Citrus Sinensis ID: 035924

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
SKISSVTVRADQSSFEQRHIYNYIPTFSLIITMLRPEALYSMFVEDPHVLERMDGAAAAGNNHFAMEMASLKPWLARKLNHLWLSPHARGFVGGIAIDVLFGWLRLSNKEQILKWKDDDGNTALHMRISRVHWKYHIN
cccccEEEEEccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHccHHHHHcccHHHHHHHHHcccHHHHHHccccccccEEEHccccHHHHHHHHHHccccEEEEEcccccccccHHEEEEEEEEccccc
ccEEEEEEEEccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHEEEEEEEEEEcccccEEEEccccccccEEEEEEEEEEEEEcc
skissvtvradqssfeqrhiynyiptFSLIITMLRPEALYSMFVEDPHVLERMDGAAAAGNNHFAMEMASLKPWLARKLNhlwlsphargfvGGIAIDVLFGWLRLSNKEQILKwkdddgntalHMRISRVHWKYHIN
skissvtvradqssfeqrhiynyIPTFSLIITMLRPEALYSMFVEDPHVLERMDGAAAAGNNHFAMEMASLKPWLARKLNHLWLSPHARGFVGGIAIDVLFGWLRLSNKEQILkwkdddgntalhmrisrvhwkyhin
SKISSVTVRADQSSFEQRHIYNYIPTFSLIITMLRPEALYSMFVEDPHVLERMDGAAAAGNNHFAMEMASLKPWLARKLNHLWLSPHARGFVGGIAIDVLFGWLRLSNKEQILKWKDDDGNTALHMRISRVHWKYHIN
****************QRHIYNYIPTFSLIITMLRPEALYSMFVEDPHVLERMDGAAAAGNNHFAMEMASLKPWLARKLNHLWLSPHARGFVGGIAIDVLFGWLRLSNKEQILKWKDDDGNTALHMRISRVHWKYH**
******T************IYNYIPTFSLIITMLRPEALYSMFVEDPHVLERMDGAAAAGNNHFAMEMASLKPWLARKLNHLWLSPHARGFVGGIAIDVLFGWLRLSNKEQILKWKDDDGNTALHMRISRVHWKYHI*
************SSFEQRHIYNYIPTFSLIITMLRPEALYSMFVEDPHVLERMDGAAAAGNNHFAMEMASLKPWLARKLNHLWLSPHARGFVGGIAIDVLFGWLRLSNKEQILKWKDDDGNTALHMRISRVHWKYHIN
**ISSVTVRADQSSFEQRHIYNYIPTFSLIITMLRPEALYSMFVEDPHVLERMDGAAAAGNNHFAMEMASLKPWLARKLNHLWLSPHARGFVGGIAIDVLFGWLRLSNKEQILKWKDDDGNTALHMRISRVHWKYHIN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SKISSVTVRADQSSFEQRHIYNYIPTFSLIITMLRPEALYSMFVEDPHVLERMDGAAAAGNNHFAMEMASLKPWLARKLNHLWLSPHARGFVGGIAIDVLFGWLRLSNKEQILKWKDDDGNTALHMRISRVHWKYHIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
15237015 406 ankyrin repeat-containing protein [Arabi 0.833 0.283 0.359 1e-13
3513742 417 contains similarity to Zea mays embryoge 0.833 0.275 0.340 1e-12
7267770 416 putative ankyrin-repeat-containing prote 0.666 0.221 0.339 4e-05
3513747 1633 contains similarity to reverse transcrip 0.449 0.037 0.4 9e-05
3600030 427 contains similarity to ankyrin repeats ( 0.659 0.213 0.330 9e-05
>gi|15237015|ref|NP_192838.1| ankyrin repeat-containing protein [Arabidopsis thaliana] gi|4539374|emb|CAB40068.1| putative protein [Arabidopsis thaliana] gi|7267798|emb|CAB81201.1| putative protein [Arabidopsis thaliana] gi|332657560|gb|AEE82960.1| ankyrin repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 67/128 (52%), Gaps = 13/128 (10%)

Query: 9   RADQSSFEQRHIYNYIPTFSLIITMLRPEALYSMFVEDPHVLERMDG----------AAA 58
           R+   S +  +IY  + T + +  +   E LY +  EDP++L+  D           AA 
Sbjct: 27  RSSGMSTQDENIYARLKTVAQVGDI---ERLYELIAEDPNILDHFDKVSFCETPLHIAAE 83

Query: 59  AGNNHFAMEMASLKPWLARKLNHLWLSPHARGFVGGIAIDVLFGWLRLSNKEQILKWKDD 118
            G  HFAME+ +LKP LA KLN    SP            VL GW++ +N+++IL WKD+
Sbjct: 84  KGQTHFAMELMTLKPSLALKLNVSGFSPLHLALQNNHIQTVLLGWIKRANRKEILDWKDE 143

Query: 119 DGNTALHM 126
           DGNT  H+
Sbjct: 144 DGNTVFHI 151

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|3513742|gb|AAC33958.1| contains similarity to Zea mays embryogenesis transmembrane protein (GB:X97570) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|7267770|emb|CAB81173.1| putative ankyrin-repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3513747|gb|AAC33963.1| contains similarity to reverse transcriptases (Pfam; rvt.hmm, score: 11.19) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3600030|gb|AAC35518.1| contains similarity to ankyrin repeats (Pfam: ank.hmm, score: 13.93, 14.93 and 27.78) [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
TAIR|locus:2123406 406 AT4G11000 "AT4G11000" [Arabido 0.833 0.283 0.359 1.4e-14
TAIR|locus:2012532 441 AT1G14480 "AT1G14480" [Arabido 0.347 0.108 0.448 1.6e-07
TAIR|locus:2132711 445 AT4G10720 "AT4G10720" [Arabido 0.659 0.204 0.326 0.00011
TAIR|locus:2172099 431 AT5G54620 [Arabidopsis thalian 0.362 0.116 0.35 0.00085
TAIR|locus:2123406 AT4G11000 "AT4G11000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 192 (72.6 bits), Expect = 1.4e-14, P = 1.4e-14
 Identities = 46/128 (35%), Positives = 67/128 (52%)

Query:     9 RADQSSFEQRHIYNYIPTFSLIITMLRPEALYSMFVEDPHVLERMDG----------AAA 58
             R+   S +  +IY  + T + +  +   E LY +  EDP++L+  D           AA 
Sbjct:    27 RSSGMSTQDENIYARLKTVAQVGDI---ERLYELIAEDPNILDHFDKVSFCETPLHIAAE 83

Query:    59 AGNNHFAMEMASLKPWLARKLNHLWLSPHARGFVGGIAIDVLFGWLRLSNKEQILKWKDD 118
              G  HFAME+ +LKP LA KLN    SP            VL GW++ +N+++IL WKD+
Sbjct:    84 KGQTHFAMELMTLKPSLALKLNVSGFSPLHLALQNNHIQTVLLGWIKRANRKEILDWKDE 143

Query:   119 DGNTALHM 126
             DGNT  H+
Sbjct:   144 DGNTVFHI 151
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2012532 AT1G14480 "AT1G14480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132711 AT4G10720 "AT4G10720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172099 AT5G54620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT4G11000
ankyrin repeat family protein; ankyrin repeat family protein; FUNCTIONS IN- protein binding; INVOLVED IN- biological_process unknown; LOCATED IN- cellular_component unknown; EXPRESSED IN- 9 plant structures; EXPRESSED DURING- 8 growth stages; CONTAINS InterPro DOMAIN/s- Ankyrin (InterPro-IPR002110); BEST Arabidopsis thaliana protein match is- ankyrin repeat family protein (TAIR-AT4G10720.1); Has 4707 Blast hits to 2984 proteins in 183 species- Archae - 4; Bacteria - 244; Metazoa - 2377; Fungi - 95; Plants - 892; Viruses - 16; Other Eukaryotes - 1079 (source- NCBI BLink). (406 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
DL3220C
zinc finger (C3HC4-type RING finger) family protein / ankyrin repeat family protein; zinc finge [...] (376 aa)
   •    0.434
AT5G52750
heavy-metal-associated domain-containing protein; heavy-metal-associated domain-containing prot [...] (139 aa)
   •    0.433
AT5G52760
heavy-metal-associated domain-containing protein; heavy-metal-associated domain-containing prot [...] (126 aa)
   •    0.402

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.87
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.84
PHA02791 284 ankyrin-like protein; Provisional 99.77
PHA02791284 ankyrin-like protein; Provisional 99.75
PHA02875 413 ankyrin repeat protein; Provisional 99.75
PHA02741169 hypothetical protein; Provisional 99.74
PHA02875 413 ankyrin repeat protein; Provisional 99.73
KOG0510 929 consensus Ankyrin repeat protein [General function 99.73
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.72
PHA02736154 Viral ankyrin protein; Provisional 99.71
PHA02874 434 ankyrin repeat protein; Provisional 99.7
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.68
PHA02859209 ankyrin repeat protein; Provisional 99.68
PHA03100 480 ankyrin repeat protein; Provisional 99.67
PHA02946 446 ankyin-like protein; Provisional 99.67
PHA02989 494 ankyrin repeat protein; Provisional 99.67
PHA02874 434 ankyrin repeat protein; Provisional 99.67
PHA02878 477 ankyrin repeat protein; Provisional 99.66
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.66
PHA02859209 ankyrin repeat protein; Provisional 99.65
PHA02795 437 ankyrin-like protein; Provisional 99.65
PHA02878 477 ankyrin repeat protein; Provisional 99.65
PHA02884 300 ankyrin repeat protein; Provisional 99.65
KOG0508 615 consensus Ankyrin repeat protein [General function 99.65
PHA02743166 Viral ankyrin protein; Provisional 99.63
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.63
PHA03100 480 ankyrin repeat protein; Provisional 99.62
PHA02798 489 ankyrin-like protein; Provisional 99.62
PHA02876 682 ankyrin repeat protein; Provisional 99.61
PHA02989 494 ankyrin repeat protein; Provisional 99.6
PHA02946 446 ankyin-like protein; Provisional 99.6
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.6
PHA03095 471 ankyrin-like protein; Provisional 99.59
PHA03095 471 ankyrin-like protein; Provisional 99.59
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.58
PHA02798 489 ankyrin-like protein; Provisional 99.58
PHA02876 682 ankyrin repeat protein; Provisional 99.58
KOG0510 929 consensus Ankyrin repeat protein [General function 99.57
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.55
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.54
PHA02917 661 ankyrin-like protein; Provisional 99.52
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.51
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.51
PHA02917 661 ankyrin-like protein; Provisional 99.5
PHA02795 437 ankyrin-like protein; Provisional 99.49
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.49
KOG0514452 consensus Ankyrin repeat protein [General function 99.47
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.47
KOG0508 615 consensus Ankyrin repeat protein [General function 99.46
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.46
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.46
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.45
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.41
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.36
PHA02730 672 ankyrin-like protein; Provisional 99.35
PHA02741169 hypothetical protein; Provisional 99.31
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.29
PHA02743166 Viral ankyrin protein; Provisional 99.29
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.28
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.26
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.25
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.24
PHA02792 631 ankyrin-like protein; Provisional 99.21
PHA02792 631 ankyrin-like protein; Provisional 99.2
PHA02884 300 ankyrin repeat protein; Provisional 99.2
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.19
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.18
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.16
KOG0515 752 consensus p53-interacting protein 53BP/ASPP, conta 99.14
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.14
PHA02730 672 ankyrin-like protein; Provisional 99.14
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.07
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.06
PHA02736154 Viral ankyrin protein; Provisional 99.06
KOG0514452 consensus Ankyrin repeat protein [General function 99.06
KOG0502296 consensus Integral membrane ankyrin-repeat protein 98.95
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.95
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 98.91
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 98.87
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 98.82
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 98.76
KOG4214117 consensus Myotrophin and similar proteins [Transcr 98.74
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 98.73
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 98.63
KOG4214117 consensus Myotrophin and similar proteins [Transcr 98.57
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.42
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 98.36
KOG0522 560 consensus Ankyrin repeat protein [General function 98.33
PF1360630 Ank_3: Ankyrin repeat 98.3
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.29
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.29
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.26
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.05
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.03
PF1360630 Ank_3: Ankyrin repeat 97.89
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.85
KOG0783 1267 consensus Uncharacterized conserved protein, conta 97.53
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 97.52
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 97.46
KOG0783 1267 consensus Uncharacterized conserved protein, conta 97.35
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.33
KOG0511 516 consensus Ankyrin repeat protein [General function 97.21
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 97.19
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.04
KOG0522 560 consensus Ankyrin repeat protein [General function 96.9
KOG2384 223 consensus Major histocompatibility complex protein 96.71
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.59
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 96.08
KOG2384223 consensus Major histocompatibility complex protein 96.02
KOG0705749 consensus GTPase-activating protein Centaurin gamm 95.53
KOG0521785 consensus Putative GTPase activating proteins (GAP 95.39
KOG0521785 consensus Putative GTPase activating proteins (GAP 95.13
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 94.95
KOG0511 516 consensus Ankyrin repeat protein [General function 93.2
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 91.93
KOG2505 591 consensus Ankyrin repeat protein [General function 85.72
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 85.06
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.87  E-value=2.1e-22  Score=148.35  Aligned_cols=108  Identities=18%  Similarity=0.124  Sum_probs=85.0

Q ss_pred             hhccCcHHHHHHhcCCCCCHHHHHHHHhc-CCcccccccH-------HHHccCHHHHHHHhccCCccccccCCCCchHHH
Q 035924           17 QRHIYNYIPTFSLIITMLRPEALYSMFVE-DPHVLERMDG-------AAAAGNNHFAMEMASLKPWLARKLNHLWLSPHA   88 (138)
Q Consensus        17 ~~~~~t~Lh~Aa~~~~~G~~~~v~~Ll~~-~~~~l~~~d~-------Aa~~G~~~~v~~Ll~~~~~~~~~~d~~G~TpLH   88 (138)
                      |..|+||||.||..   |+.++|+.|+.. ++++-..+..       ||..|..+|+++|++.++.+ +.+|+.|.||||
T Consensus        69 DdaGWtPlhia~s~---g~~evVk~Ll~r~~advna~tn~G~T~LHyAagK~r~eIaqlLle~ga~i-~~kD~~~qtplH  144 (226)
T KOG4412|consen   69 DDAGWTPLHIAASN---GNDEVVKELLNRSGADVNATTNGGQTCLHYAAGKGRLEIAQLLLEKGALI-RIKDKQGQTPLH  144 (226)
T ss_pred             cccCCchhhhhhhc---CcHHHHHHHhcCCCCCcceecCCCcceehhhhcCChhhHHHHHHhcCCCC-cccccccCchhH
Confidence            67788999999888   888988888876 5554222221       88899999999988877544 567899999999


Q ss_pred             HHHHH--HHHHHHHHHHhhhcCcccccccccCCCCcHHHHHHhcCCcc
Q 035924           89 RGFVG--GIAIDVLFGWLRLSNKEQILKWKDDDGNTALHMRISRVHWK  134 (138)
Q Consensus        89 ~A~~~--~~~v~~Ll~~~~~~~~~~~vn~~D~~G~TpLHlAa~~g~~~  134 (138)
                      .|+.+  .+++++|++      .++.+|.+|+.|+||||.|...||.+
T Consensus       145 RAAavGklkvie~Li~------~~a~~n~qDk~G~TpL~~al~e~~~d  186 (226)
T KOG4412|consen  145 RAAAVGKLKVIEYLIS------QGAPLNTQDKYGFTPLHHALAEGHPD  186 (226)
T ss_pred             HHHhccchhhHHHHHh------cCCCCCcccccCccHHHHHHhccCch
Confidence            99766  678888886      36779999999999999997777765

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.88
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.85
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.85
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.85
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.84
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.84
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.84
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.84
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.83
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.83
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.83
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.83
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.83
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.83
2rfa_A232 Transient receptor potential cation channel subfa 99.83
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.82
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.82
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.82
2etb_A256 Transient receptor potential cation channel subfam 99.82
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.82
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.82
3hra_A201 Ankyrin repeat family protein; structural protein; 99.82
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.82
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.82
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.82
2rfa_A232 Transient receptor potential cation channel subfa 99.81
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.81
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.81
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.81
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.81
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.8
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.8
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.8
2pnn_A273 Transient receptor potential cation channel subfa 99.8
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.8
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.8
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.8
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.8
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.8
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.8
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.8
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.79
3hra_A201 Ankyrin repeat family protein; structural protein; 99.79
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.79
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 99.79
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.79
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.79
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.79
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.79
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.78
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.78
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.78
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.78
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.78
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.78
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.78
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.78
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.78
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.78
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.77
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.77
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.77
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.77
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.77
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.77
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.77
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.77
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.77
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.76
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.76
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.76
2etb_A256 Transient receptor potential cation channel subfam 99.76
2pnn_A273 Transient receptor potential cation channel subfa 99.75
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.75
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.75
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.75
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.75
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.74
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.74
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.74
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.73
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.73
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.73
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.73
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 99.73
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.73
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.72
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.72
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.71
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.71
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.7
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.7
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.69
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.65
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.65
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.65
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.64
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.59
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.59
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.57
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.56
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.56
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.54
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.53
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.52
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.49
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.47
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.46
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.45
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.43
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.41
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.37
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.0
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.88  E-value=1.2e-22  Score=146.84  Aligned_cols=113  Identities=12%  Similarity=0.029  Sum_probs=94.7

Q ss_pred             CchhhhccCcHHHHHHhcCCCCCHHHHHHHHhcCCccccccc----H---HHHccCHHHHHHHhccCCccccccCCCCch
Q 035924           13 SSFEQRHIYNYIPTFSLIITMLRPEALYSMFVEDPHVLERMD----G---AAAAGNNHFAMEMASLKPWLARKLNHLWLS   85 (138)
Q Consensus        13 ~s~~~~~~~t~Lh~Aa~~~~~G~~~~v~~Ll~~~~~~l~~~d----~---Aa~~G~~~~v~~Ll~~~~~~~~~~d~~G~T   85 (138)
                      .+..+..|.||||.|+..   |+.++++.|++.+.++.....    .   ||..|+.++|++|++.++++ +.+|.+|+|
T Consensus        30 vn~~d~~g~t~l~~a~~~---~~~~~~~~ll~~gad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~gadv-n~~d~~G~T  105 (169)
T 4gpm_A           30 VNASDSDGRTPLHHAAEN---GHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADV-NAKDSDGRT  105 (169)
T ss_dssp             TTCCCTTSCCHHHHHHHT---TCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCT-TCCCTTSCC
T ss_pred             CCCcCCCCCCHHHHHHHc---CCHHHHHHHHhcccchhhhccCCCCHHHHHHHcCCHHHHHHHHHCcCCC-CCCCCCCCC
Confidence            345678899999999999   999999999998765422211    1   99999999999999998886 467999999


Q ss_pred             HHHHHHHH--HHHHHHHHHHhhhcCcccccccccCCCCcHHHHHHhcCCccc
Q 035924           86 PHARGFVG--GIAIDVLFGWLRLSNKEQILKWKDDDGNTALHMRISRVHWKY  135 (138)
Q Consensus        86 pLH~A~~~--~~~v~~Ll~~~~~~~~~~~vn~~D~~G~TpLHlAa~~g~~~~  135 (138)
                      |||+|+..  .++++.|++      .++++|.+|.+|+||||+|+.+|+.++
T Consensus       106 pLh~A~~~g~~~~v~~Ll~------~gad~~~~d~~G~TpL~~A~~~g~~~i  151 (169)
T 4gpm_A          106 PLHHAAENGHKEVVKLLIS------KGADVNTSDSDGRTPLDLAREHGNEEV  151 (169)
T ss_dssp             HHHHHHHTTCHHHHHHHHH------TTCCTTCCCTTSCCHHHHHHHTTCHHH
T ss_pred             HHHHHHHcCCHHHHHHHHH------cCCCccccCCCCCCHHHHHHHcCCHHH
Confidence            99999754  688899886      367899999999999999999998753
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.84
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.83
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.82
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.81
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.8
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.8
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.79
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.79
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.78
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.78
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.75
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.75
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.74
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.73
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.73
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.72
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.69
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.67
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.66
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.66
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.64
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.63
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.62
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.61
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.57
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.57
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.51
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.48
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.45
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.44
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.37
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.25
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Cell cycle inhibitor p16ink4A
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.84  E-value=3.8e-21  Score=130.67  Aligned_cols=105  Identities=12%  Similarity=0.004  Sum_probs=86.1

Q ss_pred             cCcHHHHHHhcCCCCCHHHHHHHHhcCCcccccccH-------HHHccCHHHHHHHhccCCccccccCCCCc-hHHHHHH
Q 035924           20 IYNYIPTFSLIITMLRPEALYSMFVEDPHVLERMDG-------AAAAGNNHFAMEMASLKPWLARKLNHLWL-SPHARGF   91 (138)
Q Consensus        20 ~~t~Lh~Aa~~~~~G~~~~v~~Ll~~~~~~l~~~d~-------Aa~~G~~~~v~~Ll~~~~~~~~~~d~~G~-TpLH~A~   91 (138)
                      ..++||.||+.   |++++|+.||+.+.++ +..+.       +|..|+.++|++|++.++++. ..|..|+ ||||+|+
T Consensus         3 ~~~~L~~Aa~~---G~~~~v~~Ll~~gad~-n~~~~~g~t~l~~a~~g~~~~v~~Ll~~ga~~~-~~~~~~~~~~L~~A~   77 (125)
T d1bi7b_           3 SADWLATAAAR---GRVEEVRALLEAGANP-NAPNSYGRRPIQVMMMGSARVAELLLLHGAEPN-CADPATLTRPVHDAA   77 (125)
T ss_dssp             STTHHHHHHHH---TCHHHHHHHHTTTCCT-TCCCSSSCCTTTSSCTTCHHHHHHHHTTTCCCC-CCCTTTCCCHHHHHH
T ss_pred             ChhHHHHHHHC---CCHHHHHHHHHcCCcc-ccccccccccccccccccccccccccccccccc-ccccccccccccccc
Confidence            45899999999   9999999999976543 22222       667899999999999988764 4566665 7999997


Q ss_pred             HH--HHHHHHHHHHhhhcCcccccccccCCCCcHHHHHHhcCCccc
Q 035924           92 VG--GIAIDVLFGWLRLSNKEQILKWKDDDGNTALHMRISRVHWKY  135 (138)
Q Consensus        92 ~~--~~~v~~Ll~~~~~~~~~~~vn~~D~~G~TpLHlAa~~g~~~~  135 (138)
                      ..  .++++.|++.      ++++|.+|..|+||||+|+.+|+.++
T Consensus        78 ~~g~~~~v~~Ll~~------ga~~~~~d~~G~T~l~~A~~~g~~~~  117 (125)
T d1bi7b_          78 REGFLDTLVVLHRA------GARLDVRDAWGRLPVDLAEELGHRDV  117 (125)
T ss_dssp             HHTCHHHHHHHHHH------TCCSSCCCTTCCCHHHHHHHHTCHHH
T ss_pred             cccccccccccccc------ccccccccCCCCCHHHHHHHcCCHHH
Confidence            65  6888999874      57799999999999999999998764
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure