Citrus Sinensis ID: 035893

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-----
SLEEMPLGIGKLTCLQTLGNFAVGKDNGSGLRKLKSLIHLQGTLKISKLENVKDDGDAKEARLDGKKNLRELSLNWTCSTDGSSSREAETETGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFLNLVTLKFEDCGMCTALPSVGQLPSLKHLTVHGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEMLVIEECEELSISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLSGPLKPRIPKLEELGISNNICSLKRLVITSCPTLQSLVAEEEKDQQQQLCELSCRLEYLKLSNCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIQISYCDALKSLPEAWMCHTNSSLEILIILYCNSLTYIAEVQLPPSLKQLDIYNCDNIRTLTVEEGIQCSSSSSRRYTSYLLEDLVIWECPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVNFCSKLELIAERLDNNTSLETISISNCENLVSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLSTLQYLTIGGALPSLEEEDGLPTNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCDDDMVSFPLEDKRLGTALPLPASLTSLTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKYFPEKGLPSSLLRLNIAGCPLIEEKCRKDGGQYWDLLTHIPYVVIDFKWVF
ccccccccccccccccccccEEEcccccccHHHHccccccccEEEEccccccccHHHHHHHcccccccccEEEEEEccccccccccccccHHHHHccccccccccEEEEEEcccccccccccccccccEEEEEEEccccccccccccccccccEEEEccccccEEEcccccccccccccccccEEEccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEEcccccccccccccccEEEEcccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccccHHHHHHHHHcccccccEEEEEEccccccccccccccccccEEEEcccccccccccccccccccEEEEEcccccccccHHHHccccccccEEEEEccccccccccccccccccEEEEEccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccEEEEEEccccEEccccccccccccEEEEEcccccEEccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccEEEEcccccHHHHHHHccccccccccccEEEEEcccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccEEEEccEEEc
ccHHcccccccHHcHcHccEEEEcccccccHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHccccccEEEEEEccccccccccccHHHHHHHHHccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccEEEccHHHcccccccccccHHEEEEcccHHHHHccccccccHccccccccEEEEcccHHHHccccccccccEEEEEccccccccccccccccEEEEEEccccEEccccccccccccEEEEccccccccccccccccccHccEEEEcccccccccccccccccHcEcccccccccccccccccccccEEEEcccccHcccccccccccccEEEEEcccccccccccccccccccEEEEcccccHccccHHHcccccccccEEEEcccccccccccccccccccEEEEcccHHHHHccHHccccHHHcccccccccHHcEEEccccccHcccccHccccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEEcccccHccccccccccccccEEEEccccccccccccccccccEEEEcccHHHHHHHHHccccccccccccEEEEcccccccccccHHcccccHHccccccccEEEEcccccHHHccHHccccccHcEEEEcccccccccccccccccccEEEEcccHHHHHHcccccccccccEccccEEEEccEEEc
sleemplgigkltclqtlgnfavgkdngsgLRKLKSLIHLQgtlkisklenvkddgdakeARLDGKKNLRELSLnwtcstdgsssreaetetgvldmlkphknleqfgicgyggtkfptwlgdssflnlvtlkfedcgmctalpsvgqlpslkhltvHGMSRVkrlgsefygddspipfpcletlrfedLQEWeewiphgssqgverfpklRELHILRCSKlqgtfpehlpALEMLVIEECEELSISItslpalckmeiggckKVVWRSatdhlgsqnsvvcrdtsnqvflsgplkpripkleelgisnnicslkrlVITSCPTLQSLVAEEEKDQQQQLCELSCRLEylklsnceglvklpqsslslsslreieickcsslvsfpevalpsklKKIQISYCDALKslpeawmchtnssLEILIILYCNSLtyiaevqlppslkqldiyncdnirTLTVEEGiqcsssssrryTSYLLEDlviwecpsltcifsknelpatleslevgnlppslksLRVNFCSKLELIAERldnntsletisisncenlvsfpegglpcaklrtlkiydckrlkalpkglhnlstLQYLTiggalpsleeedglptnlhfLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRgcdddmvsfpledkrlgtalplpasltsltifsfpslerlsssivdlqnltqldlgdcpklkyfpekglpssllrlniagcplieekcrkdggqywdllthipyvvidfkwvf
SLEEMPLGIGKLTCLQTLGNFAVGKDNGSGLRKLKSLIHLqgtlkisklenvkddgdakearldgkknlrelslnwtcstdgsssreAETETGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFLNLVTLKFEDCGMCTALPSVGQLPSLKHLTVHGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEMLVIEECEELSISITSLPALCKMEIGGCKKVVWRSATDHlgsqnsvvcrdtsnqvflsgplkpripklEELGISNNICSLKRLVITSCPTLQSLVAEEEKDQQQQLCELSCRLEYLKLSNCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIQISYCDALKSLPEAWMCHTNSSLEILIILYCNSLTYIAEVQLPPSLKQLDIYNCDNIRTLTVeegiqcsssssRRYTSYLLEDLVIWECPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVNFCSKLELIAErldnntslETISISNCENLVSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLSTLQYLTIGGALPSLEEEDGLPTNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCDDDMVSFPLEDKRLGTALPLPASLTSLTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKYFPEKGLPSSLLRLNIAGCPLIEEKCRKDGGQYWDLLTHIPYVVIDFKWVF
SLEEMPLGIGKLTCLQTLGNFAVGKDNGSGLRKLKSLIHLQGTLKISKLENVKDDGDAKEARLDGKKNLRELSLNWTCSTDGSSSREAETETGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFLNLVTLKFEDCGMCTALPSVGQLPSLKHLTVHGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEMLVIEECEELSISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLSGPLKPRIPKLEELGISNNICSLKRLVITSCPTLQSLVAEEEKDQQQQLCELSCRLEYLKLSNCEGLVKLPQsslslsslREIEICKCSSLVSFPEVALPSKLKKIQISYCDALKSLPEAWMCHTNSSLEILIILYCNSLTYIAEVQLPPSLKQLDIYNCDNIRTLTVEEGIQCsssssrrytsyLLEDLVIWECPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVNFCSKLELIAERLDNNTSLETISISNCENLVSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLSTLQYLTIGGALPSLEEEDGLPTNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCDDDMVSFPLEDKRLGTALPLPASLTSLTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKYFPEKGLPSSLLRLNIAGCPLIEEKCRKDGGQYWDLLTHIPYVVIDFKWVF
******LGIGKLTCLQTLGNFAVGKDNGSGLRKLKSLIHLQGTLKIS****************************W******************LDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFLNLVTLKFEDCGMCTALPSVGQLPSLKHLTVHGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEMLVIEECEELSISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLSGPLKPRIPKLEELGISNNICSLKRLVITSCPTLQSLVAE******QQLCELSCRLEYLKLSNCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIQISYCDALKSLPEAWMCHTNSSLEILIILYCNSLTYIAEVQLPPSLKQLDIYNCDNIRTLTVEEGIQCSSSSSRRYTSYLLEDLVIWECPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVNFCSKLELIAERLDNNTSLETISISNCENLVSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLSTLQYLTIGGALPSLEEEDGLPTNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCDDDMVSFPLEDKRLGTALPLPASLTSLTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKYFPEKGLPSSLLRLNIAGCPLIEEKCRKDGGQYWDLLTHIPYVVIDFKWV*
SLEEMPLGIGKLTCLQTLGNFAVGKDNGSGLRKLKSLIHLQGTLKISKLENVKDDGDAKEARLDGKKNLRELSLNWTCSTD**********TGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFLNLVTLKFEDCGMCTALPSVGQLPSLKHLTVHGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEMLVIEECEELSISITSLPALCKMEIGGCKKVVWR*********NSVVCRDTSNQVFLSGPLKPRIPKLEELGISNNICSLKRLVITSCPTLQSLVAEEEKDQQQQLCELSCRLEYLKLSNCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIQISYCDALKSLPEA*****NSSLEILIILYCNSLTYIAEVQLPPSLKQLDIYNCDNIRTLTVEEGI***S*SSRRYTSYLLEDLVIWECPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVNFCSKLELIAERLDNNTSLETISISNCENLVSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLSTLQYLTIGGALPSLEEEDGLPTNLHFLKIEGNMEIWKSMI**GRGFHRFSSLRELIIRGCDDDMVSFPLEDKRLGTALPLPASLTSLTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKYFPEKGLPSSLLRLNIAGCPLIEEKCRKDGGQYWDLLTHIPYVVIDFKWVF
SLEEMPLGIGKLTCLQTLGNFAVGKDNGSGLRKLKSLIHLQGTLKISKLENVKDDGDAKEARLDGKKNLRELSLNWT**************TGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFLNLVTLKFEDCGMCTALPSVGQLPSLKHLTVHGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEMLVIEECEELSISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLSGPLKPRIPKLEELGISNNICSLKRLVITSCPTLQSLVA********QLCELSCRLEYLKLSNCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIQISYCDALKSLPEAWMCHTNSSLEILIILYCNSLTYIAEVQLPPSLKQLDIYNCDNIRTLTVEEGIQCSSSSSRRYTSYLLEDLVIWECPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVNFCSKLELIAERLDNNTSLETISISNCENLVSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLSTLQYLTIGGALPSLEEEDGLPTNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCDDDMVSFPLEDKRLGTALPLPASLTSLTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKYFPEKGLPSSLLRLNIAGCPLIEEKCRKDGGQYWDLLTHIPYVVIDFKWVF
*LEEMPLGIGKLTCLQTLGNFAVGKDNGSGLRKLKSLIHLQGTLKISKLENVKDDGDAKEARLDGKKNLRELSLNWTCSTDGSSSREAETETGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFLNLVTLKFEDCGMCTALPSVGQLPSLKHLTVHGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEMLVIEECEELSISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLSGPLKPRIPKLEELGISNNICSLKRLVITSCPTLQSLVAEEEKDQQQQLCELSCRLEYLKLSNCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIQISYCDALKSLPEAWMCHTNSSLEILIILYCNSLTYIAEVQLPPSLKQLDIYNCDNIRTLTVEEGIQCSSSSSRRYTSYLLEDLVIWECPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVNFCSKLELIAERLDNNTSLETISISNCENLVSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLSTLQYLTIGGALPSLEEEDGLPTNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCDDDMVSFPLEDKRLGTALPLPASLTSLTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKYFPEKGLPSSLLRLNIAGCPLIEEKCRKDGGQYWDLLTHIPYVVIDFKWVF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLEEMPLGIGKLTCLQTLGNFAVGKDNGSGLRKLKSLIHLQGTLKISKLENVKDDGDAKEARLDGKKNLRELSLNWTCSTDGSSSREAETETGVLDMLKPHKNLEQFGICGYGGTKFPTWLGDSSFLNLVTLKFEDCGMCTALPSVGQLPSLKHLTVHGMSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEMLVIEECEELSISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLSGPLKPRIPKLEELGISNNICSLKRLVITSCPTLQSLVAEEEKDQQQQLCELSCRLEYLKLSNCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIQISYCDALKSLPEAWMCHTNSSLEILIILYCNSLTYIAEVQLPPSLKQLDIYNCDNIRTLTVEEGIQCSSSSSRRYTSYLLEDLVIWECPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVNFCSKLELIAERLDNNTSLETISISNCENLVSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLSTLQYLTIGGALPSLEEEDGLPTNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCDDDMVSFPLEDKRLGTALPLPASLTSLTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKYFPEKGLPSSLLRLNIAGCPLIEEKCRKDGGQYWDLLTHIPYVVIDFKWVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query755 2.2.26 [Sep-21-2011]
Q9LRR41054 Putative disease resistan yes no 0.316 0.226 0.408 2e-47
Q9LRR51424 Putative disease resistan no no 0.323 0.171 0.411 9e-46
Q7XA40992 Putative disease resistan N/A no 0.433 0.329 0.314 1e-33
Q7XA42979 Putative disease resistan N/A no 0.427 0.329 0.311 1e-33
Q7XBQ9970 Disease resistance protei N/A no 0.414 0.322 0.315 7e-33
Q7XA39988 Putative disease resistan N/A no 0.437 0.334 0.301 1e-32
O23530 1301 Protein SUPPRESSOR OF npr no no 0.471 0.273 0.245 2e-10
Q9LVT1623 Putative disease resistan no no 0.132 0.160 0.303 2e-05
Q9LZ25811 Probable disease resistan no no 0.152 0.141 0.299 0.0002
Q9SZA7816 Probable disease resistan no no 0.131 0.121 0.336 0.0002
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function desciption
 Score =  191 bits (484), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/250 (40%), Positives = 148/250 (59%), Gaps = 11/250 (4%)

Query: 2   LEEMPLGIGKLTCLQTLGNFAVGKDNGSGLRKLKSLIHLQGTLKISKLENVKDDGDAKEA 61
           L +MP   G+L  LQTL  F V   +GS + +L  L  L G LKI +L+ V D  DA EA
Sbjct: 661 LRQMPRRFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEA 720

Query: 62  RLDGKKNLRELSLNW----TCSTDGSSSREAETETGVLDMLKPHKNLEQFGICGYGGTKF 117
            L+ KK+LRE+   W    + S + ++    + E  V + L+PH+++E+  I  Y G +F
Sbjct: 721 NLNSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRRF 780

Query: 118 PTWLGDSSFLNLVTLKFEDCGMCTALPSVGQLPSLKHLTVHGMSRVKRLGSEFY------ 171
           P WL D SF  +V ++  +C  CT+LPS+GQLP LK L + GM  ++ +G +FY      
Sbjct: 781 PDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSIGRKFYFSDQQL 840

Query: 172 GDDSPIPFPCLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLP 231
            D    PF  LETLRF++L +W+EW+    ++G + FP L++L ILRC +L GT P  LP
Sbjct: 841 RDQDQQPFRSLETLRFDNLPDWQEWLDVRVTRG-DLFPSLKKLFILRCPELTGTLPTFLP 899

Query: 232 ALEMLVIEEC 241
           +L  L I +C
Sbjct: 900 SLISLHIYKC 909
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 Back     alignment and function description
>sp|Q9LZ25|DRL30_ARATH Probable disease resistance protein At5g04720 OS=Arabidopsis thaliana GN=At5g04720 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZA7|DRL29_ARATH Probable disease resistance protein At4g33300 OS=Arabidopsis thaliana GN=At4g33300 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query755
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.913 0.484 0.391 1e-126
45826061739 resistance protein [Quercus suber] 0.900 0.920 0.393 1e-121
400131587 1388 FB_MR5 [Malus x robusta] 0.907 0.493 0.390 1e-119
296085123 1278 unnamed protein product [Vitis vinifera] 0.916 0.541 0.379 1e-118
356554923 1399 PREDICTED: putative disease resistance R 0.935 0.504 0.377 1e-114
359487253 1390 PREDICTED: putative disease resistance p 0.916 0.497 0.361 1e-112
225449649 1418 PREDICTED: putative disease resistance p 0.935 0.497 0.375 1e-107
147766392 1471 hypothetical protein VITISV_007674 [Viti 0.919 0.471 0.363 1e-104
225450023 1396 PREDICTED: putative disease resistance p 0.919 0.497 0.368 1e-103
359495054 1347 PREDICTED: putative disease resistance R 0.842 0.472 0.359 1e-103
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
 Score =  460 bits (1183), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 317/810 (39%), Positives = 433/810 (53%), Gaps = 120/810 (14%)

Query: 2    LEEMPLGIGKLTCLQTLGNFAVGK-DNGSGLRKLKSLIHLQGTLKISKLENVKDDGDAKE 60
            LE MPL IG L+ LQTL NF VGK D+   +R+L  L+HL+GTL ISKLENV    +A++
Sbjct: 663  LEGMPLSIGNLSSLQTLSNFVVGKADSFCVIRELGPLVHLRGTLCISKLENVTKAQEARD 722

Query: 61   ARLDGKKNLRELSLNWTCSTDGSSSREAETETGVLDMLKPHKNLEQFGICGYGGTKFPTW 120
            + L GK++L E+ + W  S++ + S++ ET+  VL+ML+P+  L++  +  YGGTKFPTW
Sbjct: 723  SYLYGKQDLNEVVMEW--SSNLNESQDEETQLEVLNMLQPNVKLKELTVKCYGGTKFPTW 780

Query: 121  LGDSSFLNLVTLKFEDCGMCTALPSVGQLPSLKHLTVHGMSRVKRLGSEFYGDDSPIPFP 180
            +GD SF NLV L+FE+C  C +LP VGQLP LK L + GM+ VK +G EFYG+    PF 
Sbjct: 781  IGDPSFSNLVLLRFENCDNCNSLPPVGQLPFLKDLLIKGMAGVKSVGREFYGESCSRPFQ 840

Query: 181  CLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEMLVIEE 240
             LETL FED+  W  WIP G +   E F  L +L I+RC  L    P+HLP+L+ LVI  
Sbjct: 841  SLETLHFEDMPRWVNWIPLGVN---EAFACLHKLSIIRCHNLVRKLPDHLPSLKKLVIHG 897

Query: 241  CEELSISITSLPALCKMEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFLSGPLKPRIP 300
            C  + +S+++LP LC + I GCK+V                  +  + V    P      
Sbjct: 898  CWNMVVSVSNLPMLCVLVIEGCKRV------------------ECESSVGFGSPYSMAFS 939

Query: 301  KLEELGISNNICSLKRLVITSCPTLQSLVAEEEKDQQQQLCELSCRLEYLKLSNCEGLV- 359
            K+ E G  N    L   V                           ++EYLK+ + E L  
Sbjct: 940  KISEFG--NATAGLMHGV--------------------------SKVEYLKIVDSEKLTT 971

Query: 360  ---KLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIQISYCDALKSLPEAWMCHT 416
               K+P+    L  LRE+ I  C +LVSFP    PS LK IQI  C  LKSL      H+
Sbjct: 972  LWEKIPEGLHRLKFLRELSIEDCPTLVSFPASGFPSMLKVIQIKSCSGLKSLLPEGTLHS 1031

Query: 417  --NSSLEILIILYCNSLTYIAEVQLPPSLKQLDIYNCDNIRTL------------TVEEG 462
              N+ LE L ++ C+S+  IA  QLP +LK+L+I +C N++ +              +E 
Sbjct: 1032 RENACLERLCVVRCDSMKSIARGQLPTTLKKLEISHCMNLQCVLDEGEGSSSSSGMHDED 1091

Query: 463  IQCSSSSSRRYTSYLLEDLVIWECPSLTCIFSKNELPATLESL------------EVGNL 510
            I   S +  +Y       L I  CPSLT + S  +LPATL  L              G L
Sbjct: 1092 INNRSKTHLQY-------LDIKSCPSLTTLTSSGKLPATLTHLLLRECPKLMCLSSTGKL 1144

Query: 511  PPSLKSLRVNFCSKLELIAERLDNNTSLETISISNCENL--------------------- 549
            P +L+ L +   SKL+ IAERL  NTSLE I I NC  L                     
Sbjct: 1145 PAALQYLEIQSISKLQKIAERLHQNTSLECIKIWNCHGLKSLPEDLHNLSKLRQFLIFWC 1204

Query: 550  ---VSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLSTLQYLTIGGALPSL-EEEDGLP 605
                SFP  GLP + LR L I +CK LKALP G+ NL++LQ L I   L SL   ++GLP
Sbjct: 1205 QSFSSFPAAGLP-SNLRVLGIKNCKNLKALPNGMRNLTSLQKLDISHRLDSLPSPQEGLP 1263

Query: 606  TNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCDDDMVSFPLEDKRLGTALPLP 665
            TNL  L +  +++ +K M E   G  + +SL +L I G   D+ S+P E +  G  + LP
Sbjct: 1264 TNLIELNMH-DLKFYKPMFE--WGLQQPTSLIKLSIHGECLDVDSYPGEREN-GVMMLLP 1319

Query: 666  ASLTSLTIFSFPSLERLS-SSIVDLQNLTQLDLGDCPKLKYFPEKGLPSSLLRLNIAGCP 724
             SL+ L I  F +LE LS     +L +L QL + +C KL   P++GLP SL +L I  CP
Sbjct: 1320 NSLSILCISYFQNLECLSPKGFQNLTSLNQLKIYNCLKLTSLPKEGLPPSLTQLEIRNCP 1379

Query: 725  LIEEKCRKDGGQYWDLLTHIPYVVIDFKWV 754
            L+ + C  + GQ W  + HIP V+ID K++
Sbjct: 1380 LLSQHCNNEKGQEWSKIAHIPCVLIDNKFI 1409

Source: Quercus suber

Species: Quercus suber

Genus: Quercus

Family: Fagaceae

Order: Fagales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|45826061|gb|AAS77675.1| resistance protein [Quercus suber] Back     alignment and taxonomy information
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|296085123|emb|CBI28618.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|359487253|ref|XP_003633548.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147766392|emb|CAN67818.1| hypothetical protein VITISV_007674 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450023|ref|XP_002272823.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] gi|451798994|gb|AGF69195.1| disease resistance protein At3g14460-like protein 2 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359495054|ref|XP_002267622.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query755
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.323 0.171 0.415 3.3e-64
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.316 0.226 0.408 7.4e-48
UNIPROTKB|O486471802 O48647 "XA1" [Oryza sativa (ta 0.790 0.331 0.264 6.9e-08
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.484 0.184 0.272 3.8e-14
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.343 0.218 0.277 1.9e-13
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.536 0.260 0.251 1.7e-10
TAIR|locus:21479921189 AT5G11250 [Arabidopsis thalian 0.445 0.282 0.271 3.2e-10
TAIR|locus:2151476 1168 VICTR "VARIATION IN COMPOUND T 0.324 0.209 0.294 1.1e-09
TAIR|locus:2151466 1353 VICTL "VARIATION IN COMPOUND T 0.324 0.181 0.294 1.3e-09
TAIR|locus:2053405 1215 AT2G14080 [Arabidopsis thalian 0.345 0.214 0.282 1.9e-09
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 478 (173.3 bits), Expect = 3.3e-64, Sum P(2) = 3.3e-64
 Identities = 105/253 (41%), Positives = 153/253 (60%)

Query:     2 LEEMPLGIGKLTCLQTLGNFAVGKDNGSGLRKLKSLIHLQGTLKISKLENVKDDGDAKEA 61
             L EMP GI KL  LQ L NF +G+ +G+GL +LK L HL+GTL+IS+L+NV    +AK+A
Sbjct:   655 LVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDA 714

Query:    62 RLDGKKNLRELSLNWTCS----TDGSSSREAETETGVLDMLKPHKNLEQFGICGYGGTKF 117
              L  K  L  L L WT        GS +  A  +  VL ML+PH +L+ F I  Y G  F
Sbjct:   715 GLKRKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAF 774

Query:   118 PTWLGDSSFLNLVTLKFEDCGMCTALPSVGQLPSLKHLTVHGMSRVKRLGSEFY-GDDSP 176
             P WLGDSSF  + ++    C +C +LP VGQLPSLK+L++   + ++++G +F+ G+++ 
Sbjct:   775 PKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNS 834

Query:   177 --IPFPCLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALE 234
               +PF  L+ L+F  +  W+EWI      G+  FP L++L I RC  L+  FPE LP+  
Sbjct:   835 RGVPFQSLQILKFYGMPRWDEWICPELEDGI--FPCLQKLIIQRCPSLRKKFPEGLPSST 892

Query:   235 MLVIEECEELSIS 247
              + I +C   ++S
Sbjct:   893 EVTISDCPLRAVS 905
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151476 VICTR "VARIATION IN COMPOUND TRIGGERED ROOT growth response" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151466 VICTL "VARIATION IN COMPOUND TRIGGERED ROOT growth response-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query755
PLN03210 1153 PLN03210, PLN03210, Resistant to P 8e-11
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-08
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-07
PRK15386426 PRK15386, PRK15386, type III secretion protein Gog 6e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-04
PRK15386426 PRK15386, PRK15386, type III secretion protein Gog 3e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 65.3 bits (159), Expect = 8e-11
 Identities = 62/191 (32%), Positives = 95/191 (49%), Gaps = 15/191 (7%)

Query: 536 TSLETISISNCENLVSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLSTLQYLTIGGAL 595
           T+LET+ +S+C +LV  P       KL  L +  C+ L+ LP G+ NL +L  L + G  
Sbjct: 657 TNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGC- 714

Query: 596 PSLEEEDGLPTNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCDDDMVSFPLED 655
             L+    + TN+ +L ++       + IE      R  +L ELI+  C+  M S  L +
Sbjct: 715 SRLKSFPDISTNISWLDLDE------TAIEEFPSNLRLENLDELIL--CE--MKSEKLWE 764

Query: 656 K-RLGTAL--PLPASLTSLTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKYFPEKGLP 712
           + +  T L   L  SLT L +   PSL  L SSI +L  L  L++ +C  L+  P     
Sbjct: 765 RVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINL 824

Query: 713 SSLLRLNIAGC 723
            SL  L+++GC
Sbjct: 825 ESLESLDLSGC 835

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 755
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.84
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.8
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.58
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.41
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.4
KOG0617264 consensus Ras suppressor protein (contains leucine 99.23
KOG4341483 consensus F-box protein containing LRR [General fu 99.18
KOG4237498 consensus Extracellular matrix protein slit, conta 99.18
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.17
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.17
KOG4237498 consensus Extracellular matrix protein slit, conta 99.12
KOG0617264 consensus Ras suppressor protein (contains leucine 99.12
KOG4341483 consensus F-box protein containing LRR [General fu 99.09
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.79
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.71
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.59
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.5
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.49
PRK15386 426 type III secretion protein GogB; Provisional 98.47
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.46
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.44
PRK15386426 type III secretion protein GogB; Provisional 98.44
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.43
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.43
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.33
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.29
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.28
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.24
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.23
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.01
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.87
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.75
PLN03150623 hypothetical protein; Provisional 97.72
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.59
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.54
PLN03150623 hypothetical protein; Provisional 97.47
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.45
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.41
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.39
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.37
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.28
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.08
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.05
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.93
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.87
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.81
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.77
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.39
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.9
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.48
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.0
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 94.88
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.52
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.48
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.05
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.91
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.9
KOG2123 388 consensus Uncharacterized conserved protein [Funct 92.77
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.13
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.75
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.64
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 88.37
smart0037026 LRR Leucine-rich repeats, outliers. 84.11
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.11
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 81.39
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1e-34  Score=347.63  Aligned_cols=524  Identities=15%  Similarity=0.140  Sum_probs=288.6

Q ss_pred             CcceEEEeeeCCCc-CCCCcCCCCCCCccEEEEecCCCCCcCC-C-CCCCCCcceEeecccccceeeCccccCCCCCCCC
Q 035893          103 NLEQFGICGYGGTK-FPTWLGDSSFLNLVTLKFEDCGMCTALP-S-VGQLPSLKHLTVHGMSRVKRLGSEFYGDDSPIPF  179 (755)
Q Consensus       103 ~L~~L~l~~~~~~~-~p~~~~~~~l~~L~~L~L~~~~~~~~lp-~-l~~l~~L~~L~l~~~~~l~~i~~~~~~~~~~~~~  179 (755)
                      +++.|+++++.+.. +|..+.  .+++|+.|++++|.....+| . +..+++|++|+++++.-...++.        ..+
T Consensus        70 ~v~~L~L~~~~i~~~~~~~~~--~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--------~~l  139 (968)
T PLN00113         70 RVVSIDLSGKNISGKISSAIF--RLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--------GSI  139 (968)
T ss_pred             cEEEEEecCCCccccCChHHh--CCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--------ccc
Confidence            45555555544322 233332  35566666666554433455 2 23555666666655432222221        115


Q ss_pred             CcccEEEccccccccccccCCCCCccccCCCcceEeecccccccccCCC---CCCCccEEEeccCcccc---ccCCCCCc
Q 035893          180 PCLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPE---HLPALEMLVIEECEELS---ISITSLPA  253 (755)
Q Consensus       180 ~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~p~---~l~~L~~L~l~~~~~l~---~~~~~l~~  253 (755)
                      ++|++|+++++.-.     ...+..++.+++|++|++++|. +.+.+|.   .+++|++|++++|....   ..+..+++
T Consensus       140 ~~L~~L~Ls~n~~~-----~~~p~~~~~l~~L~~L~L~~n~-l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~  213 (968)
T PLN00113        140 PNLETLDLSNNMLS-----GEIPNDIGSFSSLKVLDLGGNV-LVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKS  213 (968)
T ss_pred             CCCCEEECcCCccc-----ccCChHHhcCCCCCEEECccCc-ccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCC
Confidence            55666665555311     1112224455566666666653 4444443   23455555555544221   12233445


Q ss_pred             cceEEEcCCCCce-eecccCCCCCCceeEeecCCCcccccCCCCCCccchhhccccccCCCcCeEEEccCCCcchhhhhh
Q 035893          254 LCKMEIGGCKKVV-WRSATDHLGSQNSVVCRDTSNQVFLSGPLKPRIPKLEELGISNNICSLKRLVITSCPTLQSLVAEE  332 (755)
Q Consensus       254 L~~L~l~~~~~~~-~~~~~~~~~~l~~L~l~~~~~~~~~~~~i~~~~~~l~~l~~~~~~~~L~~L~l~~~~~l~~l~~~~  332 (755)
                      |+.|++.++.... .......+++|+.|+++++..    .|.+|.         .+.++++|+.|+++++.-...++.. 
T Consensus       214 L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l----~~~~p~---------~l~~l~~L~~L~L~~n~l~~~~p~~-  279 (968)
T PLN00113        214 LKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNL----TGPIPS---------SLGNLKNLQYLFLYQNKLSGPIPPS-  279 (968)
T ss_pred             ccEEECcCCccCCcCChhHhcCCCCCEEECcCcee----ccccCh---------hHhCCCCCCEEECcCCeeeccCchh-
Confidence            5555554443211 111122334444444443321    111111         1133344555555444221111110 


Q ss_pred             HHHHHHhhhhccccccEEEEecCCCCcccCccccCCCCccEEEEccCCCcccCCC-ccCCCCccEEEeccCCCCcccchh
Q 035893          333 EKDQQQQLCELSCRLEYLKLSNCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPE-VALPSKLKKIQISYCDALKSLPEA  411 (755)
Q Consensus       333 ~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~-~~~l~~L~~L~l~~~~~~~~~~~~  411 (755)
                          +    ..+++|++|++++|...+.+|..+..+++|+.|++++|.....+|. +..+++|+.|++++|.....+|..
T Consensus       280 ----l----~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~  351 (968)
T PLN00113        280 ----I----FSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKN  351 (968)
T ss_pred             ----H----hhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChH
Confidence                0    1124555555555554445555555555555555555544333332 233555555555555544444443


Q ss_pred             hhccCCCCccEEEeccCCcccccccc-cCCCCCcEEeeeCCcCCCCCcccccccccCCCccccccccccceeeccCCCcc
Q 035893          412 WMCHTNSSLEILIILYCNSLTYIAEV-QLPPSLKQLDIYNCDNIRTLTVEEGIQCSSSSSRRYTSYLLEDLVIWECPSLT  490 (755)
Q Consensus       412 ~~~~~~~~L~~L~l~~c~~l~~~~~~-~~~~~L~~L~l~~~~~L~~l~~~~~~~~~~~~~~~~~~~~L~~l~i~~c~~l~  490 (755)
                      +  ..+++|+.|++++|.-...++.. ...++|+.|+++++.                                      
T Consensus       352 l--~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~--------------------------------------  391 (968)
T PLN00113        352 L--GKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNS--------------------------------------  391 (968)
T ss_pred             H--hCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCE--------------------------------------
Confidence            3  44555555555553211122211 111233333333322                                      


Q ss_pred             ccccCCCcchhhhhhhccCCCCCcceEEEccCccchhhhhhcCCCCCcCeEEEecCCCCCccCCCCCCCCCceeEEeccC
Q 035893          491 CIFSKNELPATLESLEVGNLPPSLKSLRVNFCSKLELIAERLDNNTSLETISISNCENLVSFPEGGLPCAKLRTLKIYDC  570 (755)
Q Consensus       491 ~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~~  570 (755)
                             +.+.++.. ++.+ ++|+.|++++|...+.+|..+..+++|+.|++++|...+.++..+..+++|+.|++++|
T Consensus       392 -------l~~~~p~~-~~~~-~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n  462 (968)
T PLN00113        392 -------LEGEIPKS-LGAC-RSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARN  462 (968)
T ss_pred             -------ecccCCHH-HhCC-CCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCc
Confidence                   21112111 2333 57888888888877777888888888888888888766666766677888888888888


Q ss_pred             cCcccccccCCCCCCcceeEeCCc-CCC-CccCCCCCCceeeEeecCCcccchhhhhcCcCcCCCCCccEEEEeccCCCc
Q 035893          571 KRLKALPKGLHNLSTLQYLTIGGA-LPS-LEEEDGLPTNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCDDDM  648 (755)
Q Consensus       571 ~~l~~~~~~l~~l~~L~~L~ls~~-~~~-l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~  648 (755)
                      ...+.+|..+ ..++|+.|++++| +.. .+..+..+++|+.|++++|.+....+    ..+.++++|++|++++| ...
T Consensus       463 ~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p----~~~~~l~~L~~L~Ls~N-~l~  536 (968)
T PLN00113        463 KFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIP----DELSSCKKLVSLDLSHN-QLS  536 (968)
T ss_pred             eeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCC----hHHcCccCCCEEECCCC-ccc
Confidence            8777776654 4578888888887 221 12445667888999999998776655    45788899999999984 334


Q ss_pred             ccccccccccCCCCCCCCccceEecccCCCCccccccccCCCCccEEeeCCCCCCCCCCCCCCcccccceeecCCcch
Q 035893          649 VSFPLEDKRLGTALPLPASLTSLTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKYFPEKGLPSSLLRLNIAGCPLI  726 (755)
Q Consensus       649 ~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~L~~L~i~~c~~l  726 (755)
                      ..+|...       ..+++|++|++++|.....+|..+..+++|++|++++|+....+|..+...++....+.+++.+
T Consensus       537 ~~~p~~~-------~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~l  607 (968)
T PLN00113        537 GQIPASF-------SEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDL  607 (968)
T ss_pred             ccCChhH-------hCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccc
Confidence            4455443       5788999999999877778888889999999999999987777888666666666667777755

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query755
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-18
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-11
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 7e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-09
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
4fdw_A401 Leucine rich hypothetical protein; putative cell s 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 85.0 bits (211), Expect = 5e-18
 Identities = 65/381 (17%), Positives = 108/381 (28%), Gaps = 83/381 (21%)

Query: 347 LEYLKLSNCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIQISYCDALK 406
            E L       L                +  +  S          S   +I+     ALK
Sbjct: 14  RENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQAN----SNNPQIETRTGRALK 69

Query: 407 SLPEAWMCHTNSSLEILIILYCNSLTYI-AEVQLPPSLKQLDIYNCDNIRTLTVEEGIQC 465
           +  +     T      L  L    L     +      L+ + I     +  L      Q 
Sbjct: 70  ATADLLEDATQPGRVALE-LRSVPLPQFPDQAFRLSHLQHMTIDAA-GLMELPDTMQ-QF 126

Query: 466 SSSSSRRYTSYLLEDLVIWECPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVNFCSKL 525
           +           LE L +     L        LPA++ SL        L+ L +  C +L
Sbjct: 127 AG----------LETLTLARN-PLR------ALPASIASLN------RLRELSIRACPEL 163

Query: 526 ELIAERLDNNTSLETISISNCENLVSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLST 585
             + E            +++ +              L++L++     +++LP  + NL  
Sbjct: 164 TELPE-----------PLASTDASGEHQG----LVNLQSLRLEWTG-IRSLPASIANLQN 207

Query: 586 LQYLTIGGALPSLEEEDGLPTNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCD 645
           L+ L I  +   L     L   +H L                        L EL +RGC 
Sbjct: 208 LKSLKIRNS--PLSA---LGPAIHHLP----------------------KLEELDLRGCT 240

Query: 646 DDMVSFPLEDKRLGTALPLPASLTSLTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKY 705
             + ++P             A L  L +    +L  L   I  L  L +LDL  C  L  
Sbjct: 241 A-LRNYPPIFGGR-------APLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSR 292

Query: 706 FPEK-GLPSSLLRLNIAGCPL 725
            P       +   + +     
Sbjct: 293 LPSLIAQLPANCIILVPPHLQ 313
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query755
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.84
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.75
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.75
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.73
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.72
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.72
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.66
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.66
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.65
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.65
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.65
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.64
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.63
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.62
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.6
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.59
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.56
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.56
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.55
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.54
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.54
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.52
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.52
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.5
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.43
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.41
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.4
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.4
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.38
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.37
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.37
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.37
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.37
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.36
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.36
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.33
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.31
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.3
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.3
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.29
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.24
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.23
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.23
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.22
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.2
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.19
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.18
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.15
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.02
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.97
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.97
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.95
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.95
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.92
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.9
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.9
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.88
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.87
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.84
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.81
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.8
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.75
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.72
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.68
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.61
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.6
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.58
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.49
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.48
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.34
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.2
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.18
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.17
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.14
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.07
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.36
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.3
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.99
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.72
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.3
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 91.93
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 90.85
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 89.99
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-45  Score=427.84  Aligned_cols=630  Identities=16%  Similarity=0.080  Sum_probs=355.5

Q ss_pred             CCcCCCCCCCCCccCceEeCCCCCCChhhccccccCCceeEecCCCCCCChhhhHHh--ccCCCCCCCcEEEEeecCCCC
Q 035893            5 MPLGIGKLTCLQTLGNFAVGKDNGSGLRKLKSLIHLQGTLKISKLENVKDDGDAKEA--RLDGKKNLRELSLNWTCSTDG   82 (755)
Q Consensus         5 lP~~i~~L~~L~~L~~~~~~~~~~~~i~~L~~L~~L~~~L~i~~~~~~~~~~~~~~~--~l~~l~~L~~L~l~~~~~~~~   82 (755)
                      +|..+++|++|+.++....+.  ......++++++|+ .|++++..    .......  .+.++++|++|++++|.-   
T Consensus        69 l~~~l~~L~~L~~l~~~~~~~--~~l~~~~~~l~~L~-~L~Ls~n~----l~~~~~~~~~l~~l~~L~~L~Ls~n~l---  138 (768)
T 3rgz_A           69 VSSSLLSLTGLESLFLSNSHI--NGSVSGFKCSASLT-SLDLSRNS----LSGPVTTLTSLGSCSGLKFLNVSSNTL---  138 (768)
T ss_dssp             HHHHTTTCTTCCEEECTTSCE--EECCCCCCCCTTCC-EEECCSSE----EEEEGGGGGGGGGCTTCCEEECCSSEE---
T ss_pred             cChhHhccCcccccCCcCCCc--CCCchhhccCCCCC-EEECCCCc----CCCcCCChHHHhCCCCCCEEECcCCcc---
Confidence            566677776666663322111  01123566667777 77777633    2222222  477788888888866311   


Q ss_pred             CCccchhhHHhHhhcCCCCCCcceEEEeeeCCCcCCC-C---cCCCCCCCccEEEEecCCCCCcCCCCCCCCCcceEeec
Q 035893           83 SSSREAETETGVLDMLKPHKNLEQFGICGYGGTKFPT-W---LGDSSFLNLVTLKFEDCGMCTALPSVGQLPSLKHLTVH  158 (755)
Q Consensus        83 ~~~~~~~~~~~~l~~l~~~~~L~~L~l~~~~~~~~p~-~---~~~~~l~~L~~L~L~~~~~~~~lp~l~~l~~L~~L~l~  158 (755)
                           ..  ......+..+++|++|+++++.....+. .   +  ..+++|++|++++|.. ....+++.+++|++|+++
T Consensus       139 -----~~--~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~--~~l~~L~~L~Ls~n~l-~~~~~~~~l~~L~~L~Ls  208 (768)
T 3rgz_A          139 -----DF--PGKVSGGLKLNSLEVLDLSANSISGANVVGWVLS--DGCGELKHLAISGNKI-SGDVDVSRCVNLEFLDVS  208 (768)
T ss_dssp             -----EC--CSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHT--TCCTTCCEEECCSSEE-ESCCBCTTCTTCCEEECC
T ss_pred             -----CC--cCCHHHhccCCCCCEEECCCCccCCcCChhhhhh--ccCCCCCEEECCCCcc-cccCCcccCCcCCEEECc
Confidence                 00  0001122456788888888877655432 2   3  2478888888888763 333345778888888888


Q ss_pred             ccccceeeCccccCCCCCCCCCcccEEEccccccccccccCCCCCccccCCCcceEeecccccccccCCC-CCCCccEEE
Q 035893          159 GMSRVKRLGSEFYGDDSPIPFPCLETLRFEDLQEWEEWIPHGSSQGVERFPKLRELHILRCSKLQGTFPE-HLPALEMLV  237 (755)
Q Consensus       159 ~~~~l~~i~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~p~-~l~~L~~L~  237 (755)
                      +|.....++.  ++     .+++|++|++.++.- ..    ..+..+..+++|++|++++|. +.+.+|. .+++|++|+
T Consensus       209 ~n~l~~~~~~--l~-----~l~~L~~L~Ls~n~l-~~----~~~~~l~~l~~L~~L~Ls~n~-l~~~~~~~~l~~L~~L~  275 (768)
T 3rgz_A          209 SNNFSTGIPF--LG-----DCSALQHLDISGNKL-SG----DFSRAISTCTELKLLNISSNQ-FVGPIPPLPLKSLQYLS  275 (768)
T ss_dssp             SSCCCSCCCB--CT-----TCCSCCEEECCSSCC-CS----CHHHHTTTCSSCCEEECCSSC-CEESCCCCCCTTCCEEE
T ss_pred             CCcCCCCCcc--cc-----cCCCCCEEECcCCcC-CC----cccHHHhcCCCCCEEECCCCc-ccCccCccccCCCCEEE
Confidence            7643333332  22     278888888887752 11    112225677888888888885 5555553 467888888


Q ss_pred             eccCccccc---cCCC-CCccceEEEcCCCCce-eecccCCCCCCceeEeecCCCcccccCCCCCCccchhhccccccCC
Q 035893          238 IEECEELSI---SITS-LPALCKMEIGGCKKVV-WRSATDHLGSQNSVVCRDTSNQVFLSGPLKPRIPKLEELGISNNIC  312 (755)
Q Consensus       238 l~~~~~l~~---~~~~-l~~L~~L~l~~~~~~~-~~~~~~~~~~l~~L~l~~~~~~~~~~~~i~~~~~~l~~l~~~~~~~  312 (755)
                      +++|.....   .+.. +++|+.|+++++.... .......+++|++|+++++.-.    |.+|        ...+..++
T Consensus       276 L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~----~~ip--------~~~l~~l~  343 (768)
T 3rgz_A          276 LAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFS----GELP--------MDTLLKMR  343 (768)
T ss_dssp             CCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEE----EECC--------HHHHTTCT
T ss_pred             CcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCccc----CcCC--------HHHHhcCC
Confidence            887764321   1222 4788888887765332 1222334455555555543211    1111        11123344


Q ss_pred             CcCeEEEccCCCcchhhhhhHHHHHHhhhhccccccEEEEecCCCCcccCccccC--CCCccEEEEccCCCcccCCC-cc
Q 035893          313 SLKRLVITSCPTLQSLVAEEEKDQQQQLCELSCRLEYLKLSNCEGLVKLPQSSLS--LSSLREIEICKCSSLVSFPE-VA  389 (755)
Q Consensus       313 ~L~~L~l~~~~~l~~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~--l~~L~~L~l~~~~~l~~~~~-~~  389 (755)
                      +|++|+++++.-...++....        ...++|++|++++|...+.+|..+..  +++|++|++++|.....+|. +.
T Consensus       344 ~L~~L~Ls~n~l~~~~p~~l~--------~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~  415 (768)
T 3rgz_A          344 GLKVLDLSFNEFSGELPESLT--------NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS  415 (768)
T ss_dssp             TCCEEECCSSEEEECCCTTHH--------HHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGG
T ss_pred             CCCEEeCcCCccCccccHHHH--------hhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHh
Confidence            555555554421112211100        00025555555555444444444433  44555555555543333332 33


Q ss_pred             CCCCccEEEeccCCCCcccchhhhccCCCCccEEEeccCCcccccccc-cCCCCCcEEeeeCCcCCCCCcccccccccCC
Q 035893          390 LPSKLKKIQISYCDALKSLPEAWMCHTNSSLEILIILYCNSLTYIAEV-QLPPSLKQLDIYNCDNIRTLTVEEGIQCSSS  468 (755)
Q Consensus       390 ~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~-~~~~~L~~L~l~~~~~L~~l~~~~~~~~~~~  468 (755)
                      .+++|++|++++|...+.+|..+  ..+++|+.|++++|.....++.. ...++|++|++++|.-...++          
T Consensus       416 ~l~~L~~L~Ls~N~l~~~~p~~l--~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p----------  483 (768)
T 3rgz_A          416 NCSELVSLHLSFNYLSGTIPSSL--GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIP----------  483 (768)
T ss_dssp             GCTTCCEEECCSSEEESCCCGGG--GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCC----------
T ss_pred             cCCCCCEEECcCCcccCcccHHH--hcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCC----------
Confidence            35555555555555443444433  44555555555553222222221 223334444444432111111          


Q ss_pred             CccccccccccceeeccCCCccccccCCCcchhhhhhhccCCCCCcceEEEccCccchhhhhhcCCCCCcCeEEEecCCC
Q 035893          469 SSRRYTSYLLEDLVIWECPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVNFCSKLELIAERLDNNTSLETISISNCEN  548 (755)
Q Consensus       469 ~~~~~~~~~L~~l~i~~c~~l~~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~  548 (755)
                                                         .. ++.+ ++|++|++++|...+.+|..+..+++|++|++++|..
T Consensus       484 -----------------------------------~~-l~~l-~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l  526 (768)
T 3rgz_A          484 -----------------------------------SG-LSNC-TNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSF  526 (768)
T ss_dssp             -----------------------------------GG-GGGC-TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCC
T ss_pred             -----------------------------------HH-HhcC-CCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcc
Confidence                                               11 2222 4667777777766666666666677777777777655


Q ss_pred             CCccCCCCCCCCCceeEEeccCcCcccccccCCCCCCcceeEeCC-----------------------------------
Q 035893          549 LVSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLSTLQYLTIGG-----------------------------------  593 (755)
Q Consensus       549 l~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~l~~l~~L~~L~ls~-----------------------------------  593 (755)
                      .+.+|..+..+++|++|++++|...+.+|..+.....+..+.+..                                   
T Consensus       527 ~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  606 (768)
T 3rgz_A          527 SGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNR  606 (768)
T ss_dssp             EEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGG
T ss_pred             cCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhc
Confidence            556666666666777777777766666665544433333222211                                   


Q ss_pred             -----------c-C-CCCccCCCCCCceeeEeecCCcccchhhhhcCcCcCCCCCccEEEEeccCCCcccccccccccCC
Q 035893          594 -----------A-L-PSLEEEDGLPTNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCDDDMVSFPLEDKRLGT  660 (755)
Q Consensus       594 -----------~-~-~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~  660 (755)
                                 + + ..++..++.+++|++|++++|.+....+    ..+.++++|+.|++++| .-...+|...     
T Consensus       607 l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip----~~l~~l~~L~~L~Ls~N-~l~g~ip~~l-----  676 (768)
T 3rgz_A          607 LSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIP----KEIGSMPYLFILNLGHN-DISGSIPDEV-----  676 (768)
T ss_dssp             GGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCC----GGGGGCTTCCEEECCSS-CCCSCCCGGG-----
T ss_pred             cccccccccccceecccCchhhhccccccEEECcCCcccccCC----HHHhccccCCEEeCcCC-ccCCCCChHH-----
Confidence                       1 0 0011345667899999999999887666    56899999999999994 4455777665     


Q ss_pred             CCCCCCccceEecccCCCCccccccccCCCCccEEeeCCCCCCCCCCCCCCcccccceeecCCcchhH----hhccCCCc
Q 035893          661 ALPLPASLTSLTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKYFPEKGLPSSLLRLNIAGCPLIEE----KCRKDGGQ  736 (755)
Q Consensus       661 ~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~L~~L~i~~c~~l~~----~~~~~~~~  736 (755)
                        ..+++|++|+++++.....+|..+..+++|++|++++|+..+.+|..+.+.++....+.|||.++-    .|....++
T Consensus       677 --~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~  754 (768)
T 3rgz_A          677 --GDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNAD  754 (768)
T ss_dssp             --GGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC--
T ss_pred             --hCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccC
Confidence              578999999999976666899999999999999999997777899887888888999999987642    68999999


Q ss_pred             ccccccCcceEE
Q 035893          737 YWDLLTHIPYVV  748 (755)
Q Consensus       737 ~~~~~~~~~~~~  748 (755)
                      +|++++|++.++
T Consensus       755 ~~~~~~~~~~~~  766 (768)
T 3rgz_A          755 GYAHHQRSHHHH  766 (768)
T ss_dssp             ------------
T ss_pred             CCCCCCCccccC
Confidence            999999999875
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 755
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 38.5 bits (88), Expect = 0.002
 Identities = 38/248 (15%), Positives = 72/248 (29%), Gaps = 19/248 (7%)

Query: 343 LSCRLEYLKLSNCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALP--SKLKKIQIS 400
           LS  +   +      + +      S   ++ +++      VS     L   SKL+ + + 
Sbjct: 21  LSQGVIAFRCPRSF-MDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLE 79

Query: 401 YCDALKSLPEAWMCHTNSSLEILIILYCNSLTYIAEVQLPPSLKQLDIYNCDNIRTLTVE 460
                  +        NS+L  L +  C+  +  A   L  S  +LD  N       T +
Sbjct: 80  GLRLSDPIVNTL--AKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEK 137

Query: 461 EGIQCSSSSSRRYTSYLLEDLVIWECPSLTCIFSKNELPATLESLEVGNLPPSLKSLRVN 520
                 +  S   T   L         S      +               P  +     +
Sbjct: 138 HVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRC-------------PNLVHLDLSD 184

Query: 521 FCSKLELIAERLDNNTSLETISISNCENLVSFPEGGLP-CAKLRTLKIYDCKRLKALPKG 579
                    +       L+ +S+S C +++      L     L+TL+++       L   
Sbjct: 185 SVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLL 244

Query: 580 LHNLSTLQ 587
              L  LQ
Sbjct: 245 KEALPHLQ 252
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query755
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.79
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.7
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.69
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.67
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.61
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.58
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.56
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.56
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.45
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.44
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.44
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.36
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.36
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.36
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.36
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.35
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.34
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.14
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.03
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.97
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.91
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.91
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.9
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.87
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.85
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.58
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.55
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.53
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.5
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.42
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.52
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.02
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.86
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.59
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.15
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.83  E-value=3.3e-19  Score=187.63  Aligned_cols=186  Identities=17%  Similarity=0.167  Sum_probs=133.1

Q ss_pred             CCcceEEEccCccchhhhhhcCCCCCcCeEEEecCCCCCccCCCCCCCCCceeEEeccCcCcccccccCCCCCCcceeEe
Q 035893          512 PSLKSLRVNFCSKLELIAERLDNNTSLETISISNCENLVSFPEGGLPCAKLRTLKIYDCKRLKALPKGLHNLSTLQYLTI  591 (755)
Q Consensus       512 ~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~l~~l~~L~~L~l  591 (755)
                      ++++.+++++|...+..|  ...+++|++|++++| .++.++ .+..+++|+.|++++|.. ..++ .+..+++|+.|++
T Consensus       197 ~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n-~l~~~~-~l~~l~~L~~L~l~~n~l-~~~~-~~~~~~~L~~L~l  270 (384)
T d2omza2         197 TNLESLIATNNQISDITP--LGILTNLDELSLNGN-QLKDIG-TLASLTNLTDLDLANNQI-SNLA-PLSGLTKLTELKL  270 (384)
T ss_dssp             TTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSS-CCCCCG-GGGGCTTCSEEECCSSCC-CCCG-GGTTCTTCSEEEC
T ss_pred             cccceeeccCCccCCCCc--ccccCCCCEEECCCC-CCCCcc-hhhcccccchhccccCcc-CCCC-cccccccCCEeec
Confidence            578888888886555443  455788888888888 455554 355678888888888874 4443 3677888888888


Q ss_pred             CCc-CCCCccCCCCCCceeeEeecCCcccchhhhhcCcCcCCCCCccEEEEeccCCCcccccccccccCCCCCCCCccce
Q 035893          592 GGA-LPSLEEEDGLPTNLHFLKIEGNMEIWKSMIERGRGFHRFSSLRELIIRGCDDDMVSFPLEDKRLGTALPLPASLTS  670 (755)
Q Consensus       592 s~~-~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~L~~  670 (755)
                      +++ +..+ ..+..++.++.+++..|.+...      ..+..++++++|++++|  .+..++.        +..+++|++
T Consensus       271 ~~~~l~~~-~~~~~~~~l~~l~~~~n~l~~~------~~~~~~~~l~~L~ls~n--~l~~l~~--------l~~l~~L~~  333 (384)
T d2omza2         271 GANQISNI-SPLAGLTALTNLELNENQLEDI------SPISNLKNLTYLTLYFN--NISDISP--------VSSLTKLQR  333 (384)
T ss_dssp             CSSCCCCC-GGGTTCTTCSEEECCSSCCSCC------GGGGGCTTCSEEECCSS--CCSCCGG--------GGGCTTCCE
T ss_pred             cCcccCCC-Cccccccccccccccccccccc------cccchhcccCeEECCCC--CCCCCcc--------cccCCCCCE
Confidence            876 2222 3455677888888888876653      23677888888888874  3344432        136788999


Q ss_pred             EecccCCCCccccccccCCCCccEEeeCCCCCCCCCCCCCCcccccceeecCC
Q 035893          671 LTIFSFPSLERLSSSIVDLQNLTQLDLGDCPKLKYFPEKGLPSSLLRLNIAGC  723 (755)
Q Consensus       671 L~l~~~~~l~~l~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~L~~L~i~~c  723 (755)
                      |++++| .++.++ .+..+++|++|++++| +++.+++..-+++|+.|+++++
T Consensus       334 L~L~~n-~l~~l~-~l~~l~~L~~L~l~~N-~l~~l~~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         334 LFFANN-KVSDVS-SLANLTNINWLSAGHN-QISDLTPLANLTRITQLGLNDQ  383 (384)
T ss_dssp             EECCSS-CCCCCG-GGGGCTTCCEEECCSS-CCCBCGGGTTCTTCSEEECCCE
T ss_pred             EECCCC-CCCCCh-hHcCCCCCCEEECCCC-cCCCChhhccCCCCCEeeCCCC
Confidence            999886 777777 5788899999999888 6777766444678888888875
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure