Citrus Sinensis ID: 035904

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-
ANNINTTDQQALLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTISSQVGNLSSLQTLDLSHNQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGTIPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIPHNLWQ
cccccHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEccccccEEEEEEcccccEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEcccHHHHcccccccEEEccccEEEEccccccccccccccEEccccEEcccccHHHHccccccEEEccccccEEcccHHcccccccccEEccccccEEcccccccccccccEEEcccccccEEccHHHHHccccccEEEcccccccccccccccc
ccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEccccccEEEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEccEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHcc
ANNINTTDQQALLALKARitsdpsnllaknwTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTissqvgnlsslqtldlshnqfsgtipssifSISTLKILIlgdnqlsgsfpsfiISNMssiraidcnynslsgelpanifsYLPFLKSLALSAnnfhgqipstlsnckQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNklqgeipqdlgnlaelewlslpqsfltgtipssiFNLTSlleldfsnnsltgsfrddlcqripllqrfymtnnhftgsiphnlwq
ANNINTTDQQALLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTISSQVGNLSSLQTLDLSHNQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGTIPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNnhftgsiphnlwq
ANNINTTDQQALLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTISSQVGNLSSLQTLDLSHNQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGTIPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIPHNLWQ
***********LLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTISSQVGNLSSLQTLDLSHNQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGTIPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIP*****
**NINTTDQQALLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTISSQVGNLSSLQTLDLSHNQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGTIPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIPHNLWQ
********QQALLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTISSQVGNLSSLQTLDLSHNQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGTIPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIPHNLWQ
*****TTDQQALLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTISSQVGNLSSLQTLDLSHNQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGTIPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIPHNLW*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ANNINTTDQQALLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTISSQVGNLSSLQTLDLSHNQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGTIPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIPHNLWQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query291 2.2.26 [Sep-21-2011]
Q9M2Z1 1002 Leucine-rich repeat recep yes no 0.972 0.282 0.412 6e-48
O49545 1003 Leucine-rich repeat recep no no 0.945 0.274 0.403 3e-44
Q9FL28 1173 LRR receptor-like serine/ no no 0.951 0.236 0.394 5e-41
C0LGT6 1031 LRR receptor-like serine/ no no 0.890 0.251 0.336 1e-38
Q9LVP0 1102 Probable leucine-rich rep no no 0.955 0.252 0.352 2e-38
C0LGP4 1010 Probable LRR receptor-lik no no 0.886 0.255 0.354 3e-38
O82318 960 Probably inactive leucine no no 0.972 0.294 0.338 6e-37
O49318 1124 Probable leucine-rich rep no no 0.965 0.25 0.358 1e-36
C0LGQ5 1249 LRR receptor-like serine/ no no 0.965 0.224 0.319 6e-36
Q9ZPS9 1143 Serine/threonine-protein no no 0.835 0.212 0.389 8e-36
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function desciption
 Score =  191 bits (484), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 118/286 (41%), Positives = 168/286 (58%), Gaps = 3/286 (1%)

Query: 7   TDQQALLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTI 66
           T+  ALL+LK+  T D  + L  +W   T+ CSW G+TCDVS   VT+L++S   L+GT+
Sbjct: 26  TELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTL 85

Query: 67  SSQVGNLSSLQTLDLSHNQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIR 126
           SS V +L  LQ L L+ NQ SG IP  I ++  L+ L L +N  +GSFP  + S + ++R
Sbjct: 86  SSDVAHLPLLQNLSLAANQISGPIPPQISNLYELRHLNLSNNVFNGSFPDELSSGLVNLR 145

Query: 127 AIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPSTLSNCKQLQMLSLSINDFTG 186
            +D   N+L+G+LP ++ + L  L+ L L  N F G+IP+T      L+ L++S N+ TG
Sbjct: 146 VLDLYNNNLTGDLPVSL-TNLTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELTG 204

Query: 187 AIPKEIGNLTKLTELYLG-YNKLQGEIPQDLGNLAELEWLSLPQSFLTGTIPSSIFNLTS 245
            IP EIGNLT L ELY+G YN  +  +P ++GNL+EL         LTG IP  I  L  
Sbjct: 205 KIPPEIGNLTTLRELYIGYYNAFENGLPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQK 264

Query: 246 LLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIPHNLWQ 291
           L  L    N+ TG+   +L   I  L+   ++NN FTG IP +  Q
Sbjct: 265 LDTLFLQVNAFTGTITQEL-GLISSLKSMDLSNNMFTGEIPTSFSQ 309
Necessary for male gametophyte development, as well as ovule specification and function. Involved in cell-cell communication process required during early anther development, and regulating cell division and differentiation to organize cell layers. Required for the development of high-ordered vascular strands within the leaf and a correlated control of leaf shape, size and symmetry. May regulate the CLV1-dependent CLV3-mediated signaling in meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query291
255578886 1043 serine-threonine protein kinase, plant-t 0.972 0.271 0.429 4e-58
359485451 1454 PREDICTED: LRR receptor-like serine/thre 0.962 0.192 0.441 5e-56
147866276 1326 hypothetical protein VITISV_033547 [Viti 0.958 0.210 0.417 6e-56
302143442 999 unnamed protein product [Vitis vinifera] 0.893 0.260 0.442 1e-55
297740832 1686 unnamed protein product [Vitis vinifera] 0.969 0.167 0.395 5e-55
449465016 1092 PREDICTED: probable LRR receptor-like se 0.989 0.263 0.360 9e-55
449500845 982 PREDICTED: probable LRR receptor-like se 0.989 0.293 0.357 2e-54
147776333 1205 hypothetical protein VITISV_000078 [Viti 0.982 0.237 0.367 2e-54
359485453 1202 PREDICTED: probable LRR receptor-like se 0.982 0.237 0.381 1e-53
359483688 1197 PREDICTED: LRR receptor-like serine/thre 0.972 0.236 0.365 6e-53
>gi|255578886|ref|XP_002530297.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223530195|gb|EEF32104.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  230 bits (587), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 190/310 (61%), Gaps = 27/310 (8%)

Query: 6   TTDQQALLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGT 65
            +DQ ALLALK RI  DP+NLLA NW+  TSVC+W+G+TC     RVTAL++S  GLTGT
Sbjct: 32  ASDQDALLALKVRIIRDPNNLLAANWSITTSVCTWVGVTCGARHGRVTALDLSDMGLTGT 91

Query: 66  ISSQVGNLS------------------------SLQTLDLSHNQFSGTIPSSIFSISTLK 101
           I   +GNLS                         ++   +S N FSG IPS I S + L+
Sbjct: 92  IPPHLGNLSFLAFISFYNNRFHGSLPDELSKLRRIKAFGMSTNYFSGEIPSWIGSFTQLQ 151

Query: 102 ILILGDNQLSGSFPSFIISN-MSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNF 160
            L L  N+ +G  P+ + +N +SS+  +D   N+L+G LP NIF++L  L++L L++N F
Sbjct: 152 RLSLSSNKFTGLLPAILANNTISSLWLLDFGTNNLTGRLPPNIFTHLANLRALYLNSNLF 211

Query: 161 HGQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLA 220
           +G IPSTL  C+QL++L+LS N F G+I K+IGNLT L ELYLG N   G IP ++G+LA
Sbjct: 212 NGPIPSTLMACQQLKLLALSFNHFEGSIHKDIGNLTMLQELYLGGNNFSGTIPDEIGDLA 271

Query: 221 ELEWLSLPQSFLTGTIPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNH 280
            LE + L  + L+G +PS I+N + +  +  + N L+G         +P L+ F + +N+
Sbjct: 272 HLEEIILNVNGLSGLVPSGIYNASKMTAIGLALNQLSGYLPSS--SNLPNLEFFIIEDNN 329

Query: 281 FTGSIPHNLW 290
           FTG IP +L+
Sbjct: 330 FTGPIPVSLF 339

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359485451|ref|XP_002276944.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147866276|emb|CAN79935.1| hypothetical protein VITISV_033547 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143442|emb|CBI22003.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740832|emb|CBI31014.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449465016|ref|XP_004150225.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449500845|ref|XP_004161209.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147776333|emb|CAN72034.1| hypothetical protein VITISV_000078 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485453|ref|XP_003633276.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483688|ref|XP_003633002.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query291
TAIR|locus:2097310 1002 BAM2 "BARELY ANY MERISTEM 2" [ 0.972 0.282 0.412 5.2e-49
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.920 0.284 0.402 2e-45
TAIR|locus:2169965 1003 BAM1 "BARELY ANY MERISTEM 1" [ 0.945 0.274 0.403 6.5e-45
TAIR|locus:2085537 894 RLP34 "AT3G11010" [Arabidopsis 0.903 0.294 0.406 1.1e-43
TAIR|locus:2020382 756 RLP3 "AT1G17250" [Arabidopsis 0.958 0.369 0.397 8.6e-42
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.951 0.236 0.394 1.2e-41
TAIR|locus:2120412 992 BAM3 "BARELY ANY MERISTEM 3" [ 0.975 0.286 0.378 2.9e-41
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.972 0.274 0.351 7.8e-40
TAIR|locus:4515102753 598 AT1G73066 [Arabidopsis thalian 0.958 0.466 0.357 6.2e-39
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.817 0.248 0.423 7.7e-39
TAIR|locus:2097310 BAM2 "BARELY ANY MERISTEM 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 520 (188.1 bits), Expect = 5.2e-49, P = 5.2e-49
 Identities = 118/286 (41%), Positives = 168/286 (58%)

Query:     7 TDQQALLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTI 66
             T+  ALL+LK+  T D  + L  +W   T+ CSW G+TCDVS   VT+L++S   L+GT+
Sbjct:    26 TELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTL 85

Query:    67 SSQVGNLSSLQTLDLSHNQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIR 126
             SS V +L  LQ L L+ NQ SG IP  I ++  L+ L L +N  +GSFP  + S + ++R
Sbjct:    86 SSDVAHLPLLQNLSLAANQISGPIPPQISNLYELRHLNLSNNVFNGSFPDELSSGLVNLR 145

Query:   127 AIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPSTLSNCKQLQMLSLSINDFTG 186
              +D   N+L+G+LP ++ + L  L+ L L  N F G+IP+T      L+ L++S N+ TG
Sbjct:   146 VLDLYNNNLTGDLPVSLTN-LTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELTG 204

Query:   187 AIPKEIGNLTKLTELYLGY-NKLQGEIPQDLGNLAELEWLSLPQSFLTGTIPSSIFNLTS 245
              IP EIGNLT L ELY+GY N  +  +P ++GNL+EL         LTG IP  I  L  
Sbjct:   205 KIPPEIGNLTTLRELYIGYYNAFENGLPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQK 264

Query:   246 LLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIPHNLWQ 291
             L  L    N+ TG+   +L   I  L+   ++NN FTG IP +  Q
Sbjct:   265 LDTLFLQVNAFTGTITQEL-GLISSLKSMDLSNNMFTGEIPTSFSQ 309
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0010075 "regulation of meristem growth" evidence=IGI;RCA
GO:0048229 "gametophyte development" evidence=IGI
GO:0048437 "floral organ development" evidence=IGI
GO:0010480 "microsporocyte differentiation" evidence=IGI
GO:0048653 "anther development" evidence=IGI;RCA
GO:0009934 "regulation of meristem structural organization" evidence=IGI
GO:0005515 "protein binding" evidence=IPI
GO:0033612 "receptor serine/threonine kinase binding" evidence=IPI
GO:0000271 "polysaccharide biosynthetic process" evidence=RCA
GO:0007389 "pattern specification process" evidence=RCA
GO:0008361 "regulation of cell size" evidence=RCA
GO:0009664 "plant-type cell wall organization" evidence=RCA
GO:0009740 "gibberellic acid mediated signaling pathway" evidence=RCA
GO:0009825 "multidimensional cell growth" evidence=RCA
GO:0009832 "plant-type cell wall biogenesis" evidence=RCA
GO:0009926 "auxin polar transport" evidence=RCA
GO:0009932 "cell tip growth" evidence=RCA
GO:0010015 "root morphogenesis" evidence=RCA
GO:0010162 "seed dormancy process" evidence=RCA
GO:0010817 "regulation of hormone levels" evidence=RCA
GO:0040007 "growth" evidence=RCA
GO:0043481 "anthocyanin accumulation in tissues in response to UV light" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169965 BAM1 "BARELY ANY MERISTEM 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020382 RLP3 "AT1G17250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120412 BAM3 "BARELY ANY MERISTEM 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102753 AT1G73066 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00025217001
SubName- Full=Chromosome chr9 scaffold_33, whole genome shotgun sequence; (2202 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query291
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-49
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-33
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-11
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  174 bits (443), Expect = 3e-49
 Identities = 122/303 (40%), Positives = 173/303 (57%), Gaps = 33/303 (10%)

Query: 12  LLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTISS--- 68
           LL+ K+ I +DP   L+ NW S   VC W GITC+ S+ RV ++++S   ++G ISS   
Sbjct: 34  LLSFKSSI-NDPLKYLS-NWNSSADVCLWQGITCNNSS-RVVSIDLSGKNISGKISSAIF 90

Query: 69  -----QVGNLS-----------------SLQTLDLSHNQFSGTIPSSIFSISTLKILILG 106
                Q  NLS                 SL+ L+LS+N F+G+IP    SI  L+ L L 
Sbjct: 91  RLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG--SIPNLETLDLS 148

Query: 107 DNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPS 166
           +N LSG  P+ I S  SS++ +D   N L G++P ++ + L  L+ L L++N   GQIP 
Sbjct: 149 NNMLSGEIPNDIGS-FSSLKVLDLGGNVLVGKIPNSL-TNLTSLEFLTLASNQLVGQIPR 206

Query: 167 TLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLS 226
            L   K L+ + L  N+ +G IP EIG LT L  L L YN L G IP  LGNL  L++L 
Sbjct: 207 ELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLF 266

Query: 227 LPQSFLTGTIPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIP 286
           L Q+ L+G IP SIF+L  L+ LD S+NSL+G   + + Q +  L+  ++ +N+FTG IP
Sbjct: 267 LYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQ-LQNLEILHLFSNNFTGKIP 325

Query: 287 HNL 289
             L
Sbjct: 326 VAL 328

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 291
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.82
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.8
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.77
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.74
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.72
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.72
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.65
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.65
PLN03150623 hypothetical protein; Provisional 99.59
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.38
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.29
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.23
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.23
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.22
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.2
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.2
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.19
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.17
PLN03150623 hypothetical protein; Provisional 99.12
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.97
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.85
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.8
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.74
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.74
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.73
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.72
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.7
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.69
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.69
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.65
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.56
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.25
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.23
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.22
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.21
KOG4341483 consensus F-box protein containing LRR [General fu 98.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.11
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.08
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.08
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.04
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.03
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.02
PRK15386 426 type III secretion protein GogB; Provisional 97.96
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.74
PRK15386 426 type III secretion protein GogB; Provisional 97.69
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.61
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.54
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.51
KOG4341483 consensus F-box protein containing LRR [General fu 97.34
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.3
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.13
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.84
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.82
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.23
smart0037026 LRR Leucine-rich repeats, outliers. 95.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.1
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.54
KOG4308 478 consensus LRR-containing protein [Function unknown 94.17
KOG4308 478 consensus LRR-containing protein [Function unknown 94.07
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.85
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.4
smart0037026 LRR Leucine-rich repeats, outliers. 91.4
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.4
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 89.52
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.37
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 85.12
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.1e-34  Score=280.03  Aligned_cols=278  Identities=38%  Similarity=0.683  Sum_probs=214.2

Q ss_pred             CCHHHHHHHHHHHHHhccCCCCccCCCccCCCCccccceeEeecCCCceEEEEecCccccccCcccccCCCCCCEEeCCC
Q 035904            4 INTTDQQALLALKARITSDPSNLLAKNWTSITSVCSWIGITCDVSTHRVTALNISYFGLTGTISSQVGNLSSLQTLDLSH   83 (291)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~c~~~~~~~~~~~~~l~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~   83 (291)
                      ..++|.++++++++.+ .+|.+++.. |+...++|.|.|+.|+. ..+++.|+++++.+.+.++..+..+++|+.|++++
T Consensus        26 ~~~~~~~~l~~~~~~~-~~~~~~~~~-w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~  102 (968)
T PLN00113         26 LHAEELELLLSFKSSI-NDPLKYLSN-WNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSN  102 (968)
T ss_pred             CCHHHHHHHHHHHHhC-CCCcccCCC-CCCCCCCCcCcceecCC-CCcEEEEEecCCCccccCChHHhCCCCCCEEECCC
Confidence            4678999999999999 578777776 98888999999999975 56999999999999999999999999999999999


Q ss_pred             CccccccCcccc-CCCCccEEEeecccCcCCCchhhhhcCCCccEEEccCCccccccChhhhccccCccEEEcccccccc
Q 035904           84 NQFSGTIPSSIF-SISTLKILILGDNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHG  162 (291)
Q Consensus        84 ~~~~~~~~~~l~-~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~  162 (291)
                      |++.+.+|..+. .+.+|++|++++|++++.+|.   ..+++|++|++++|.+.+.++..+ ..+++|++|++++|.+..
T Consensus       103 n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~---~~l~~L~~L~Ls~n~~~~~~p~~~-~~l~~L~~L~L~~n~l~~  178 (968)
T PLN00113        103 NQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR---GSIPNLETLDLSNNMLSGEIPNDI-GSFSSLKVLDLGGNVLVG  178 (968)
T ss_pred             CccCCcCChHHhccCCCCCEEECcCCccccccCc---cccCCCCEEECcCCcccccCChHH-hcCCCCCEEECccCcccc
Confidence            999887887665 888999999999988766665   457778888888887775666554 367777888887777766


Q ss_pred             cCccccccCCCCcEEEcccCcCcCccCccCCCCCCccEEEcCCCcccCCccccccCCCCCceEEccCccccCCCCccccC
Q 035904          163 QIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGTIPSSIFN  242 (291)
Q Consensus       163 ~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~  242 (291)
                      ..|..+..+++|++|++++|.+.+..|..+..+++|+.|++++|.+++.+|..+..+++|++|++++|.+.+..|..+..
T Consensus       179 ~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~  258 (968)
T PLN00113        179 KIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGN  258 (968)
T ss_pred             cCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhC
Confidence            66777777777777777777776666777777777777777777776666777777777777777777776666666666


Q ss_pred             CCCCCEEEccCCcccccCchHHHhhCccccEEEeecceeeeeCCCCC
Q 035904          243 LTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIPHNL  289 (291)
Q Consensus       243 ~~~L~~L~l~~n~i~~~~~~~~~~~~~~L~~L~l~~n~l~~~ip~~~  289 (291)
                      +++|++|++++|.+.+.+|..+.. +++|+.|++++|.+++.+|..+
T Consensus       259 l~~L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~Ls~n~l~~~~p~~~  304 (968)
T PLN00113        259 LKNLQYLFLYQNKLSGPIPPSIFS-LQKLISLDLSDNSLSGEIPELV  304 (968)
T ss_pred             CCCCCEEECcCCeeeccCchhHhh-ccCcCEEECcCCeeccCCChhH
Confidence            677777777777666666655544 6666666666666666666543

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query291
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-27
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-27
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-18
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-11
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-08
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-07
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-07
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 4e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 9e-06
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 3e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 4e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 4e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 6e-05
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 7e-05
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 2e-04
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 6e-04
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 6e-04
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 8e-04
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  120 bits (300), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 125/245 (51%), Gaps = 27/245 (11%)
Query: 71  GNLSSLQTLDLSHNQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIRAIDC 130
           G   +L  LDLS N F G +P    S S L+ L L  N  SG  P   +  M  ++ +D 
Sbjct: 291 GACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDL 350
Query: 131 NYNSLSGELPANIFSYLPFLKSLALSANNFHG--------------------------QI 164
           ++N  SGELP ++ +    L +L LS+NNF G                          +I
Sbjct: 351 SFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI 410
Query: 165 PSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEW 224
           P TLSNC +L  L LS N  +G IP  +G+L+KL +L L  N L+GEIPQ+L  +  LE 
Sbjct: 411 PPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLET 470
Query: 225 LSLPQSFLTGTIPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGS 284
           L L  + LTG IPS + N T+L  +  SNN LTG        R+  L    ++NN F+G+
Sbjct: 471 LILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIP-KWIGRLENLAILKLSNNSFSGN 529
Query: 285 IPHNL 289
           IP  L
Sbjct: 530 IPAEL 534
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query291
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-69
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-65
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-64
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-63
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-58
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-55
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-49
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-48
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-27
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-39
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-34
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-34
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-36
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-33
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-36
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-31
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-22
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-30
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-30
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-29
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-28
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-24
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-28
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-24
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-21
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-14
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-16
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-18
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-24
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-22
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-20
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-07
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-18
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-18
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 9e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-20
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-20
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-20
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-17
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 3e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-21
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 6e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-20
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-13
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 4e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-19
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-14
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-14
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-11
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 8e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-14
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-11
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  216 bits (552), Expect = 2e-69
 Identities = 82/293 (27%), Positives = 129/293 (44%), Gaps = 40/293 (13%)

Query: 5   NTTDQQALLALKARITSDPSNLLAKNWTSITSVC--SWIGITCDVSTH--RVTALNISYF 60
           N  D+QALL +K  +  +P+ L   +W   T  C  +W+G+ CD  T   RV  L++S  
Sbjct: 4   NPQDKQALLQIKKDL-GNPTTL--SSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL 60

Query: 61  GLTGT--ISSQVGNLSSLQTLDLSH-NQFSGTIPSSIFSISTLKILILGDNQLSGSFPSF 117
            L     I S + NL  L  L +   N   G IP +I  ++ L  L +    +SG+ P F
Sbjct: 61  NLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDF 120

Query: 118 IISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSANNFHGQIPSTLSNCKQL-QM 176
           + S + ++  +D +YN+LSG LP +I S LP L  +    N   G IP +  +  +L   
Sbjct: 121 L-SQIKTLVTLDFSYNALSGTLPPSISS-LPNLVGITFDGNRISGAIPDSYGSFSKLFTS 178

Query: 177 LSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGTI 236
           +++S N  TG IP    NL  L  + L  N L+G+     G+    + + L ++ L   +
Sbjct: 179 MTISRNRLTGKIPPTFANL-NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDL 237

Query: 237 PSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIPHNL 289
              +    +L  LD  NN                            G++P  L
Sbjct: 238 GK-VGLSKNLNGLDLRNN-------------------------RIYGTLPQGL 264
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query291
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.85
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.84
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.76
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.65
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.37
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.17
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.15
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.06
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.99
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.95
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.91
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.64
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.63
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.47
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.46
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.3
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.6
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.28
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.81
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.5
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=1.3e-40  Score=281.29  Aligned_cols=277  Identities=31%  Similarity=0.557  Sum_probs=249.2

Q ss_pred             CCHHHHHHHHHHHHHhccCCCCccCCCccCCCCccc--cceeEeecCC--CceEEEEecCccccc--cCcccccCCCCCC
Q 035904            4 INTTDQQALLALKARITSDPSNLLAKNWTSITSVCS--WIGITCDVST--HRVTALNISYFGLTG--TISSQVGNLSSLQ   77 (291)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~c~--~~~~~~~~~~--~~l~~L~l~~~~~~~--~~~~~~~~l~~L~   77 (291)
                      =.++|.+||++||+++ .+|. .+.. |..+.++|.  |.|+.|+...  .+|++|+++++.+++  .+|..+.++++|+
T Consensus         3 c~~~~~~aL~~~k~~~-~~~~-~l~~-W~~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~L~   79 (313)
T 1ogq_A            3 CNPQDKQALLQIKKDL-GNPT-TLSS-WLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLN   79 (313)
T ss_dssp             SCHHHHHHHHHHHHHT-TCCG-GGTT-CCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCS
T ss_pred             CCHHHHHHHHHHHHhc-CCcc-cccC-CCCCCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccChhHhCCCCCC
Confidence            3678999999999999 5665 5666 988889998  9999997544  799999999999998  8999999999999


Q ss_pred             EEeCCC-CccccccCccccCCCCccEEEeecccCcCCCchhhhhcCCCccEEEccCCccccccChhhhccccCccEEEcc
Q 035904           78 TLDLSH-NQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALS  156 (291)
Q Consensus        78 ~L~l~~-~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~  156 (291)
                      +|++++ |.+.+.+|..+..+++|++|++++|.+.+.+|..+ ..+++|++|++++|.+.+.++..+ ..+++|++|+++
T Consensus        80 ~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~-~~l~~L~~L~Ls~N~l~~~~p~~~-~~l~~L~~L~L~  157 (313)
T 1ogq_A           80 FLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFL-SQIKTLVTLDFSYNALSGTLPPSI-SSLPNLVGITFD  157 (313)
T ss_dssp             EEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGG-GGCTTCCEEECCSSEEESCCCGGG-GGCTTCCEEECC
T ss_pred             eeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHH-hCCCCCCEEeCCCCccCCcCChHH-hcCCCCCeEECc
Confidence            999995 89998999999999999999999999987777765 899999999999999987676654 489999999999


Q ss_pred             cccccccCccccccCC-CCcEEEcccCcCcCccCccCCCCCCccEEEcCCCcccCCccccccCCCCCceEEccCccccCC
Q 035904          157 ANNFHGQIPSTLSNCK-QLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGT  235 (291)
Q Consensus       157 ~~~~~~~~~~~l~~~~-~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~  235 (291)
                      +|.+....|..+..++ .|++|++++|.+.+..|..+..+. |+.|++++|.+++..+..+..+++|+.|++++|.+.+.
T Consensus       158 ~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~  236 (313)
T 1ogq_A          158 GNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFD  236 (313)
T ss_dssp             SSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCB
T ss_pred             CCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeee
Confidence            9999878888999998 999999999999888888888887 99999999999988899999999999999999999866


Q ss_pred             CCccccCCCCCCEEEccCCcccccCchHHHhhCccccEEEeecceeeeeCCCC
Q 035904          236 IPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIPHN  288 (291)
Q Consensus       236 ~~~~l~~~~~L~~L~l~~n~i~~~~~~~~~~~~~~L~~L~l~~n~l~~~ip~~  288 (291)
                      .+. +..+++|++|++++|.+.+.+|..+.. +++|+.|++++|+++|.+|..
T Consensus       237 ~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~-l~~L~~L~Ls~N~l~~~ip~~  287 (313)
T 1ogq_A          237 LGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQ-LKFLHSLNVSFNNLCGEIPQG  287 (313)
T ss_dssp             GGG-CCCCTTCCEEECCSSCCEECCCGGGGG-CTTCCEEECCSSEEEEECCCS
T ss_pred             cCc-ccccCCCCEEECcCCcccCcCChHHhc-CcCCCEEECcCCcccccCCCC
Confidence            554 778899999999999999888887665 999999999999999999974
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 291
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-16
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-06
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 84.4 bits (207), Expect = 2e-19
 Identities = 70/312 (22%), Positives = 114/312 (36%), Gaps = 37/312 (11%)

Query: 5   NTTDQQALLALKARITSDPSNLLAKNWTSITSVC--SWIGITCDVST--HRVTALNISYF 60
           N  D+QALL +K  +  +P+ L   +W   T  C  +W+G+ CD  T  +RV  L++S  
Sbjct: 4   NPQDKQALLQIKKDL-GNPTTL--SSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL 60

Query: 61  GLTG--TISSQVGNLSSLQTLDLSHN-QFSGTIPSSIFSISTLKILILGDNQLSGSFPSF 117
            L     I S + NL  L  L +       G IP +I  ++ L  L +    +SG+ P F
Sbjct: 61  NLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDF 120

Query: 118 I-----------------------ISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLA 154
           +                       IS++ ++  I  + N +SG +P +  S+     S+ 
Sbjct: 121 LSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMT 180

Query: 155 LSANNFHGQIPSTLSNCKQLQMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQ 214
           +S N   G+IP T +N     +          A      +           +        
Sbjct: 181 ISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKV 240

Query: 215 DLGNLAELEWLSLPQSFLTGTIPSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRF 274
            L        L   +  + GT+P  +  L  L  L+ S N+L G         +      
Sbjct: 241 GLSKNLNGLDLRNNR--IYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ--GGNLQRFDVS 296

Query: 275 YMTNNHFTGSIP 286
              NN      P
Sbjct: 297 AYANNKCLCGSP 308
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query291
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.65
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.47
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.31
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.34
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.97
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.96
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.59
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.45
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=2.5e-37  Score=259.22  Aligned_cols=275  Identities=31%  Similarity=0.555  Sum_probs=216.6

Q ss_pred             CHHHHHHHHHHHHHhccCCCCccCCCccCCCCccc--cceeEeecCC--CceEEEEecCccccc--cCcccccCCCCCCE
Q 035904            5 NTTDQQALLALKARITSDPSNLLAKNWTSITSVCS--WIGITCDVST--HRVTALNISYFGLTG--TISSQVGNLSSLQT   78 (291)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~c~--~~~~~~~~~~--~~l~~L~l~~~~~~~--~~~~~~~~l~~L~~   78 (291)
                      .|+|.+||++||+.+.+ |. .+.. |..++|+|.  |.|++|+...  .+|++|+++++.+.+  .+|..+.++++|++
T Consensus         4 ~~~e~~aLl~~k~~~~~-~~-~l~s-W~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~   80 (313)
T d1ogqa_           4 NPQDKQALLQIKKDLGN-PT-TLSS-WLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNF   80 (313)
T ss_dssp             CHHHHHHHHHHHHHTTC-CG-GGTT-CCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSE
T ss_pred             CHHHHHHHHHHHHHCCC-CC-cCCC-CCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccccc
Confidence            47899999999999954 43 5666 988899995  9999998643  389999999999987  57899999999999


Q ss_pred             EeCCC-CccccccCccccCCCCccEEEeecccCcCCCchhhhhcCCCccEEEccCCccccccChhhhccccCccEEEccc
Q 035904           79 LDLSH-NQFSGTIPSSIFSISTLKILILGDNQLSGSFPSFIISNMSSIRAIDCNYNSLSGELPANIFSYLPFLKSLALSA  157 (291)
Q Consensus        79 L~l~~-~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~  157 (291)
                      |+|++ |++.+.+|..|+++++|++|++++|++.+..+.. +..+.+|+++++++|.+.+.++..+ ..+++++++++++
T Consensus        81 L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~-~~~~~~L~~l~l~~N~~~~~~p~~l-~~l~~L~~l~l~~  158 (313)
T d1ogqa_          81 LYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDF-LSQIKTLVTLDFSYNALSGTLPPSI-SSLPNLVGITFDG  158 (313)
T ss_dssp             EEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGG-GGGCTTCCEEECCSSEEESCCCGGG-GGCTTCCEEECCS
T ss_pred             cccccccccccccccccccccccchhhhcccccccccccc-ccchhhhcccccccccccccCchhh-ccCcccceeeccc
Confidence            99997 7898899999999999999999999998555544 4889999999999999887777665 4899999999999


Q ss_pred             ccccccCccccccCCCC-cEEEcccCcCcCccCccCCCCCCccEEEcCCCcccCCccccccCCCCCceEEccCccccCCC
Q 035904          158 NNFHGQIPSTLSNCKQL-QMLSLSINDFTGAIPKEIGNLTKLTELYLGYNKLQGEIPQDLGNLAELEWLSLPQSFLTGTI  236 (291)
Q Consensus       158 ~~~~~~~~~~l~~~~~L-~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~  236 (291)
                      |.+....|..+..+..+ +.++++.|.+.+..+..+..+..+ .+++..+...+.+|..+..++.++.+++.++.+.+.+
T Consensus       159 n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~  237 (313)
T d1ogqa_         159 NRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDL  237 (313)
T ss_dssp             SCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBG
T ss_pred             cccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccccccccccccccccccccccc
Confidence            99887788888777775 788888888876666666554433 5677777666666666666677777777777766443


Q ss_pred             CccccCCCCCCEEEccCCcccccCchHHHhhCccccEEEeecceeeeeCCC
Q 035904          237 PSSIFNLTSLLELDFSNNSLTGSFRDDLCQRIPLLQRFYMTNNHFTGSIPH  287 (291)
Q Consensus       237 ~~~l~~~~~L~~L~l~~n~i~~~~~~~~~~~~~~L~~L~l~~n~l~~~ip~  287 (291)
                      + .+..+++|+.|++++|++++.+|..+.. +++|+.|++++|+++|.||+
T Consensus       238 ~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~-L~~L~~L~Ls~N~l~g~iP~  286 (313)
T d1ogqa_         238 G-KVGLSKNLNGLDLRNNRIYGTLPQGLTQ-LKFLHSLNVSFNNLCGEIPQ  286 (313)
T ss_dssp             G-GCCCCTTCCEEECCSSCCEECCCGGGGG-CTTCCEEECCSSEEEEECCC
T ss_pred             c-ccccccccccccCccCeecccCChHHhC-CCCCCEEECcCCcccccCCC
Confidence            3 4556677777777777777667766554 67777777777777777774
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure