Citrus Sinensis ID: 035831

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---
MKVFGCFVLFFLVTCSSLSSICLALSDAEAAFITRRQLLTLPKDGKLPDNFDDEYGLKNKTFANERLKKAYVALQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGIDLNGNDIAGSFPAELGLLTDLALFHVNSNRFCGIIPDFSDWKLMFEFDVSNNRLVGSFPRVVLSWPSLKFLDLRYNNFEGELPCDLFDMKLDALFLNNNRFSYSIPEKLGRSTVSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDDASNCLAERPSQKWANTCEPVVSNPVDCSRDMCSAGGTPPSIPYTAPPKPTTIPPAPELKTPTPAPPTPREAKVLRPKGTTPPP
ccccccHHHHHHHHccccccccccccHHHHccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHHHcccccccccccccccccccccccEEccccccccccccEEEEEccccccEEccccccccccccccEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEcccHHHHcccccEEEccccccEEccccccccccccEEEEccccccccccHHHHcccccccEEcccccccccccHHHcccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccHHHHHHHHHHHHcccccccHHHcccccccEEEccccccccHHHcccccccEEEcccccccccHHHHHHHHHHcccccHHHHccccccccccccccccccccccccccccEEEEEcccccccccccHHHcccccccEEEccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccEEEEEccccccccccHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccccHcccccccEEEcccccccccccHHHccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MKVFGCFVLFFLVTCSSLSSICLALSDAEAAFITRRQlltlpkdgklpdnfddeyglknkTFANERLKKAYVALQAFKksiysdpfnttanwvdntdvcsyngvfcapalddpnitvvagidlngndiagsfpaelGLLTDLALFHvnsnrfcgiipdfsdwkLMFEFdvsnnrlvgsfprvvlswpslkfldlrynnfegelpcdlfdmkLDALFlnnnrfsysipeklgrsTVSVVTFAHnnfngciprsignmqnlneiilsdnklsgcfpseigslknlrvfdvssnlfhgnvpqsfssLESIQTLILSHNqltgfvseqicklpslsnftfSYNYFqglgnecipgskvnsafddasnclaerpsqkwantcepvvsnpvdcsrdmcsaggtppsipytappkpttippapelktptpapptpreakvlrpkgttppp
MKVFGCFVLFFLVTCSSLSSICLALSDAEAAFITRRQlltlpkdgklpdnfdDEYGLKNKTFANERLKKAYVALQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGIDLNGNDIAGSFPAELGLLTDLALFHVNSNRFCGIIPDFSDWKLMFEFDVSNNRLVGSFPRVVLSWPSLKFLDLRYNNFEGELPCDLFDMKLDALFLNNNRFSYSIPEKLGRSTVSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDDASNCLAerpsqkwantcePVVSNPVDCSRDMCSAGGTPPSIPYTAPPKPTTIPPAPElktptpapptpreakvlrpkgttppp
MKVFGCFVLFFLVTcsslssiclalsDAEAAFITRRQLLTLPKDGKLPDNFDDEYGLKNKTFANERLKKAYVALQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGIDLNGNDIAGSFPAELGLLTDLALFHVNSNRFCGIIPDFSDWKLMFEFDVSNNRLVGSFPRVVLSWPSLKFLDLRYNNFEGELPCDLFDMKLDALFLNNNRFSYSIPEKLGRSTVSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDDASNCLAERPSQKWANTCEPVVSNPVDCSRDMCSAGGTPPSipytappkpttippapelktptpapptpreakVLRPKGTTPPP
**VFGCFVLFFLVTCSSLSSICLALSDAEAAFITRRQLLTLPKDGKLPDNFDDEYGLKNKTFANERLKKAYVALQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGIDLNGNDIAGSFPAELGLLTDLALFHVNSNRFCGIIPDFSDWKLMFEFDVSNNRLVGSFPRVVLSWPSLKFLDLRYNNFEGELPCDLFDMKLDALFLNNNRFSYSIPEKLGRSTVSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDDASNCLA******WANTCEPVV**************************************************************
***FGCFVLFFLVTCSSLSSICLALSDAEAAFITRRQLLTLPKDGKLPDNFDDEYGLKNKTFANERLKKAYVALQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGIDLNGNDIAGSFPAELGLLTDLALFHVNSNRFCGIIPDFSDWKLMFEFDVSNNRLVGSFPRVVLSWPSLKFLDLRYNNFEGELPCDLFDMKLDALFLNNNRFSYSIPEKLGRSTVSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDDASNCLAERPSQKWANTCEPVVSNPVDCSRDMC***************************************************
MKVFGCFVLFFLVTCSSLSSICLALSDAEAAFITRRQLLTLPKDGKLPDNFDDEYGLKNKTFANERLKKAYVALQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGIDLNGNDIAGSFPAELGLLTDLALFHVNSNRFCGIIPDFSDWKLMFEFDVSNNRLVGSFPRVVLSWPSLKFLDLRYNNFEGELPCDLFDMKLDALFLNNNRFSYSIPEKLGRSTVSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDDASNCLAERPSQKWANTCEPVVSNPVDCSRDMCSAGGTPPSIPYTAPPKPTTIPPAPELKT***********************
**VFGCFVLFFLVTCSSLSSICLALSDAEAAFITRRQLLTLPKDGKLPDNFDDEYGLKNKTFANERLKKAYVALQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGIDLNGNDIAGSFPAELGLLTDLALFHVNSNRFCGIIPDFSDWKLMFEFDVSNNRLVGSFPRVVLSWPSLKFLDLRYNNFEGELPCDLFDMKLDALFLNNNRFSYSIPEKLGRSTVSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDDASNCLAERPSQKWANTCEPVVSNPVDCSRDMCSAGGTPPSIPYTAPPKPTTIPPAPELKTPTP********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVFGCFVLFFLVTCSSLSSICLALSDAEAAFITRRQLLTLPKDGKLPDNFDDEYGLKNKTFANERLKKAYVALQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGIDLNGNDIAGSFPAELGLLTDLALFHVNSNRFCGIIPDFSDWKLMFEFDVSNNRLVGSFPRVVLSWPSLKFLDLRYNNFEGELPCDLFDMKLDALFLNNNRFSYSIPEKLGRSTVSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDDASNCLAERPSQKWANTCEPVVSNPVDCSRDMCSAGGTPPSIPYTAPPKPTTIPPAPELKTPTPAPPTPREAKVLRPKGTTPPP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query443 2.2.26 [Sep-21-2011]
Q9LJ64 956 Pollen-specific leucine-r yes no 0.880 0.407 0.636 1e-146
Q9XIL9 727 Pollen-specific leucine-r no no 0.900 0.548 0.605 1e-142
O81765 699 Pollen-specific leucine-r no no 0.930 0.589 0.597 1e-140
Q9XIB6 847 Pollen-specific leucine-r no no 0.848 0.443 0.584 1e-131
Q9LHF1494 Leucine-rich repeat exten no no 0.814 0.730 0.505 1e-102
Q9SN46 857 Leucine-rich repeat exten no no 0.851 0.439 0.510 1e-102
O65375 744 Leucine-rich repeat exten no no 0.830 0.494 0.484 2e-99
Q9T0K5 760 Leucine-rich repeat exten no no 0.823 0.480 0.507 2e-99
O48809 786 Leucine-rich repeat exten no no 0.760 0.428 0.526 2e-97
Q4PSE6433 Leucine-rich repeat exten no no 0.747 0.764 0.494 8e-90
>sp|Q9LJ64|PLRX1_ARATH Pollen-specific leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=1 Back     alignment and function desciption
 Score =  520 bits (1338), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 250/393 (63%), Positives = 299/393 (76%), Gaps = 3/393 (0%)

Query: 2   KVFGCFVLFFLVTCSSLSSICLALSDAEAAFITRRQLLTLPKDGKLPDNFDDEYGLKNKT 61
           K FGCF+L F  T S       AL+D EA+F+TRRQLL L ++G LPD+ + E  L  K 
Sbjct: 8   KPFGCFLLLFCFTISIFFYSAAALTDEEASFLTRRQLLALSENGDLPDDIEYEVDLDLK- 66

Query: 62  FANERLKKAYVALQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGI 121
           FAN RLK+AY+ALQA+KK+ YSDPFNT ANWV   DVCSY GVFCAPALDDP++ VVAGI
Sbjct: 67  FANNRLKRAYIALQAWKKAFYSDPFNTAANWV-GPDVCSYKGVFCAPALDDPSVLVVAGI 125

Query: 122 DLNGNDIAGSFPAELGLLTDLALFHVNSNRFCGIIPD-FSDWKLMFEFDVSNNRLVGSFP 180
           DLN  DIAG  P ELGLLTD+ALFHVNSNRFCG+IP   S   LM+EFDVSNNR VG FP
Sbjct: 126 DLNHADIAGYLPPELGLLTDVALFHVNSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGPFP 185

Query: 181 RVVLSWPSLKFLDLRYNNFEGELPCDLFDMKLDALFLNNNRFSYSIPEKLGRSTVSVVTF 240
            V LSWPSLKFLD+RYN+FEG+LP ++FD  LDA+FLNNNRF  +IPE +G+ST SVVTF
Sbjct: 186 TVALSWPSLKFLDIRYNDFEGKLPPEIFDKDLDAIFLNNNRFESTIPETIGKSTASVVTF 245

Query: 241 AHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQS 300
           AHN F+GCIP++IG M+NLNEI+   N LSGC P+EIGSL N+ VFD SSN F G++P +
Sbjct: 246 AHNKFSGCIPKTIGQMKNLNEIVFIGNNLSGCLPNEIGSLNNVTVFDASSNGFVGSLPST 305

Query: 301 FSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDD 360
            S L +++ +  S+N+ TGFV++ ICKLP LSNFTFSYN+F G    C+PGS     FDD
Sbjct: 306 LSGLANVEQMDFSYNKFTGFVTDNICKLPKLSNFTFSYNFFNGEAQSCVPGSSQEKQFDD 365

Query: 361 ASNCLAERPSQKWANTCEPVVSNPVDCSRDMCS 393
            SNCL  RP+QK A  C PVVS PVDCS+D C+
Sbjct: 366 TSNCLQNRPNQKSAKECLPVVSRPVDCSKDKCA 398
Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9XIL9|PLRX3_ARATH Pollen-specific leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=PEX3 PE=2 SV=1 Back     alignment and function description
>sp|O81765|PLRX4_ARATH Pollen-specific leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=PEX4 PE=2 SV=1 Back     alignment and function description
>sp|Q9XIB6|PLRX2_ARATH Pollen-specific leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=PEX2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHF1|LRX4_ARATH Leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=LRX4 PE=1 SV=1 Back     alignment and function description
>sp|Q9SN46|LRX5_ARATH Leucine-rich repeat extensin-like protein 5 OS=Arabidopsis thaliana GN=LRX5 PE=2 SV=2 Back     alignment and function description
>sp|O65375|LRX1_ARATH Leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=LRX1 PE=1 SV=1 Back     alignment and function description
>sp|Q9T0K5|LRX3_ARATH Leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=LRX3 PE=1 SV=1 Back     alignment and function description
>sp|O48809|LRX2_ARATH Leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=LRX2 PE=1 SV=1 Back     alignment and function description
>sp|Q4PSE6|LRX7_ARATH Leucine-rich repeat extensin-like protein 7 OS=Arabidopsis thaliana GN=LRX7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query443
30685162 956 Pollen-specific leucine-rich repeat exte 0.880 0.407 0.636 1e-145
297834816 927 hypothetical protein ARALYDRAFT_479420 [ 0.961 0.459 0.604 1e-144
20259488 712 unknown protein [Arabidopsis thaliana] 0.880 0.547 0.636 1e-144
297836208 740 predicted protein [Arabidopsis lyrata su 0.916 0.548 0.605 1e-142
15226640 727 Pollen-specific leucine-rich repeat exte 0.900 0.548 0.605 1e-140
15235186 699 Pollen-specific leucine-rich repeat exte 0.930 0.589 0.597 1e-138
224103499 711 predicted protein [Populus trichocarpa] 0.839 0.523 0.642 1e-137
224123244499 predicted protein [Populus trichocarpa] 0.823 0.731 0.649 1e-137
255556233 829 protein binding protein, putative [Ricin 0.828 0.442 0.627 1e-131
297798516 668 hypothetical protein ARALYDRAFT_491276 [ 0.902 0.598 0.572 1e-130
>gi|30685162|ref|NP_188532.2| Pollen-specific leucine-rich repeat extensin-like protein 1 [Arabidopsis thaliana] gi|75335059|sp|Q9LJ64.1|PLRX1_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like protein 1; Short=AtPEX1; Short=Pollen-specific LRR/EXTENSIN1; AltName: Full=Cell wall hydroxyproline-rich glycoprotein; Flags: Precursor gi|9280319|dbj|BAB01698.1| extensin protein-like [Arabidopsis thaliana] gi|332642663|gb|AEE76184.1| Pollen-specific leucine-rich repeat extensin-like protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 250/393 (63%), Positives = 299/393 (76%), Gaps = 3/393 (0%)

Query: 2   KVFGCFVLFFLVTCSSLSSICLALSDAEAAFITRRQLLTLPKDGKLPDNFDDEYGLKNKT 61
           K FGCF+L F  T S       AL+D EA+F+TRRQLL L ++G LPD+ + E  L  K 
Sbjct: 8   KPFGCFLLLFCFTISIFFYSAAALTDEEASFLTRRQLLALSENGDLPDDIEYEVDLDLK- 66

Query: 62  FANERLKKAYVALQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGI 121
           FAN RLK+AY+ALQA+KK+ YSDPFNT ANWV   DVCSY GVFCAPALDDP++ VVAGI
Sbjct: 67  FANNRLKRAYIALQAWKKAFYSDPFNTAANWV-GPDVCSYKGVFCAPALDDPSVLVVAGI 125

Query: 122 DLNGNDIAGSFPAELGLLTDLALFHVNSNRFCGIIPD-FSDWKLMFEFDVSNNRLVGSFP 180
           DLN  DIAG  P ELGLLTD+ALFHVNSNRFCG+IP   S   LM+EFDVSNNR VG FP
Sbjct: 126 DLNHADIAGYLPPELGLLTDVALFHVNSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGPFP 185

Query: 181 RVVLSWPSLKFLDLRYNNFEGELPCDLFDMKLDALFLNNNRFSYSIPEKLGRSTVSVVTF 240
            V LSWPSLKFLD+RYN+FEG+LP ++FD  LDA+FLNNNRF  +IPE +G+ST SVVTF
Sbjct: 186 TVALSWPSLKFLDIRYNDFEGKLPPEIFDKDLDAIFLNNNRFESTIPETIGKSTASVVTF 245

Query: 241 AHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQS 300
           AHN F+GCIP++IG M+NLNEI+   N LSGC P+EIGSL N+ VFD SSN F G++P +
Sbjct: 246 AHNKFSGCIPKTIGQMKNLNEIVFIGNNLSGCLPNEIGSLNNVTVFDASSNGFVGSLPST 305

Query: 301 FSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDD 360
            S L +++ +  S+N+ TGFV++ ICKLP LSNFTFSYN+F G    C+PGS     FDD
Sbjct: 306 LSGLANVEQMDFSYNKFTGFVTDNICKLPKLSNFTFSYNFFNGEAQSCVPGSSQEKQFDD 365

Query: 361 ASNCLAERPSQKWANTCEPVVSNPVDCSRDMCS 393
            SNCL  RP+QK A  C PVVS PVDCS+D C+
Sbjct: 366 TSNCLQNRPNQKSAKECLPVVSRPVDCSKDKCA 398

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297834816|ref|XP_002885290.1| hypothetical protein ARALYDRAFT_479420 [Arabidopsis lyrata subsp. lyrata] gi|297331130|gb|EFH61549.1| hypothetical protein ARALYDRAFT_479420 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|20259488|gb|AAM13864.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297836208|ref|XP_002885986.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297331826|gb|EFH62245.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15226640|ref|NP_179188.1| Pollen-specific leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana] gi|75338652|sp|Q9XIL9.1|PLRX3_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like protein 3; Short=AtPEX3; Short=Pollen-specific LRR/EXTENSIN3; AltName: Full=Cell wall hydroxyproline-rich glycoprotein; Flags: Precursor gi|5306245|gb|AAD41978.1| unknown protein [Arabidopsis thaliana] gi|330251349|gb|AEC06443.1| Pollen-specific leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15235186|ref|NP_195123.1| Pollen-specific leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana] gi|75318791|sp|O81765.1|PLRX4_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like protein 4; Short=AtPEX4; Short=Pollen-specific LRR/EXTENSIN4; AltName: Full=Cell wall hydroxyproline-rich glycoprotein; Flags: Precursor gi|3297821|emb|CAA19879.1| extensin-like protein [Arabidopsis thaliana] gi|7270346|emb|CAB80114.1| extensin-like protein [Arabidopsis thaliana] gi|332660902|gb|AEE86302.1| Pollen-specific leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224103499|ref|XP_002313080.1| predicted protein [Populus trichocarpa] gi|222849488|gb|EEE87035.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123244|ref|XP_002330268.1| predicted protein [Populus trichocarpa] gi|222871303|gb|EEF08434.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255556233|ref|XP_002519151.1| protein binding protein, putative [Ricinus communis] gi|223541814|gb|EEF43362.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297798516|ref|XP_002867142.1| hypothetical protein ARALYDRAFT_491276 [Arabidopsis lyrata subsp. lyrata] gi|297312978|gb|EFH43401.1| hypothetical protein ARALYDRAFT_491276 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query443
TAIR|locus:2085889 956 AT3G19020 [Arabidopsis thalian 0.887 0.411 0.628 8.5e-136
TAIR|locus:2044576 727 AT2G15880 [Arabidopsis thalian 0.830 0.506 0.637 2.8e-130
TAIR|locus:2118949 699 AT4G33970 [Arabidopsis thalian 0.887 0.562 0.598 1.7e-128
TAIR|locus:2010247 847 AT1G49490 [Arabidopsis thalian 0.873 0.456 0.588 3.1e-122
TAIR|locus:2124142 857 AT4G18670 "AT4G18670" [Arabido 0.864 0.446 0.497 3.2e-97
TAIR|locus:2094854494 AT3G24480 [Arabidopsis thalian 0.871 0.781 0.493 8.4e-97
TAIR|locus:2142105 760 LRX3 "AT4G13340" [Arabidopsis 0.860 0.501 0.484 4.8e-94
TAIR|locus:2008895 744 LRX1 "AT1G12040" [Arabidopsis 0.769 0.458 0.508 4.3e-93
TAIR|locus:2179449433 AT5G25550 "AT5G25550" [Arabido 0.753 0.771 0.492 2.6e-86
TAIR|locus:2094389470 AT3G22800 "AT3G22800" [Arabido 0.747 0.704 0.492 1.4e-85
TAIR|locus:2085889 AT3G19020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1330 (473.2 bits), Expect = 8.5e-136, P = 8.5e-136
 Identities = 249/396 (62%), Positives = 297/396 (75%)

Query:     2 KVFGCFVLFFLVTXXXXXXXXXXXXDAEAAFITRRQLLTLPKDGKLPDNFDDEYGLKNKT 61
             K FGCF+L F  T            D EA+F+TRRQLL L ++G LPD+ + E  L  K 
Sbjct:     8 KPFGCFLLLFCFTISIFFYSAAALTDEEASFLTRRQLLALSENGDLPDDIEYEVDLDLK- 66

Query:    62 FANERLKKAYVALQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGI 121
             FAN RLK+AY+ALQA+KK+ YSDPFNT ANWV   DVCSY GVFCAPALDDP++ VVAGI
Sbjct:    67 FANNRLKRAYIALQAWKKAFYSDPFNTAANWV-GPDVCSYKGVFCAPALDDPSVLVVAGI 125

Query:   122 DLNGNDIAGSFPAELGLLTDLALFHVNSNRFCGIIP-DFSDWKLMFEFDVSNNRLVGSFP 180
             DLN  DIAG  P ELGLLTD+ALFHVNSNRFCG+IP   S   LM+EFDVSNNR VG FP
Sbjct:   126 DLNHADIAGYLPPELGLLTDVALFHVNSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGPFP 185

Query:   181 RVVLSWPSLKFLDLRYNNFEGELPCDLFDMKLDALFLNNNRFSYSIPEKLGRSTVSVVTF 240
              V LSWPSLKFLD+RYN+FEG+LP ++FD  LDA+FLNNNRF  +IPE +G+ST SVVTF
Sbjct:   186 TVALSWPSLKFLDIRYNDFEGKLPPEIFDKDLDAIFLNNNRFESTIPETIGKSTASVVTF 245

Query:   241 AHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQS 300
             AHN F+GCIP++IG M+NLNEI+   N LSGC P+EIGSL N+ VFD SSN F G++P +
Sbjct:   246 AHNKFSGCIPKTIGQMKNLNEIVFIGNNLSGCLPNEIGSLNNVTVFDASSNGFVGSLPST 305

Query:   301 FSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDD 360
              S L +++ +  S+N+ TGFV++ ICKLP LSNFTFSYN+F G    C+PGS     FDD
Sbjct:   306 LSGLANVEQMDFSYNKFTGFVTDNICKLPKLSNFTFSYNFFNGEAQSCVPGSSQEKQFDD 365

Query:   361 ASNCLAERPSQKWANTCEPVVSNPVDCSRDMCSAGG 396
              SNCL  RP+QK A  C PVVS PVDCS+D C+ GG
Sbjct:   366 TSNCLQNRPNQKSAKECLPVVSRPVDCSKDKCAGGG 401
GO:0005634 "nucleus" evidence=ISM
GO:0005199 "structural constituent of cell wall" evidence=ISS
GO:0009860 "pollen tube growth" evidence=RCA
TAIR|locus:2044576 AT2G15880 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118949 AT4G33970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010247 AT1G49490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124142 AT4G18670 "AT4G18670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094854 AT3G24480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142105 LRX3 "AT4G13340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008895 LRX1 "AT1G12040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179449 AT5G25550 "AT5G25550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094389 AT3G22800 "AT3G22800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query443
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-32
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-21
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-21
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  134 bits (339), Expect = 7e-34
 Identities = 94/274 (34%), Positives = 138/274 (50%), Gaps = 13/274 (4%)

Query: 74  LQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGIDLNGNDIAGSFP 133
           L +FK SI +DP    +NW  + DVC + G+ C       N + V  IDL+G +I+G   
Sbjct: 34  LLSFKSSI-NDPLKYLSNWNSSADVCLWQGITCN------NSSRVVSIDLSGKNISGKIS 86

Query: 134 AELGLLTDLALFHVNSNRFCGIIPD--FSDWKLMFEFDVSNNRLVGSFPRVVLSWPSLKF 191
           + +  L  +   ++++N+  G IPD  F+    +   ++SNN   GS PR   S P+L+ 
Sbjct: 87  SAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG--SIPNLET 144

Query: 192 LDLRYNNFEGELPCDL-FDMKLDALFLNNNRFSYSIPEKLGR-STVSVVTFAHNNFNGCI 249
           LDL  N   GE+P D+     L  L L  N     IP  L   +++  +T A N   G I
Sbjct: 145 LDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQI 204

Query: 250 PRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQSFSSLESIQT 309
           PR +G M++L  I L  N LSG  P EIG L +L   D+  N   G +P S  +L+++Q 
Sbjct: 205 PRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQY 264

Query: 310 LILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQG 343
           L L  N+L+G +   I  L  L +   S N   G
Sbjct: 265 LFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSG 298

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 443
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
KOG4237498 consensus Extracellular matrix protein slit, conta 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.8
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
PLN03150623 hypothetical protein; Provisional 99.49
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.46
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.45
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.44
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.41
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.34
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.29
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.28
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.27
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.2
PLN03150623 hypothetical protein; Provisional 99.19
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.15
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.98
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.89
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.74
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.59
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.52
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.28
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.26
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.23
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.21
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.97
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.92
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 97.91
PRK15386 426 type III secretion protein GogB; Provisional 97.78
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.77
PRK15386426 type III secretion protein GogB; Provisional 97.7
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.27
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.27
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.25
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.21
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.96
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.95
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 96.83
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.7
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.63
KOG4308478 consensus LRR-containing protein [Function unknown 95.67
KOG4308478 consensus LRR-containing protein [Function unknown 95.53
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.96
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.8
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.58
KOG4341483 consensus F-box protein containing LRR [General fu 93.37
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.11
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.29
KOG1947482 consensus Leucine rich repeat proteins, some prote 92.18
KOG1947482 consensus Leucine rich repeat proteins, some prote 92.06
KOG4341483 consensus F-box protein containing LRR [General fu 91.62
smart0037026 LRR Leucine-rich repeats, outliers. 90.84
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.84
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.79
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.5
smart0037026 LRR Leucine-rich repeats, outliers. 90.5
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.46
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.28
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.3e-35  Score=321.01  Aligned_cols=292  Identities=32%  Similarity=0.507  Sum_probs=192.7

Q ss_pred             HHHHHHHHHHHhccCCCCCCCCCCCCCCCCCcccceecCCCCCCCCCCcEEEEEcCCCCCcccCchhhcCCCCCCEEEcc
Q 035831           69 KAYVALQAFKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDPNITVVAGIDLNGNDIAGSFPAELGLLTDLALFHVN  148 (443)
Q Consensus        69 ~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~~~gv~c~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~  148 (443)
                      .+..+|.++|+.+ .++.....+|....++|.|.|++|...      .+++.|||++|++.+.++..|..+++|++|+|+
T Consensus        29 ~~~~~l~~~~~~~-~~~~~~~~~w~~~~~~c~w~gv~c~~~------~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls  101 (968)
T PLN00113         29 EELELLLSFKSSI-NDPLKYLSNWNSSADVCLWQGITCNNS------SRVVSIDLSGKNISGKISSAIFRLPYIQTINLS  101 (968)
T ss_pred             HHHHHHHHHHHhC-CCCcccCCCCCCCCCCCcCcceecCCC------CcEEEEEecCCCccccCChHHhCCCCCCEEECC
Confidence            3556789999887 577778899987789999999999742      356666666666666666666666666666666


Q ss_pred             CCcCCccCC-C-ccCCCCCCEEEccCC----------------------cCcccCCcccCCCCCCcEEecccccCCCCCC
Q 035831          149 SNRFCGIIP-D-FSDWKLMFEFDVSNN----------------------RLVGSFPRVVLSWPSLKFLDLRYNNFEGELP  204 (443)
Q Consensus       149 ~n~i~~~~~-~-~~~l~~L~~L~Ls~n----------------------~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~  204 (443)
                      +|++.+..+ . +..+++|++|+|++|                      .+.+.+|..++.+++|++|+|++|.+.+.+|
T Consensus       102 ~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p  181 (968)
T PLN00113        102 NNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIP  181 (968)
T ss_pred             CCccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCC
Confidence            666654333 2 334555555555555                      4444555556666666666666666665566


Q ss_pred             CcccCC-CCCEEEccCCcccccCCccccC-CccceeeeccCCCCCccchhhhcCCcCceeeccCcccCccCccccCCCCC
Q 035831          205 CDLFDM-KLDALFLNNNRFSYSIPEKLGR-STVSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKN  282 (443)
Q Consensus       205 ~~~~~~-~L~~L~L~~n~l~~~~~~~~~~-~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~  282 (443)
                      ..+... +|++|++++|.+.+.+|..++. .+|++|++++|++.+.+|..++++++|++|++++|.+++.+|..++++++
T Consensus       182 ~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~  261 (968)
T PLN00113        182 NSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKN  261 (968)
T ss_pred             hhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCC
Confidence            555554 6666666666666666655544 55666666666666666666666666666666666666666666666666


Q ss_pred             ccEEEeeCCcCCcCCchhccCCCCCceEEcccccCCccCchhhcCCCCCCEEEecCCcCCCCCCCCCCCCCcCceeeCCC
Q 035831          283 LRVFDVSSNLFHGNVPQSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDDAS  362 (443)
Q Consensus       283 L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~L~l~~  362 (443)
                      |++|++++|++.+.+|..+..+.+|++|++++|.+.+.+|..+.++++|+.|++++|.+.+..+..+..+++|+.|++++
T Consensus       262 L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~  341 (968)
T PLN00113        262 LQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWS  341 (968)
T ss_pred             CCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcC
Confidence            66666666666666666666666677777777766666666666677777777777777666666666677777777777


Q ss_pred             CCCCC
Q 035831          363 NCLAE  367 (443)
Q Consensus       363 N~l~~  367 (443)
                      |.+.+
T Consensus       342 n~l~~  346 (968)
T PLN00113        342 NKFSG  346 (968)
T ss_pred             CCCcC
Confidence            77664

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query443
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-20
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-20
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-05
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 129/301 (42%), Gaps = 56/301 (18%)
Query: 97  DVCSYNGVFCAPALDDPNITVVAGIDLNGNDIAGSFPAELGLLTDLALFHVNSNRFCGII 156
           DV S N     P L D   + +  +D++GN ++G F   +   T+L L +++SN+F G I
Sbjct: 206 DVSSNNFSTGIPFLGD--CSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPI 263
Query: 157 PDFSDWKLMF------------------------EFDVSNNRLVGSFP------------ 180
           P      L +                          D+S N   G+ P            
Sbjct: 264 PPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESL 323
Query: 181 -------------RVVLSWPSLKFLDLRYNNFEGELPCDLFDMK--LDALFLNNNRFSYS 225
                          +L    LK LDL +N F GELP  L ++   L  L L++N FS  
Sbjct: 324 ALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGP 383
Query: 226 IPEKL---GRSTVSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKN 282
           I   L    ++T+  +   +N F G IP ++ N   L  + LS N LSG  PS +GSL  
Sbjct: 384 ILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSK 443
Query: 283 LRVFDVSSNLFHGNVPQSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQ 342
           LR   +  N+  G +PQ    +++++TLIL  N LTG +   +    +L+  + S N   
Sbjct: 444 LRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLT 503
Query: 343 G 343
           G
Sbjct: 504 G 504
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query443
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-53
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-52
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-51
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-49
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-28
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-30
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-14
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-15
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-18
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  183 bits (466), Expect = 1e-54
 Identities = 71/296 (23%), Positives = 117/296 (39%), Gaps = 33/296 (11%)

Query: 73  ALQAFKKSIYSDPFNTTANWVDNTDVCSYN--GVFCAPA----------LDDPNITVVAG 120
           AL   KK +  +P  T ++W+  TD C+    GV C             L   N+     
Sbjct: 10  ALLQIKKDL-GNP-TTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYP 67

Query: 121 I-------------DL-NGNDIAGSFPAELGLLTDLALFHVNSNRFCGIIPDF-SDWKLM 165
           I              +   N++ G  P  +  LT L   ++      G IPDF S  K +
Sbjct: 68  IPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTL 127

Query: 166 FEFDVSNNRLVGSFPRVVLSWPSLKFLDLRYNNFEGELPCDLFDMK--LDALFLNNNRFS 223
              D S N L G+ P  + S P+L  +    N   G +P           ++ ++ NR +
Sbjct: 128 VTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLT 187

Query: 224 YSIPEKLGRSTVSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNL 283
             IP       ++ V  + N   G      G+ +N  +I L+ N L+      +G  KNL
Sbjct: 188 GKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNL 246

Query: 284 RVFDVSSNLFHGNVPQSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYN 339
              D+ +N  +G +PQ  + L+ + +L +S N L G + +    L       ++ N
Sbjct: 247 NGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANN 301
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query443
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.98
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.98
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.98
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.88
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.83
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.79
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.78
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.78
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.72
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.71
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.67
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.63
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.49
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.41
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.39
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.31
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.27
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.26
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.17
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.93
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.66
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.63
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.41
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.08
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.92
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.85
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.29
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.88
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=5.9e-41  Score=321.09  Aligned_cols=292  Identities=25%  Similarity=0.399  Sum_probs=265.5

Q ss_pred             HHHHHHHHHHHHhccCCCCCCCCCCCCCCCCCc--ccceecCCCCCCCCCCcEEEEEcCCCCCcc--cCchhhcCCCCCC
Q 035831           68 KKAYVALQAFKKSIYSDPFNTTANWVDNTDVCS--YNGVFCAPALDDPNITVVAGIDLNGNDIAG--SFPAELGLLTDLA  143 (443)
Q Consensus        68 ~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~--~~gv~c~~~~~~~~l~~L~~L~Ls~n~l~~--~~~~~~~~l~~L~  143 (443)
                      ..+..+|.+||..+ .|+. .+.+|..+.++|.  |.||+|....   ...+|++|+|++|++++  .+|..|+++++|+
T Consensus         5 ~~~~~aL~~~k~~~-~~~~-~l~~W~~~~~~C~~~w~gv~C~~~~---~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~L~   79 (313)
T 1ogq_A            5 PQDKQALLQIKKDL-GNPT-TLSSWLPTTDCCNRTWLGVLCDTDT---QTYRVNNLDLSGLNLPKPYPIPSSLANLPYLN   79 (313)
T ss_dssp             HHHHHHHHHHHHHT-TCCG-GGTTCCTTSCTTTTCSTTEEECCSS---SCCCEEEEEEECCCCSSCEECCGGGGGCTTCS
T ss_pred             HHHHHHHHHHHHhc-CCcc-cccCCCCCCCCCcCCCcceEeCCCC---CCceEEEEECCCCCccCCcccChhHhCCCCCC
Confidence            35678899999998 5665 7889987788998  9999997532   12579999999999998  8999999999999


Q ss_pred             EEEccC-CcCCccCC-CccCCCCCCEEEccCCcCcccCCcccCCCCCCcEEecccccCCCCCCCcccCC-CCCEEEccCC
Q 035831          144 LFHVNS-NRFCGIIP-DFSDWKLMFEFDVSNNRLVGSFPRVVLSWPSLKFLDLRYNNFEGELPCDLFDM-KLDALFLNNN  220 (443)
Q Consensus       144 ~L~L~~-n~i~~~~~-~~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~-~L~~L~L~~n  220 (443)
                      +|++++ |.+.+..+ .|.++++|++|+|++|++++.+|..|.++++|++|++++|.+++.+|..+... +|++|++++|
T Consensus        80 ~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N  159 (313)
T 1ogq_A           80 FLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGN  159 (313)
T ss_dssp             EEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSS
T ss_pred             eeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcCC
Confidence            999995 99998877 89999999999999999999999999999999999999999999999888876 9999999999


Q ss_pred             cccccCCccccC-C-ccceeeeccCCCCCccchhhhcCCcCceeeccCcccCccCccccCCCCCccEEEeeCCcCCcCCc
Q 035831          221 RFSYSIPEKLGR-S-TVSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVP  298 (443)
Q Consensus       221 ~l~~~~~~~~~~-~-~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p  298 (443)
                      ++++.+|..++. . .|++|++++|++.+.++..+..+. |++|++++|.+++..+..+..+++|++|++++|++++.++
T Consensus       160 ~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~  238 (313)
T 1ogq_A          160 RISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG  238 (313)
T ss_dssp             CCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG
T ss_pred             cccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeeecC
Confidence            999999988876 4 799999999999999999999997 9999999999999999999999999999999999996666


Q ss_pred             hhccCCCCCceEEcccccCCccCchhhcCCCCCCEEEecCCcCCCCCCCCCCCCCcCceeeCCCCC-CCC
Q 035831          299 QSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDDASNC-LAE  367 (443)
Q Consensus       299 ~~l~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~L~l~~N~-l~~  367 (443)
                      . +..+++|++|++++|+|++.+|..+..+++|++|++++|++++.+|.. ..++.|+.+++.+|+ +.+
T Consensus       239 ~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~-~~l~~L~~l~l~~N~~lc~  306 (313)
T 1ogq_A          239 K-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNKCLCG  306 (313)
T ss_dssp             G-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGGGSCGGGTCSSSEEES
T ss_pred             c-ccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCCC-ccccccChHHhcCCCCccC
Confidence            5 888999999999999999999999999999999999999999988876 788999999999997 444
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 443
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 89.0 bits (219), Expect = 2e-20
 Identities = 61/304 (20%), Positives = 108/304 (35%), Gaps = 62/304 (20%)

Query: 73  ALQAFKKSIYSDPFNTTANWVDNTDVC--SYNGVFCAPALDDPNITVVAGIDLNGNDIAG 130
           AL   KK +  +P  T ++W+  TD C  ++ GV C     D     V  +DL+G ++  
Sbjct: 10  ALLQIKKDL-GNP-TTLSSWLPTTDCCNRTWLGVLCDT---DTQTYRVNNLDLSGLNLPK 64

Query: 131 SF--PAELGLLTDLALFHV--NSNRFCGIIPDFSDWKLMFEFDVSNNRLVGSFPRVVLSW 186
            +  P+ L  L  L   ++   +N    I P  +    +    +++  + G+ P  +   
Sbjct: 65  PYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQI 124

Query: 187 PSLKFLDLRYNNFEGELPCDLFDMKLDALF-LNNNRFSYSIPEKLGRSTVSVVTFAHNNF 245
            +L  LD  YN   G LP  +  +        + NR S +IP+  G  +    +   +  
Sbjct: 125 KTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRN 184

Query: 246 N------------------------------------------------GCIPRSIGNMQ 257
                                                                  +G  +
Sbjct: 185 RLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSK 244

Query: 258 NLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVPQSFSSLESIQTLILSHNQ- 316
           NLN + L +N++ G  P  +  LK L   +VS N   G +P    +L+       ++N+ 
Sbjct: 245 NLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYANNKC 303

Query: 317 LTGF 320
           L G 
Sbjct: 304 LCGS 307
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query443
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.84
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.8
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.7
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.6
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.6
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.59
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.4
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.33
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.59
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.48
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.08
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.03
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.45
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.38
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=7.2e-38  Score=297.43  Aligned_cols=293  Identities=24%  Similarity=0.384  Sum_probs=260.7

Q ss_pred             HHHHHHHHHHHHhccCCCCCCCCCCCCCCCCCc--ccceecCCCCCCCCCCcEEEEEcCCCCCcc--cCchhhcCCCCCC
Q 035831           68 KKAYVALQAFKKSIYSDPFNTTANWVDNTDVCS--YNGVFCAPALDDPNITVVAGIDLNGNDIAG--SFPAELGLLTDLA  143 (443)
Q Consensus        68 ~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~--~~gv~c~~~~~~~~l~~L~~L~Ls~n~l~~--~~~~~~~~l~~L~  143 (443)
                      .++..||.+||+.+. |+ ..+.+|..+.|+|.  |.||+|....   ...+|++|||+++++.+  .+|..++++++|+
T Consensus         5 ~~e~~aLl~~k~~~~-~~-~~l~sW~~~~d~C~~~w~gv~C~~~~---~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~   79 (313)
T d1ogqa_           5 PQDKQALLQIKKDLG-NP-TTLSSWLPTTDCCNRTWLGVLCDTDT---QTYRVNNLDLSGLNLPKPYPIPSSLANLPYLN   79 (313)
T ss_dssp             HHHHHHHHHHHHHTT-CC-GGGTTCCTTSCTTTTCSTTEEECCSS---SCCCEEEEEEECCCCSSCEECCGGGGGCTTCS
T ss_pred             HHHHHHHHHHHHHCC-CC-CcCCCCCCCCCCCCCcCCCeEEeCCC---CcEEEEEEECCCCCCCCCCCCChHHhcCcccc
Confidence            567889999999985 44 36889988899994  9999998542   23579999999999987  5789999999999


Q ss_pred             EEEccC-CcCCccCC-CccCCCCCCEEEccCCcCcccCCcccCCCCCCcEEecccccCCCCCCCcccCC-CCCEEEccCC
Q 035831          144 LFHVNS-NRFCGIIP-DFSDWKLMFEFDVSNNRLVGSFPRVVLSWPSLKFLDLRYNNFEGELPCDLFDM-KLDALFLNNN  220 (443)
Q Consensus       144 ~L~L~~-n~i~~~~~-~~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~-~L~~L~L~~n  220 (443)
                      +|+|++ |++.+..| .|+++++|++|+|++|++.+..+..+..+.+|+++++++|.+.+.+|..+... +++++++++|
T Consensus        80 ~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n  159 (313)
T d1ogqa_          80 FLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGN  159 (313)
T ss_dssp             EEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSS
T ss_pred             ccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecccc
Confidence            999997 88987777 99999999999999999999999999999999999999999999999988886 9999999999


Q ss_pred             cccccCCccccC-Cc-cceeeeccCCCCCccchhhhcCCcCceeeccCcccCccCccccCCCCCccEEEeeCCcCCcCCc
Q 035831          221 RFSYSIPEKLGR-ST-VSVVTFAHNNFNGCIPRSIGNMQNLNEIILSDNKLSGCFPSEIGSLKNLRVFDVSSNLFHGNVP  298 (443)
Q Consensus       221 ~l~~~~~~~~~~-~~-L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p  298 (443)
                      .+.+.+|..+.. .. ++.+++++|++++..+..+..+..+ .++++++.+.+.++..+..+++++.+++++|.+.+.++
T Consensus       160 ~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~  238 (313)
T d1ogqa_         160 RISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG  238 (313)
T ss_dssp             CCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG
T ss_pred             ccccccccccccccccccccccccccccccccccccccccc-cccccccccccccccccccccccccccccccccccccc
Confidence            999999988865 34 5889999999999999988887654 79999999999999999999999999999999986654


Q ss_pred             hhccCCCCCceEEcccccCCccCchhhcCCCCCCEEEecCCcCCCCCCCCCCCCCcCceeeCCCCC-CCCC
Q 035831          299 QSFSSLESIQTLILSHNQLTGFVSEQICKLPSLSNFTFSYNYFQGLGNECIPGSKVNSAFDDASNC-LAER  368 (443)
Q Consensus       299 ~~l~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~L~l~~N~-l~~~  368 (443)
                       .+..+++|+.|+|++|+++|.+|..|+++++|++|+|++|+|+|.+|. +..+.+|+.+++++|+ +.+.
T Consensus       239 -~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~  307 (313)
T d1ogqa_         239 -KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             -GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEEST
T ss_pred             -ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCC
Confidence             688899999999999999999999999999999999999999998885 5778899999999996 4443
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure