Citrus Sinensis ID: 035894
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 88 | ||||||
| 297742774 | 653 | unnamed protein product [Vitis vinifera] | 0.920 | 0.124 | 0.556 | 3e-18 | |
| 359484044 | 359 | PREDICTED: strictosidine synthase 1-like | 0.738 | 0.181 | 0.657 | 8e-18 | |
| 296080853 | 312 | unnamed protein product [Vitis vinifera] | 0.579 | 0.163 | 0.764 | 1e-17 | |
| 296085255 | 315 | unnamed protein product [Vitis vinifera] | 0.579 | 0.161 | 0.764 | 1e-17 | |
| 296085256 | 322 | unnamed protein product [Vitis vinifera] | 0.579 | 0.158 | 0.745 | 4e-17 | |
| 296090369 | 291 | unnamed protein product [Vitis vinifera] | 0.693 | 0.209 | 0.672 | 4e-17 | |
| 359484190 | 325 | PREDICTED: strictosidine synthase 1-like | 0.602 | 0.163 | 0.716 | 5e-17 | |
| 359497069 | 322 | PREDICTED: strictosidine synthase 1-like | 0.579 | 0.158 | 0.745 | 1e-16 | |
| 296085258 | 343 | unnamed protein product [Vitis vinifera] | 0.681 | 0.174 | 0.666 | 2e-16 | |
| 296090370 | 322 | unnamed protein product [Vitis vinifera] | 0.693 | 0.189 | 0.655 | 4e-16 |
| >gi|297742774|emb|CBI35408.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 95.5 bits (236), Expect = 3e-18, Method: Compositional matrix adjust.
Identities = 49/88 (55%), Positives = 60/88 (68%), Gaps = 7/88 (7%)
Query: 1 MKTSLLIIFFFLALTLSPSFGLPSNAGGSRKGNHHLKLQLPAGVVGPESLAFDCNGKGPY 60
MK S IF F+ ++L FG + S + + L+LP+GV GPES+AFDCNG GPY
Sbjct: 1 MKLSQFFIFSFILISL---FGCVN----SHQALKYNTLELPSGVSGPESIAFDCNGDGPY 53
Query: 61 AGVSDGRILKWQDSKLGWTEFASTTPFR 88
G+SDGRILKWQ SK GW EFA T+PFR
Sbjct: 54 TGISDGRILKWQGSKHGWKEFAITSPFR 81
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359484044|ref|XP_002275622.2| PREDICTED: strictosidine synthase 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296080853|emb|CBI18783.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296085255|emb|CBI28987.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296085256|emb|CBI28988.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296090369|emb|CBI40188.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359484190|ref|XP_002274853.2| PREDICTED: strictosidine synthase 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359497069|ref|XP_003635414.1| PREDICTED: strictosidine synthase 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296085258|emb|CBI28990.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296090370|emb|CBI40189.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 88 | ||||||
| TAIR|locus:2080660 | 376 | AT3G57010 [Arabidopsis thalian | 0.738 | 0.172 | 0.515 | 1.1e-12 | |
| TAIR|locus:2080565 | 370 | AT3G57020 [Arabidopsis thalian | 0.75 | 0.178 | 0.492 | 6.4e-12 | |
| TAIR|locus:2080575 | 374 | AT3G57030 [Arabidopsis thalian | 0.75 | 0.176 | 0.515 | 6.5e-12 | |
| TAIR|locus:2097488 | 403 | LAP3 "LESS ADHERENT POLLEN 3" | 0.636 | 0.138 | 0.491 | 3.4e-10 | |
| TAIR|locus:2040312 | 376 | SSL2 "strictosidine synthase-l | 0.738 | 0.172 | 0.430 | 4.7e-09 | |
| TAIR|locus:2201841 | 390 | SSL3 "strictosidine synthase-l | 0.454 | 0.102 | 0.595 | 2.9e-08 | |
| TAIR|locus:2040297 | 394 | SSL1 "strictosidine synthase-l | 0.670 | 0.149 | 0.467 | 6.3e-08 | |
| TAIR|locus:504956439 | 395 | AT5G22020 [Arabidopsis thalian | 0.488 | 0.108 | 0.533 | 1.7e-07 | |
| TAIR|locus:2031511 | 329 | SS3 "strictosidine synthase 3" | 0.636 | 0.170 | 0.456 | 7.1e-07 | |
| TAIR|locus:2031486 | 335 | SS2 "strictosidine synthase 2" | 0.545 | 0.143 | 0.489 | 9e-06 |
| TAIR|locus:2080660 AT3G57010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 174 (66.3 bits), Expect = 1.1e-12, P = 1.1e-12
Identities = 34/66 (51%), Positives = 43/66 (65%)
Query: 23 PSNAGGSRKGNHHLKLQLPAGVVGPESLAFDCNGKGPYAGVSDGRILKWQDSKLGWTEFA 82
P N G++ K +P V GPESL FD G+GPY GV+DGRILKW+ +LGW +FA
Sbjct: 32 PDNLKGTKHVLQDAKT-IPLPVDGPESLEFDPQGEGPYVGVTDGRILKWRGEELGWVDFA 90
Query: 83 STTPFR 88
T+P R
Sbjct: 91 YTSPHR 96
|
|
| TAIR|locus:2080565 AT3G57020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2080575 AT3G57030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2097488 LAP3 "LESS ADHERENT POLLEN 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040312 SSL2 "strictosidine synthase-like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201841 SSL3 "strictosidine synthase-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040297 SSL1 "strictosidine synthase-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956439 AT5G22020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031511 SS3 "strictosidine synthase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031486 SS2 "strictosidine synthase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| KOG1520 | 376 | consensus Predicted alkaloid synthase/Surface muci | 99.32 | |
| PF13449 | 326 | Phytase-like: Esterase-like activity of phytase | 93.28 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 92.96 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 91.74 | |
| PRK13684 | 334 | Ycf48-like protein; Provisional | 91.6 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 91.1 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 90.87 | |
| PF01436 | 28 | NHL: NHL repeat; InterPro: IPR001258 The NHL repea | 86.9 | |
| COG5341 | 132 | Uncharacterized protein conserved in bacteria [Fun | 84.65 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 82.59 | |
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 82.05 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 81.88 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 81.47 | |
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 80.07 |
| >KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.32 E-value=3.8e-12 Score=103.08 Aligned_cols=47 Identities=53% Similarity=0.962 Sum_probs=43.8
Q ss_pred CCccCCceEEeccCCCcceEEeecceEEEEeCCCCCeEEEEEC--CCCC
Q 035894 42 AGVVGPESLAFDCNGKGPYAGVSDGRILKWQDSKLGWTEFAST--TPFR 88 (88)
Q Consensus 42 ~~v~GPESiAfD~~G~GpYTGv~DGRIlR~~~~~~gw~~FA~T--s~~r 88 (88)
..+.|||+++||+.|+|||+|++||||++|.+...||++||++ |+||
T Consensus 51 ~~~~g~E~~~fd~~~~gp~~~v~dg~il~~~g~~~Gwv~~~~~~~s~~~ 99 (376)
T KOG1520|consen 51 NHLTGPESLLFDPQGGGPYTGVVDGRILKYTGNDDGWVKFADTKDSTNR 99 (376)
T ss_pred cccCChhhheecccCCCceEEEECCceEEEeccCceEEEEEeccccccc
Confidence 4589999999999999999999999999999988899999999 7765
|
|
| >PF13449 Phytase-like: Esterase-like activity of phytase | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >PRK13684 Ycf48-like protein; Provisional | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >COG5341 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 88 | ||||
| 2fp8_A | 322 | Structure Of Strictosidine Synthase, The Biosynthet | 1e-04 | ||
| 2v91_A | 302 | Structure Of Strictosidine Synthase In Complex With | 1e-04 | ||
| 2fpb_A | 322 | Structure Of Strictosidine Synthase, The Biosynthet | 3e-04 |
| >pdb|2FP8|A Chain A, Structure Of Strictosidine Synthase, The Biosynthetic Entry To The Monoterpenoid Indole Alkaloid Family Length = 322 | Back alignment and structure |
|
| >pdb|2V91|A Chain A, Structure Of Strictosidine Synthase In Complex With Strictosidine Length = 302 | Back alignment and structure |
| >pdb|2FPB|A Chain A, Structure Of Strictosidine Synthase, The Biosynthetic Entry To The Monoterpenoid Indole Alkaloid Family Length = 322 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 88 | |||
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 9e-14 |
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Length = 322 | Back alignment and structure |
|---|
Score = 63.6 bits (154), Expect = 9e-14
Identities = 17/51 (33%), Positives = 28/51 (54%)
Query: 37 KLQLPAGVVGPESLAFDCNGKGPYAGVSDGRILKWQDSKLGWTEFASTTPF 87
++ + A P S FD KG Y V DGR++K++ G+ +FA +P+
Sbjct: 11 EILIEAPSYAPNSFTFDSTNKGFYTSVQDGRVIKYEGPNSGFVDFAYASPY 61
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 98.26 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 97.18 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 96.68 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 96.52 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 96.41 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 96.27 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 95.8 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 95.56 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 95.56 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 95.35 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 95.29 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 95.1 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 94.96 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 94.8 | |
| 1tl2_A | 236 | L10, protein (tachylectin-2); animal lectin, horse | 94.77 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 94.72 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 94.6 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 94.59 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 94.58 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 94.58 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 94.17 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 93.91 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 93.76 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 93.19 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 93.06 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 92.74 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 92.49 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 92.36 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 92.26 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 92.15 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 92.12 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 91.87 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 91.29 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 90.89 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 90.72 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 90.68 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 90.59 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 90.22 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 90.02 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 89.98 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 89.24 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 88.76 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 88.33 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 88.32 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 88.24 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 87.56 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 87.46 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 87.26 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 87.04 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 86.53 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 86.14 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 85.76 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 85.57 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 85.18 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 84.98 | |
| 3b7f_A | 394 | Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop | 84.48 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 84.4 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 84.25 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 84.13 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 84.09 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 83.66 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 83.63 | |
| 1tl2_A | 236 | L10, protein (tachylectin-2); animal lectin, horse | 83.53 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 83.49 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 83.42 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 83.24 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 82.73 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 82.55 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 82.4 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 82.17 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 81.28 | |
| 4a9v_A | 592 | PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona | 81.11 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 80.73 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 80.52 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 80.27 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 80.06 |
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
Probab=98.26 E-value=1.7e-06 Score=61.57 Aligned_cols=54 Identities=30% Similarity=0.582 Sum_probs=43.9
Q ss_pred CCceeEeeCCCCccCCceEEeccCCCcceEEeecceEEEEeCCCCCeEEEEECC
Q 035894 32 GNHHLKLQLPAGVVGPESLAFDCNGKGPYAGVSDGRILKWQDSKLGWTEFASTT 85 (88)
Q Consensus 32 ~~~~~~l~l~~~v~GPESiAfD~~G~GpYTGv~DGRIlR~~~~~~gw~~FA~Ts 85 (88)
.+.++++.+|++..+||++++|++|+-+|++..+|+|+||+.++..++.|+..+
T Consensus 6 ~~~~~~i~~~g~~~~p~~i~~d~~g~~l~v~~~~~~i~~~~~~~~~~~~~~~~~ 59 (322)
T 2fp8_A 6 SPILKEILIEAPSYAPNSFTFDSTNKGFYTSVQDGRVIKYEGPNSGFVDFAYAS 59 (322)
T ss_dssp ----CEEEEECSSSCCCCEECCTTCSSEEEECTTSEEEEECCTTTCEEEEEESC
T ss_pred CCccceeecCCccCCceEEEEcCCCCEEEEEcCCCeEEEECCCCCceEEEeccc
Confidence 355777889888899999999999877999999999999998776788887544
|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 96.95 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 96.32 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 95.69 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 95.27 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 95.04 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 94.74 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 94.67 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 94.5 | |
| d1v04a_ | 340 | Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory | 94.28 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 93.6 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 93.55 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 93.35 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 92.82 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 92.76 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 92.6 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 92.52 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 92.52 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 92.5 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 92.22 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 90.9 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 90.75 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 89.8 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 88.77 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 88.23 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 88.06 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 87.87 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 87.73 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 87.13 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 86.38 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 84.92 | |
| d1crua_ | 450 | Soluble quinoprotein glucose dehydrogenase {Acinet | 83.73 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 82.91 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 82.61 |
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: Calcium-dependent phosphotriesterase family: SGL-like domain: Diisopropylfluorophosphatase (phosphotriesterase, DFP) species: Squid (Loligo vulgaris) [TaxId: 6622]
Probab=96.95 E-value=0.0012 Score=46.34 Aligned_cols=47 Identities=26% Similarity=0.244 Sum_probs=34.9
Q ss_pred CceeEeeCCCCccCCceEEeccCCCcceEEee--------cceEEEEeCCCCCeEEEE
Q 035894 33 NHHLKLQLPAGVVGPESLAFDCNGKGPYAGVS--------DGRILKWQDSKLGWTEFA 82 (88)
Q Consensus 33 ~~~~~l~l~~~v~GPESiAfD~~G~GpYTGv~--------DGRIlR~~~~~~gw~~FA 82 (88)
+.++++.- +..|||.+|+|++|+ +|-... +|||+||++++..++.++
T Consensus 8 ~~~~~v~~--~~~g~EGpa~d~dG~-ly~~~~~~~~~~~~~g~I~r~d~~~~~~~~~~ 62 (314)
T d1pjxa_ 8 PLFTKVTE--DIPGAEGPVFDKNGD-FYIVAPEVEVNGKPAGEILRIDLKTGKKTVIC 62 (314)
T ss_dssp CCCEEEEC--CCTTCEEEEECTTSC-EEEEETTCEETTEECCEEEEECTTTCCEEEEE
T ss_pred cceEEeec--CCCCCeEeEEeCCCC-EEEEECccccccccCCEEEEEECCCCcEEEEE
Confidence 34555544 578999999999999 997533 579999998776665554
|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|