Citrus Sinensis ID: 036119


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------84
ELKKQLFGKKFLLVLDDVWNENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAERMGADPVYQLKELSDDDCLDFTRHQSLKEVGEQIVIKCGGLPLAAKTLGGLLRGRDDPRDWEFVLKTDIWNLRDSDILPALRLKQCFAYSSLFPKDYEFQDEEIILLWTAEGFLDQEYNGRKMEDLGREFVRELHSRSLFQQSSYDASRFVMHDLINDLARWAAGEICFRMEDTLAGENRQKFSESLRHFSYICGEYDGEKRLKSICDVEHLRTFLPMELSHFDENYLAWSVLQMLLNHLPRLRVFSLCGYRNIFNLPNEIGNLKHLRCLNLSRTKWEEWIPCGAGQEVDEVFPKLRTLSLDNCCKLQGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNWLQISRCPQLISLVTVEEHDQQQPELPCRLQFLELSCCEGLTRLPQALLTLSSLTEMRIHDCASLVSFPQAALPSQLRSVVIEECDALESLPEAWMQNSNSSLECLAIRSCNSLVSFPEVALPSQLRTIIIGGCHALESLPEAWMHNELPATLEHLEVSYCSNLALLSRNGNLPQSLKYLKIEDCSKLESLAERLDNTSLEEISISVLENLKSLPADLHNLHHLQKIWIFGCPNLESFPEEGLPSTKLTELTIYDCENLKALPNCMHNLTSLLNLKISECPSVVSFPEDGFPTNLQSLDVHDLKISKPLLEWGSNRFTSLRRFTIWGGCPDLVSPPPFPASLTNLWISDMPDLESISSIGENLTSLKTLRLSDCPKLKYFSEQGLPKSLLQLHIYACPLIEE
cHHHHccccEEEEEEcccccccHHHHHHHHHHHcccccccEEEEEcccHHHHHHHccccccccccccHHHcHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHccccccccccccccccccHHHHcHHccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccEEccccccEEEccHHHHHHHHHHHccEEEEEccccccccccccccEEEEEEEEcccccccccccccccccEEEEccccccccccccHHHHHHHHHHcccccccEEEEccccccccccccccccccccEEEccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEEcccccEEccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEccccccccccccccccccccEEEEEcccccEEccccccccccccccEEEccccccccccccccccccccEEEEEcccccccccHHHccccccccccEEEEEEccccccccccccccccccEEEEEccccccccccccccccccEEEEEEEcccccccccccccccccEEEEEcccccccccccccccccccEEEEEEccccccccccccccccccEEEEEccccccccccccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEcccccccc
cHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHccccccccccccHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHcHHHcccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHHcccEEEEcccccccccccccccEEEEEEEccccccccccccHcccHHHcccccccccccccccccccccccHHHcccccEEEEEccccccccccccccccccccEEEccccccHcccccccccccccccccHcEEEccccccHHcccccccccccEEEccccccccccccccccccEEEEccccccccccccccccHcHHHHHHHHHHHHcccccHHHHHEEEHccccccccccccHHHHHHHccccccccEEEEEcccccHHccHHcccccccEEEEEcccccccccccccccccccEEEEcccccccEccHHHcccccccccEEEEcccccHccccccccccccEEEEEcccccHccccHHcccccccccccEEEEccccccccccccccccccccEEEEcccccccccccccccccccEEEEcccccHccccccccccccccEEEEccccccccccccccccccccEEEEcccHcHHcccHHccccccccEEEEcccccccccccccccccccEEEEcccHHHccccHHHcccccccEEEEEccccccccccccccccccEEEEcccHcHHHccHHccccccccEEEEcccccccccccccccccccEEEEcccHHHcc
elkkqlfgKKFLLVLDDVWNENysrwselscpfgagaagskiVVTTRNLVVaermgadpvyqlkelsdddcldftrhqSLKEVGEQIVIKCGGLPLAAKTLggllrgrddprdwEFVLKTDiwnlrdsdilpalrlkqcfaysslfpkdyefqdEEIILLWTAEgfldqeyngrkmEDLGREFVRELHSrslfqqssydasRFVMHDLINDLARWAAGEICFRMEDTLAGENRQKFSESLRHFSYICGeydgekrlksicdvehlrtflpmelshfdenYLAWSVLQMLLNHlprlrvfslcgyrnifnlpneignlkhlrclnlsrtkweewipcgagqevdevFPKLRTLSLDNCCKLQGTLPRRLLLLETLDITSCDQLLVTIQclpalselqidgckrvvfssphlvhAVNVREQAYFwrsetrlpqdirslnwlqisrcpqlisLVTVEehdqqqpelpcrlqflelsccegltrlPQALLTLSsltemrihdcaslvsfpqaalpsqlrSVVIEECDAleslpeawmqnsnsslECLAIRscnslvsfpevalpsqlRTIIIGGChaleslpeawmhnelpatlEHLEVSYCSNLallsrngnlpqslkylkiedcSKLESLAErldntsleeISISVLENLkslpadlhNLHHLQKIwifgcpnlesfpeeglpstklteltiydcenlkalpncMHNLTSLLNlkisecpsvvsfpedgfptnlqsldvhdlkiskpllewgsnrftslrrftiwggcpdlvspppfpasltnlwisdmpdlesisSIGENLtslktlrlsdcpklkyfseqglpkSLLQLHIYACPLIEE
elkkqlfgkkflLVLDDVWNENYSRWSELSCpfgagaagskIVVTTRNLVVAERMGADPVYQLKELSDDDCLDFTRHQSLKEVGEQIVIKCGGLPLAAKTLGgllrgrddprdWEFVLKTDIWNLRDSDILPALRLKQCFAYSSLFPKDYEFQDEEIILLWTAEGFLDQEYNGRKMEDLGREFVRELHSRSLFQQSSYDASRFVMHDLINDLARWAAGEICFRMEDTLAGENRQKFSESLRHFSYICGEYDGEKRLKSICDVEHLRTFLPMELSHFDENYLAWSVLQMLLNHLPRLRVFSLCGYRNIFNlpneignlkHLRCLNLSRTKWEEWIPCGAGQEVDEVFPKLRTLSLDNCCKLQGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNWLQISRCPQLISLVTVEEHDQQQPELPCRLQFLELSCCEGLTRLPQALLTLSSLTEMRIHDCASLVSFPQAALPSQLRSVVIEECDALESLPEAWMQNSNSSLECLAIRSCNSLVSFPEVALPSQLRTIIIGGCHALESLPEAWMHNELPATLEHLEVSYCSNLALLSRNGNLPQSLKYLKIEDCSKLESLAERLDNTSLEEISISVLENLKSLPADLHNLHHLQKIWIFGCPNLESFPEEGLPSTKLTELTIYDCENLKALPNCMHNLTSLLNLKISECPSVVSFPEDGFPTNLQSLDVHDLKISKPLLEWGSNRFTSLRRFTIWGGCPDLVSPPPFPASLTNLWISDMPDLESISSIGENLTSLKTLRLSDCPKLKYfseqglpkslLQLHIYACPLIEE
ElkkqlfgkkfllvlDDVWNENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAERMGADPVYQLKELSDDDCLDFTRHQSLKEVGEQIVIKCGGLPLAAKTLGGLLRGRDDPRDWEFVLKTDIWNLRDSDILPALRLKQCFAYSSLFPKDYEFQDEEIILLWTAEGFLDQEYNGRKMEDLGREFVRELHSRSLFQQSSYDASRFVMHDLINDLARWAAGEICFRMEDTLAGENRQKFSESLRHFSYICGEYDGEKRLKSICDVEHLRTFLPMELSHFDENYLAWSVLQMLLNHLPRLRVFSLCGYRNIFNLPNEIGNLKHLRCLNLSRTKWEEWIPCGAGQEVDEVFPKLRTLSLDNCCKlqgtlprrlllletlDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNWLQISRCPQLISLVTVEEHDQQQPELPCRLQFLELSCCEGLTRLPQALLTLSSLTEMRIHDCASLVSFPQAALPSQLRSVVIEECDALESLPEAWMQNSNSSLECLAIRSCNSLVSFPEVALPSQLRTIIIGGCHALESLPEAWMHNELPATLEHLEVSYCSNLALLSRNGNLPQSLKYLKIEDCSKLESLAERLDNTSLEEISISVLENLKSLPADLHNLHHLQKIWIFGCPNLESFPEEGLPSTKLTELTIYDCENLKALPNCMHNLTSLLNLKISECPSVVSFPEDGFPTNLQSLDVHDLKISKPLLEWGSNRFTSLRRFTIWGGCPDLVSPPPFPASLTNLWISDMPDLESISSIGENLTSLKTLRLSDCPKLKYFSEQGLPKSLLQLHIYACPLIEE
*****LFGKKFLLVLDDVWNENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAERMGADPVYQLKELSDDDCLDFTRHQSLKEVGEQIVIKCGGLPLAAKTLGGLLRGRDDPRDWEFVLKTDIWNLRDSDILPALRLKQCFAYSSLFPKDYEFQDEEIILLWTAEGFLDQEYNGRKMEDLGREFVRELHSRSLFQQSSYDASRFVMHDLINDLARWAAGEICFRMEDTLAGENRQKFSESLRHFSYICGEYDGEKRLKSICDVEHLRTFLPMELSHFDENYLAWSVLQMLLNHLPRLRVFSLCGYRNIFNLPNEIGNLKHLRCLNLSRTKWEEWIPCGAGQEVDEVFPKLRTLSLDNCCKLQGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNWLQISRCPQLISLVTVEEHDQQQPELPCRLQFLELSCCEGLTRLPQALLTLSSLTEMRIHDCASLVSFPQAALPSQLRSVVIEECDALESLPEAWMQNSNSSLECLAIRSCNSLVSFPEVALPSQLRTIIIGGCHALESLPEAWMHNELPATLEHLEVSYCSNLALLSRNGNLPQSLKYLKIEDCSKLESLAERLDNTSLEEISISVLENLKSLPADLHNLHHLQKIWIFGCPNLESFPEEGLPSTKLTELTIYDCENLKALPNCMHNLTSLLNLKISECPSVVSFPEDGFPTNLQSLDVHDLKISKPLLEWGSNRFTSLRRFTIWGGCPDLVSPPPFPASLTNLWISDMPDLESISSIGENLTSLKTLRLSDCPKLKYFSEQGLPKSLLQLHIYACPLI**
ELKKQLFGKKFLLVLDDVWNENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAERMGADPVYQLKELSDDDCLDFTRHQSLKEVGEQIVIKCGGLPLAAKTLGGLLRGRDDPRDWEFVLKTDIWNLRDSDILPALRLKQCFAYSSLFPKDYEFQDEEIILLWTAEGFLDQEYNGRKMEDLGREFVRELHSRSLFQQSSYDASRFVMHDLINDLARWAAGEICFRMEDTLAGENRQKFSESLRHFSYICGEYDGEKRLKSICDVEHLRTFLPMELSHFDENYLAWSVLQMLLNHLPRLRVFSLCGYRNIFNLPNEIGNLKHLRCLNLSRTKWEEWIPCGAGQEVDEVFPKLRTLSLDNCCKLQGTLPRRLLLLETLDITSCD***********L***QI******************VREQAYFWRSETRLPQDIRSLNWLQISRCPQLISLVTV*****QQPELPCRLQFLELSCCEGLTRLPQALLTLSSLTEMRIHDCASLVSFPQAALPSQLRSVVIEECDALESLPEAWMQNSNSSLECLAIRSCNSLVSFPEVALPSQLRTIIIGGCHALESLPEAWMHNELPATLEHLEVSYCSNLALLSRNGNLPQSLKYLKIEDCSKLESLAERLDNTSLEEISISVLENLKSLPADLHNLHHLQKIWIFGCPNLESFPEEGLPSTKLTELTIYDCENLKALPNCMHNLTSLLNLKISECPSVVSFPEDGFPTNLQSLDVHDLKISKP********FTSLRRFTIWGGCPDLVSPPPFPASLTNLWISDMPDLESISSIGENLTSLKTLRLSDCPKLKYFSEQGLPKSLLQLHIYACPLIEE
ELKKQLFGKKFLLVLDDVWNENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAERMGADPVYQLKELSDDDCLDFTRHQSLKEVGEQIVIKCGGLPLAAKTLGGLLRGRDDPRDWEFVLKTDIWNLRDSDILPALRLKQCFAYSSLFPKDYEFQDEEIILLWTAEGFLDQEYNGRKMEDLGREFVRELHSRSLFQQSSYDASRFVMHDLINDLARWAAGEICFRMEDTLAGENRQKFSESLRHFSYICGEYDGEKRLKSICDVEHLRTFLPMELSHFDENYLAWSVLQMLLNHLPRLRVFSLCGYRNIFNLPNEIGNLKHLRCLNLSRTKWEEWIPCGAGQEVDEVFPKLRTLSLDNCCKLQGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNWLQISRCPQLISLVTV********ELPCRLQFLELSCCEGLTRLPQALLTLSSLTEMRIHDCASLVSFPQAALPSQLRSVVIEECDALESLPEAWMQNSNSSLECLAIRSCNSLVSFPEVALPSQLRTIIIGGCHALESLPEAWMHNELPATLEHLEVSYCSNLALLSRNGNLPQSLKYLKIEDCSKLESLAERLDNTSLEEISISVLENLKSLPADLHNLHHLQKIWIFGCPNLESFPEEGLPSTKLTELTIYDCENLKALPNCMHNLTSLLNLKISECPSVVSFPEDGFPTNLQSLDVHDLKISKPLLEWGSNRFTSLRRFTIWGGCPDLVSPPPFPASLTNLWISDMPDLESISSIGENLTSLKTLRLSDCPKLKYFSEQGLPKSLLQLHIYACPLIEE
ELKKQLFGKKFLLVLDDVWNENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAERMGADPVYQLKELSDDDCLDFTRHQSLKEVGEQIVIKCGGLPLAAKTLGGLLRGRDDPRDWEFVLKTDIWNLRDSDILPALRLKQCFAYSSLFPKDYEFQDEEIILLWTAEGFLDQEYNGRKMEDLGREFVRELHSRSLFQQSSYDASRFVMHDLINDLARWAAGEICFRMEDTLAGENRQKFSESLRHFSYICGEYDGEKRLKSICDVEHLRTFLPMELSHFDENYLAWSVLQMLLNHLPRLRVFSLCGYRNIFNLPNEIGNLKHLRCLNLSRTKWEEWIPCGAGQEVDEVFPKLRTLSLDNCCKLQGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNWLQISRCPQLISLVTVEEHDQQQPELPCRLQFLELSCCEGLTRLPQALLTLSSLTEMRIHDCASLVSFPQAALPSQLRSVVIEECDALESLPEAWMQNSNSSLECLAIRSCNSLVSFPEVALPSQLRTIIIGGCHALESLPEAWMHNELPATLEHLEVSYCSNLALLSRNGNLPQSLKYLKIEDCSKLESLAERLDNTSLEEISISVLENLKSLPADLHNLHHLQKIWIFGCPNLESFPEEGLPSTKLTELTIYDCENLKALPNCMHNLTSLLNLKISECPSVVSFPEDGFPTNLQSLDVHDLKISKPLLEWGSNRFTSLRRFTIWGGCPDLVSPPPFPASLTNLWISDMPDLESISSIGENLTSLKTLRLSDCPKLKYFSEQGLPKSLLQLHIYACPLIE*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ELKKQLFGKKFLLVLDDVWNENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAERMGADPVYQLKELSDDDCLDFTRHQSLKEVGEQIVIKCGGLPLAAKTLGGLLRGRDDPRDWEFVLKTDIWNLRDSDILPALRLKQCFAYSSLFPKDYEFQDEEIILLWTAEGFLDQEYNGRKMEDLGREFVRELHSRSLFQQSSYDASRFVMHDLINDLARWAAGEICFRMEDTLAGENRQKFSESLRHFSYICGEYDGEKRLKSICDVEHLRTFLPMELSHFDENYLAWSVLQMLLNHLPRLRVFSLCGYRNIFNLPNEIGNLKHLRCLNLSRTKWEEWIPCGAGQEVDEVFPKLRTLSLDNCCKLQGTLPRRLLLLETLDITSCDQLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLNWLQISRCPQLISLVTVEEHDQQQPELPCRLQFLELSCCEGLTRLPQALLTLSSLTEMRIHDCASLVSFPQAALPSQLRSVVIEECDALESLPEAWMQNSNSSLECLAIRSCNSLVSFPEVALPSQLRTIIIGGCHALESLPEAWMHNELPATLEHLEVSYCSNLALLSRNGNLPQSLKYLKIEDCSKLESLAERLDNTSLEEISISVLENLKSLPADLHNLHHLQKIWIFGCPNLESFPEEGLPSTKLTELTIYDCENLKALPNCMHNLTSLLNLKISECPSVVSFPEDGFPTNLQSLDVHDLKISKPLLEWGSNRFTSLRRFTIWGGCPDLVSPPPFPASLTNLWISDMPDLESISSIGENLTSLKTLRLSDCPKLKYFSEQGLPKSLLQLHIYACPLIEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query839 2.2.26 [Sep-21-2011]
Q9LRR41054 Putative disease resistan yes no 0.387 0.308 0.414 3e-62
Q7XA40992 Putative disease resistan N/A no 0.779 0.659 0.307 2e-61
Q9LRR5 1424 Putative disease resistan no no 0.421 0.248 0.376 2e-61
Q7XA39988 Putative disease resistan N/A no 0.768 0.652 0.301 1e-60
Q7XBQ9970 Disease resistance protei N/A no 0.771 0.667 0.310 2e-59
Q7XA42979 Putative disease resistan N/A no 0.774 0.663 0.310 1e-58
Q8RXS5888 Probable disease resistan no no 0.415 0.393 0.259 6e-26
O81825919 Probable disease resistan no no 0.716 0.653 0.263 6e-24
Q8L3R3885 Disease resistance protei no no 0.638 0.605 0.253 4e-23
Q8W3K01138 Probable disease resistan no no 0.860 0.634 0.245 4e-23
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function desciption
 Score =  240 bits (613), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 148/357 (41%), Positives = 215/357 (60%), Gaps = 32/357 (8%)

Query: 1   ELKKQLFGKK--FLLVLDDVWNENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAERMGAD 58
           +LK++L G    FLLVLDD+WNEN++ W  L  PF   A GS+I+VTTR+  VA  M A 
Sbjct: 267 KLKERLTGTGLPFLLVLDDLWNENFADWDLLRQPFIHAAQGSQILVTTRSQRVASIMCAV 326

Query: 59  PVYQLKELSDDDCLD-FTR----------HQSLKEVGEQIVIKCGGLPLAAKTLGGLLRG 107
            V+ L+ LSD DC   F +          ++ + ++ E+IV KC GLPLA KTLGG+LR 
Sbjct: 327 HVHNLQPLSDGDCWSLFMKTVFGNQEPCLNREIGDLAERIVHKCRGLPLAVKTLGGVLRF 386

Query: 108 RDDPRDWEFVLKTDIWNL--RDSDILPALR---------LKQCFAYSSLFPKDYEFQDEE 156
                +WE VL + IW+L    S++LP LR         LK+CFAY S+FPK + F+ ++
Sbjct: 387 EGKVIEWERVLSSRIWDLPADKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDK 446

Query: 157 IILLWTAEGFLDQEYNGRKMEDLGREFVRELHSRSLFQQSSYDASRFVMHDLINDLARWA 216
           ++LLW AEGFL Q  + + +E+LG E+  EL SRSL Q++    +R++MHD IN+LA++A
Sbjct: 447 VVLLWMAEGFLQQTRSSKNLEELGNEYFSELESRSLLQKTK---TRYIMHDFINELAQFA 503

Query: 217 AGEICFRMEDTLAGENRQKFSESLRHFSYICGEYDGEKRLKSICDVEHLRTFLPMELSHF 276
           +GE   + ED      + + SE  R+ SY+   Y      +++ +V+ LRTFLP+ L++ 
Sbjct: 504 SGEFSSKFEDGC----KLQVSERTRYLSYLRDNYAEPMEFEALREVKFLRTFLPLSLTNS 559

Query: 277 DEN-YLAWSVLQMLLNHLPRLRVFSLCGYRNIFNLPNEIGNLKHLRCLNLSRTKWEE 332
             +  L   V + LL  L RLRV SL  Y+     P+   N+ H R L+LSRT+ E+
Sbjct: 560 SRSCCLDQMVSEKLLPTLTRLRVLSLSHYKIARLPPDFFKNISHARFLDLSRTELEK 616




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|Q8W3K0|DRL9_ARATH Probable disease resistance protein At1g58602 OS=Arabidopsis thaliana GN=At1g58602 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query839
359495896 1548 PREDICTED: putative disease resistance p 0.971 0.526 0.368 1e-114
147821539 1094 hypothetical protein VITISV_006408 [Viti 0.887 0.680 0.364 1e-113
297742877861 unnamed protein product [Vitis vinifera] 0.868 0.846 0.365 1e-104
297745513 1243 unnamed protein product [Vitis vinifera] 0.980 0.662 0.344 1e-104
359495054 1347 PREDICTED: putative disease resistance R 0.972 0.605 0.334 1e-104
225465962 1290 PREDICTED: putative disease resistance R 0.973 0.633 0.332 1e-101
357458627 1289 NBS-LRR type disease resistance protein 0.971 0.632 0.328 1e-101
224059590 1381 cc-nbs-lrr resistance protein [Populus t 0.955 0.580 0.342 1e-100
357458569 1234 NBS-LRR type disease resistance protein 0.972 0.661 0.330 1e-100
297736335 2534 unnamed protein product [Vitis vinifera] 0.946 0.313 0.330 2e-99
>gi|359495896|ref|XP_003635111.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  421 bits (1081), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 357/970 (36%), Positives = 491/970 (50%), Gaps = 155/970 (15%)

Query: 2    LKKQLFGKKFLLVLDDVWN-ENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAERMGADPV 60
            L K L GK+FLLVLDDVWN  NY +WS L  PF +GA GSKIVVTTR+  VA  M AD  
Sbjct: 282  LSKILVGKRFLLVLDDVWNINNYEQWSHLQTPFKSGARGSKIVVTTRHTNVASLMRADNY 341

Query: 61   YQL-KELSDDDCLD-FTRHQ----------SLKEVGEQIVIKCGGLPLAAKTLGGLLRGR 108
            + L K LS+DDC + F +H           +L+ +  +I+ KC GLPLAAK LGGLLR +
Sbjct: 342  HHLLKPLSNDDCWNVFVKHAFENKNIDEHPNLRLLDTRIIEKCSGLPLAAKVLGGLLRSK 401

Query: 109  DDPRDWEFVLKTDIWNLRDSDILPALRL---------KQCFAYSSLFPKDYEFQDEEIIL 159
                 WE VL + +WN   S ++P LRL         K+CFAY +LFP+DY+F+ +E+IL
Sbjct: 402  PQ-NQWEHVLSSKMWN--RSGVIPVLRLSYQHLPSHLKRCFAYCALFPRDYKFEQKELIL 458

Query: 160  LWTAEGFL-DQEYNGRKMEDLGREFVRELHSRSLFQQSSYDASRFVMHDLINDLARWAAG 218
            LW AEG + + E    +MEDLG ++  EL SR  FQ SS   S+F+MHDLINDLA+  A 
Sbjct: 459  LWMAEGLIHEAEEEKCQMEDLGADYFDELLSRCFFQPSSNSKSQFIMHDLINDLAQDVAT 518

Query: 219  EICFRMEDTLAGENRQKFSESLRHFSYICGEYDGEKRLKSICDVEHLRTF--LPMELSHF 276
            EICF +      EN  K SE  RH S+I  EYD  K+ + +   E LRTF  LP+ +++ 
Sbjct: 519  EICFNL------ENIHKTSEMTRHLSFIRSEYDVFKKFEVLNKPEQLRTFVALPVTVNNK 572

Query: 277  DENYLAWSVLQMLLNHLPRLRVFSLCGYRNIFNLPNEIGNLKHLRCLNLSRTKWEEWIPC 336
             + YL+  VL  LL  L +LRV SL GY  I  LPN IG+LKHLR LNLS TK  +W+P 
Sbjct: 573  MKCYLSTKVLHGLLPKLIQLRVLSLSGYE-INELPNSIGDLKHLRYLNLSHTKL-KWLP- 629

Query: 337  GAGQEVDEVFPKLRTLSLDNCCKLQGTLPRRLLLLET---LDITSCDQL---------LV 384
               + V  ++  L++L L NC +L   LP  ++ L     LDI+    L         LV
Sbjct: 630  ---EAVSSLY-NLQSLILCNCMELI-KLPICIMNLTNFRHLDISGSTMLEEMPPQVGSLV 684

Query: 385  TIQCLPAL--------------------SELQIDGCKRVVFSSPHLVHAVNVRE------ 418
             +Q L                        EL I G + V  S P     VN++E      
Sbjct: 685  NLQTLSMFFLSKDNGSRIKELKNLLNLRGELAIIGLENV--SDPRDAMYVNLKEIPNIED 742

Query: 419  QAYFWRSETRLPQD----IRSLNWLQISRCPQLISLV----TVEEHDQQQPELPCRLQFL 470
                W  ++   ++    I  L WLQ  +  + + +     +   H    P    ++  L
Sbjct: 743  LIMVWSEDSGNSRNESTVIEVLKWLQPHQSLKKLEIAFYGGSKFPHWIGDPSF-SKMVCL 801

Query: 471  ELSCCEGLTRLPQALLTLSSLTEMRIHDCASLVS-----FPQAALPSQ------------ 513
            EL+ C+  T LP AL  L  L ++ I     + S     +   A P Q            
Sbjct: 802  ELTDCKNCTSLP-ALGGLPFLKDLVIEGMNQVKSIGDGFYGDTANPFQSLEYLRFENMAE 860

Query: 514  -----------LRSVVIEECDALESLPEAWMQNSN-SSLECLAIRSCNSLVSFPEVALPS 561
                       L  + I ECD L  L +      N   L  L I  C+ +VS  E  LP 
Sbjct: 861  WNNWLAQRLMVLEDLGINECDELACLRKPGFGLENLGGLRRLWINGCDGVVSLEEQGLPC 920

Query: 562  QLRTIIIGGCHALESLPEAW----------MHN----------ELPATLEHLEVSYCSNL 601
             L+ + + GC  LE LP A           +HN           LP  L  L V  C  L
Sbjct: 921  NLQYLEVKGCSNLEKLPNALYTLASLAYTIIHNCPKLVSFPETGLPPMLRDLSVRNCEGL 980

Query: 602  ALLSRNGNLPQS--LKYLKIEDCSKLESLAERLDNTSLEEISISVLENLKSLP--ADLHN 657
              L  +G +  S  L+ ++I DC  L    +R    +L+ + I   E L+SLP   D +N
Sbjct: 981  ETLP-DGMMINSCALERVEIRDCPSLIGFPKRELPVTLKMLIIENCEKLESLPEGIDNNN 1039

Query: 658  LHHLQKIWIFGCPNLESFPEEGLPSTKLTELTIYDCENLKALP-NCMHNLTSLLNLKISE 716
               L+K+ + GCP+L+S P    PST L  L+I+ C  L+++P N + NLTSL  L I  
Sbjct: 1040 TCRLEKLHVCGCPSLKSIPRGYFPST-LETLSIWGCLQLQSIPGNMLQNLTSLQFLHICN 1098

Query: 717  CPSVVSFPEDGFPTNLQSLDVHDLKISK-PLLEWGSNRFTSLRRFTIWGGCPDLVSPPP- 774
            CP VVS PE     NL++L + D +  + PL  WG    TSL    I G  PDL+S    
Sbjct: 1099 CPDVVSSPEAFLNPNLKALSITDCENMRWPLSGWGLRTLTSLDELGIHGPFPDLLSFSGS 1158

Query: 775  ---FPASLTNLWISDMPDLESISSIG-ENLTSLKTLRLSDCPKLKYF-SEQGLPKSLLQL 829
                P SLT L + ++ +L+S++S+G  +L SLK+L    CPKL+ F  ++GLP +L +L
Sbjct: 1159 HLLLPTSLTYLGLVNLHNLKSVTSMGLRSLMSLKSLEFYSCPKLRSFVPKEGLPPTLARL 1218

Query: 830  HIYACPLIEE 839
             I+ CP++++
Sbjct: 1219 VIWECPILKK 1228




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147821539|emb|CAN67781.1| hypothetical protein VITISV_006408 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742877|emb|CBI35642.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745513|emb|CBI40678.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495054|ref|XP_002267622.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225465962|ref|XP_002269685.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357458627|ref|XP_003599594.1| NBS-LRR type disease resistance protein [Medicago truncatula] gi|355488642|gb|AES69845.1| NBS-LRR type disease resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224059590|ref|XP_002299922.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222847180|gb|EEE84727.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357458569|ref|XP_003599565.1| NBS-LRR type disease resistance protein [Medicago truncatula] gi|355488613|gb|AES69816.1| NBS-LRR type disease resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297736335|emb|CBI24973.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query839
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.319 0.188 0.388 4.5e-74
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.295 0.235 0.416 5.7e-51
TAIR|locus:2163426 1187 TAO1 "target of AVRB operation 0.407 0.288 0.293 2.1e-28
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.205 0.095 0.333 8.1e-28
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.452 0.293 0.270 3.6e-26
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.418 0.177 0.274 6.2e-26
TAIR|locus:20981101219 AT3G44670 [Arabidopsis thalian 0.660 0.454 0.260 1.6e-23
TAIR|locus:2098145 1240 AT3G44630 [Arabidopsis thalian 0.386 0.261 0.254 3e-22
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.634 0.599 0.237 6.6e-22
TAIR|locus:5049561821049 AT1G58848 [Arabidopsis thalian 0.240 0.192 0.279 2.6e-21
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 460 (167.0 bits), Expect = 4.5e-74, Sum P(2) = 4.5e-74
 Identities = 113/291 (38%), Positives = 164/291 (56%)

Query:    77 HQSLKEVGEQIVIKCGGLPLAAKTLGGLLRGRDDPRDWEFVLKTDIWNLRDSDILPALRL 136
             +Q L+ +G++I  +C GLPLAA+ +   LR + +P DW  V K   ++   + ILP L+L
Sbjct:   352 NQELEGIGKRIAEQCKGLPLAARAIASHLRSKPNPDDWYAVSKN--FSSYTNSILPVLKL 409

Query:   137 ---------KQCFAYSSLFPKDYEFQDEEIILLWTAEGFLDQEYNGRKMEDLGREFVREL 187
                      K+CFA  S+FPK + F  EE++LLW A   L Q  + R++ED+G +++ +L
Sbjct:   410 SYDSLPPQLKRCFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLEDIGNDYLGDL 469

Query:   188 HSRSLFQQSSYDASRFVMHDLINDLARWAAGEICFRMEDTLAGENRQKFSESLRHFSYIC 247
              ++S FQ+     + FVMHDL+NDLA+  +G+ CFR+ED    +N  +   + RHFS+  
Sbjct:   470 VAQSFFQRLDITMTSFVMHDLMNDLAKAVSGDFCFRLED----DNIPEIPSTTRHFSFSR 525

Query:   248 GEYDGEKRLKSICDVEHLRTFLPMEL-SHFDENYLAWSVLQMLLNHLPRLRVFSLCGYRN 306
              + D     +SIC  E LRT LP    +  +   L   VL  LLN L  LR+ SL  Y+ 
Sbjct:   526 SQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQ- 584

Query:   307 IFNLPNEIGNLKHLRCLNLSRTKWEEWIPCGAGQEVDEVFPKLRTLSLDNC 357
             I NLP  +  LK LR L+LS TK +E +P     E       L+TL L NC
Sbjct:   585 ITNLPKSLKGLKLLRYLDLSSTKIKE-LP-----EFVCTLCNLQTLLLSNC 629


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098145 AT3G44630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query839
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-40
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-15
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-11
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-07
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-07
PRK15386426 PRK15386, PRK15386, type III secretion protein Gog 1e-05
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score =  150 bits (380), Expect = 2e-40
 Identities = 73/194 (37%), Positives = 106/194 (54%), Gaps = 26/194 (13%)

Query: 1   ELKKQLFGKKFLLVLDDVWNENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAERMGA-DP 59
           ++K+ L  K+FLLVLDDVW +N   W ++  PF  G  GS+++VTTR+  VA RMG    
Sbjct: 92  KIKEALLRKRFLLVLDDVWEKN--DWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGTSK 149

Query: 60  VYQLKELSDDDCLDF----------TRHQSLKEVGEQIVIKCGGLPLAAKTLGGLLRGRD 109
            ++++ L  ++  +                L+EV ++IV KC GLPLA K LGGLL  + 
Sbjct: 150 PHEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKS 209

Query: 110 DPRDWEFVLKTDIWNLRDSD----ILPALR---------LKQCFAYSSLFPKDYEFQDEE 156
             ++WE VL+     L   D    +L  L          LK+CF Y +LFP+DY  + E+
Sbjct: 210 TVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIRKEQ 269

Query: 157 IILLWTAEGFLDQE 170
           +I LW AEGF+   
Sbjct: 270 LIKLWIAEGFVIPS 283


Length = 285

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 839
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.89
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.59
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.41
KOG4237498 consensus Extracellular matrix protein slit, conta 99.37
KOG4237498 consensus Extracellular matrix protein slit, conta 99.37
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.36
KOG0617264 consensus Ras suppressor protein (contains leucine 99.19
KOG0617264 consensus Ras suppressor protein (contains leucine 99.19
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.12
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.02
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.74
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.66
KOG4341483 consensus F-box protein containing LRR [General fu 98.63
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.6
PRK15386 426 type III secretion protein GogB; Provisional 98.58
KOG4341483 consensus F-box protein containing LRR [General fu 98.58
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.44
PLN03150623 hypothetical protein; Provisional 98.4
PRK15386426 type III secretion protein GogB; Provisional 98.4
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.34
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.33
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.32
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.28
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.26
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.25
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.18
PLN03150623 hypothetical protein; Provisional 98.15
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.83
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.61
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.6
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.54
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.43
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.41
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.37
PRK04841903 transcriptional regulator MalT; Provisional 97.2
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.16
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.96
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.86
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 96.83
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.75
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.62
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.5
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.29
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.15
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.07
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.76
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.93
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.87
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.86
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 94.45
KOG2123 388 consensus Uncharacterized conserved protein [Funct 93.75
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.66
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 93.28
PF05729166 NACHT: NACHT domain 93.08
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.56
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.04
PF13173128 AAA_14: AAA domain 90.74
KOG2123388 consensus Uncharacterized conserved protein [Funct 89.94
PRK06893229 DNA replication initiation factor; Validated 89.92
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 89.13
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 87.29
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.01
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 85.91
smart0037026 LRR Leucine-rich repeats, outliers. 84.2
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.2
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 83.5
PRK07471365 DNA polymerase III subunit delta'; Validated 83.18
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.4e-58  Score=525.46  Aligned_cols=481  Identities=31%  Similarity=0.523  Sum_probs=356.6

Q ss_pred             hhhhcCCCcEEEEEeccCCCChhhHhhhhcccCCCCCCCEEEEEecChHHHHH-hCCCCeEeCCCCCcccccCcC-----
Q 036119            2 LKKQLFGKKFLLVLDDVWNENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAER-MGADPVYQLKELSDDDCLDFT-----   75 (839)
Q Consensus         2 l~~~l~~k~~LlvLDdv~~~~~~~~~~l~~~~~~~~~gs~iivTtr~~~v~~~-~~~~~~~~~~~l~~~~~~~~~-----   75 (839)
                      |.+.|++|||+|||||||+.  .+|+.++.+++....||||++|||++.||.. |++...++++.|..+|||..|     
T Consensus       254 i~~~L~~krfllvLDDIW~~--~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~  331 (889)
T KOG4658|consen  254 LLNLLEGKRFLLVLDDIWEE--VDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVG  331 (889)
T ss_pred             HHHHhccCceEEEEeccccc--ccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhc
Confidence            67889999999999999997  6799999999999899999999999999988 888899999999999999332     


Q ss_pred             -----CCchHHHHHHHHHHHhCCChHHHHHHHHHhcCCCChhHHHHHHhccccccCC------CCCcchhc---------
Q 036119           76 -----RHQSLKEVGEQIVIKCGGLPLAAKTLGGLLRGRDDPRDWEFVLKTDIWNLRD------SDILPALR---------  135 (839)
Q Consensus        76 -----~~~~~~~~~~~i~~~c~glPlal~~~g~~L~~~~~~~~w~~~~~~~~~~~~~------~~~~~~l~---------  135 (839)
                           .++.+.++|++||++|+|+|||++++|++|+.|++.++|+++.+...+....      +.+++.|+         
T Consensus       332 ~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~  411 (889)
T KOG4658|consen  332 PNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEE  411 (889)
T ss_pred             cccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHH
Confidence                 2355899999999999999999999999999999999999999865444222      14556666         


Q ss_pred             hhhhhhhhccCCCCcccChhHHHHHHHHcCCCcccCCCCCHHHHHHHHHHHHHhcccccccc--CCCcceeecHHHHHHH
Q 036119          136 LKQCFAYSSLFPKDYEFQDEEIILLWTAEGFLDQEYNGRKMEDLGREFVRELHSRSLFQQSS--YDASRFVMHDLINDLA  213 (839)
Q Consensus       136 ~k~~f~~~a~f~~~~~~~~~~li~~w~~~g~~~~~~~~~~~e~~~~~~~~~L~~~~ll~~~~--~~~~~~~mHdlv~~la  213 (839)
                      +|.||+|||+||+||.|+++++|.+|+|+||+.+...++.+++.|..|+.+||.+++++...  .....|+|||+|||||
T Consensus       412 lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~a  491 (889)
T KOG4658|consen  412 LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMA  491 (889)
T ss_pred             HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHH
Confidence            89999999999999999999999999999999986678999999999999999999999875  2468899999999999


Q ss_pred             HHHcc-----CceEEeccc--ccccccccccccceEEEEEccccchhhcccccccccccccccccccccccchhhhHHHH
Q 036119          214 RWAAG-----EICFRMEDT--LAGENRQKFSESLRHFSYICGEYDGEKRLKSICDVEHLRTFLPMELSHFDENYLAWSVL  286 (839)
Q Consensus       214 ~~i~~-----~e~~~~~~~--~~~~~~~~~~~~~r~ls~~~~~~~~~~~~~~~~~~~~Lr~l~~~~~~~~~~~~~~~~~~  286 (839)
                      .|+++     +|...+...  .........+..+|+++.+.....   .+..-..++.|++|+..+...     ....+.
T Consensus       492 l~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~---~~~~~~~~~~L~tLll~~n~~-----~l~~is  563 (889)
T KOG4658|consen  492 LWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIE---HIAGSSENPKLRTLLLQRNSD-----WLLEIS  563 (889)
T ss_pred             HHHhccccccccceEEECCcCccccccccchhheeEEEEeccchh---hccCCCCCCccceEEEeecch-----hhhhcC
Confidence            99999     554443331  111222334467899998876532   334445566899996654321     235566


Q ss_pred             HHHhcCCCceeEEEeCCCcccccccccccCcCcCcEeEecCccccccccCCCCCCccccCCCccEEeccCccccccCCCc
Q 036119          287 QMLLNHLPRLRVFSLCGYRNIFNLPNEIGNLKHLRCLNLSRTKWEEWIPCGAGQEVDEVFPKLRTLSLDNCCKLQGTLPR  366 (839)
Q Consensus       287 ~~~~~~l~~L~~L~L~~~~~~~~lp~~i~~L~~L~~L~L~~~~~~~~~p~~~~~~~~~~l~~L~~L~L~~~~~l~~~lp~  366 (839)
                      .++|..++.||+|||++|...+.+|++|++|.|||||+++++.+ ..+|.++.+     |.+|.+|++.++..+. .+|.
T Consensus       564 ~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I-~~LP~~l~~-----Lk~L~~Lnl~~~~~l~-~~~~  636 (889)
T KOG4658|consen  564 GEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGI-SHLPSGLGN-----LKKLIYLNLEVTGRLE-SIPG  636 (889)
T ss_pred             HHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCc-cccchHHHH-----HHhhheeccccccccc-cccc
Confidence            77899999999999999987899999999999999999999999 579999888     9999999999876554 4453


Q ss_pred             ---CCCCccEEeecccC-----cccccCCCCCCccEEEeccccceeecCCCccceeeecccccccccccccCCCCCCCC-
Q 036119          367 ---RLLLLETLDITSCD-----QLLVTIQCLPALSELQIDGCKRVVFSSPHLVHAVNVREQAYFWRSETRLPQDIRSLN-  437 (839)
Q Consensus       367 ---~l~~L~~L~l~~~~-----~l~~~l~~l~~L~~L~l~~~~~~~~~~~~~l~~l~l~~l~~~~~~~~~~~~~~~~L~-  437 (839)
                         .|.+|++|.+....     .....+.++.+|+.++........+...                      .....|. 
T Consensus       637 i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l----------------------~~~~~L~~  694 (889)
T KOG4658|consen  637 ILLELQSLRVLRLPRSALSNDKLLLKELENLEHLENLSITISSVLLLEDL----------------------LGMTRLRS  694 (889)
T ss_pred             hhhhcccccEEEeeccccccchhhHHhhhcccchhhheeecchhHhHhhh----------------------hhhHHHHH
Confidence               58899999876543     2234556666666666644332000000                      0000010 


Q ss_pred             ---ceecccCCCcccccccccccCCCCCCcCCceEEEeccCCCCCccccccC------CCCCccEEeecCCCCCcccCCC
Q 036119          438 ---WLQISRCPQLISLVTVEEHDQQQPELPCRLQFLELSCCEGLTRLPQALL------TLSSLTEMRIHDCASLVSFPQA  508 (839)
Q Consensus       438 ---~L~l~~~~~l~~~~~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~~l~------~l~~L~~L~l~~~~~~~~l~~~  508 (839)
                         .+.+.++..       ......++.+ .+|+.|.+.+|.+.+....+..      .++++..+.+.+|.........
T Consensus       695 ~~~~l~~~~~~~-------~~~~~~~~~l-~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~  766 (889)
T KOG4658|consen  695 LLQSLSIEGCSK-------RTLISSLGSL-GNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWL  766 (889)
T ss_pred             HhHhhhhccccc-------ceeecccccc-cCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccccccccchh
Confidence               000000000       0001122222 5777777777766432222211      1456666667777666666655


Q ss_pred             CCCCCccEEEeccCccccccc
Q 036119          509 ALPSQLRSVVIEECDALESLP  529 (839)
Q Consensus       509 ~~~~~L~~L~l~~~~~l~~~~  529 (839)
                      ..+|+|+.|.+..|..++.+.
T Consensus       767 ~f~~~L~~l~l~~~~~~e~~i  787 (889)
T KOG4658|consen  767 LFAPHLTSLSLVSCRLLEDII  787 (889)
T ss_pred             hccCcccEEEEecccccccCC
Confidence            667888888888877666554



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query839
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 6e-05
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 46.6 bits (109), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 62/231 (26%), Positives = 95/231 (41%), Gaps = 37/231 (16%) Query: 502 LVSFP-QAALPSQLRSVVIEECDALESLPEAWMQNSNSSLECLAIRSCNSLVSFP-EVAL 559 L FP QA S L+ I+ L LP+ Q + LE L + + N L + P +A Sbjct: 93 LPQFPDQAFRLSHLQHXTIDAA-GLXELPDTXQQFA--GLETLTL-ARNPLRALPASIAS 148 Query: 560 PSQLRTIIIGGCHALESLPEAWMHNELPA------TLEHLEVSYCSNLALLSRNGNLPQS 613 ++LR + I C L LPE + L+ L + + +L + NL Q+ Sbjct: 149 LNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANL-QN 207 Query: 614 LKYLKIEDCSKLESLAERLDNTSLEEISISVLENLKSLPADLHNLHHLQKIWIFGCPNLE 673 LK LKI + L +L +H+L L+++ + GC L Sbjct: 208 LKSLKIRNSP------------------------LSALGPAIHHLPKLEELDLRGCTALR 243 Query: 674 SFPEEGLPSTKLTELTIYDCENLKALPNCMHNLTSLLNLKISECPSVVSFP 724 ++P L L + DC NL LP +H LT L L + C ++ P Sbjct: 244 NYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLP 294

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query839
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 3e-66
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 8e-49
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-32
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-14
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-11
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 7e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-09
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-09
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 3e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 4e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  230 bits (589), Expect = 3e-66
 Identities = 60/364 (16%), Positives = 126/364 (34%), Gaps = 76/364 (20%)

Query: 1   ELKKQLFGK--KFLLVLDDVWNENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAERMGAD 58
            L+  +  K  + LL+LDDVW+    +            +  +I++TTR+  V + +   
Sbjct: 226 RLRILMLRKHPRSLLILDDVWDSWVLKA---------FDSQCQILLTTRDKSVTDSVMGP 276

Query: 59  --PVYQLKELSDDDCLD------FTRHQSLKEVGEQIVIKCGGLPLAAKTLGGLLRGRDD 110
              V     L  +  L+        +   L E    I+ +C G PL    +G LLR   +
Sbjct: 277 KYVVPVESSLGKEKGLEILSLFVNMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPN 336

Query: 111 -PRDWEFVLKTDIW-------NLRDSDILPALR---------LKQCFAYSSLFPKDYEFQ 153
               +   L+   +       +     +  A+          +K  +   S+  KD +  
Sbjct: 337 RWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVP 396

Query: 154 DEEIILLWTAEGFLDQEYNGRKMEDLGREFVRELHSRSLFQQSSYD-ASRFVMHDLINDL 212
            + + +LW  E             +   + ++E  ++SL        + R+ +HDL  D 
Sbjct: 397 TKVLCILWDME------------TEEVEDILQEFVNKSLLFCDRNGKSFRYYLHDLQVDF 444

Query: 213 ARWAAGEICFRMEDTLAGENRQKFSESLRHFSYICGEYDGEKR----------LKSICDV 262
                 + C +++D     +++  ++  R+        D E            + S    
Sbjct: 445 LT---EKNCSQLQD----LHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYHMASAKMH 497

Query: 263 EHLRTFLPMELSHFDENYLAWSVLQMLLNHLPRLRVFSLCGYRNIFNLPNEIGNLKHLRC 322
           + L   +      F  +++      +   HL    +     YR+I +  +   +      
Sbjct: 498 KELCALM------FSLDWIKAKTELVGPAHL----IHEFVEYRHILDEKDCAVSENFQEF 547

Query: 323 LNLS 326
           L+L+
Sbjct: 548 LSLN 551


>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query839
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.98
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.86
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.84
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.83
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.83
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.8
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.75
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.75
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.75
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.74
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.73
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.73
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.73
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.73
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.73
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.73
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.68
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.67
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.66
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.63
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.63
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.62
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.61
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.61
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.57
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.55
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.55
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.53
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.53
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.52
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.51
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.49
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.45
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.45
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.44
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.42
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.4
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.39
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.39
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.39
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.38
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.37
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.35
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.33
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.32
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.3
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.29
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.29
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.27
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.27
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.25
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.25
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.24
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.19
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.19
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.15
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.14
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.14
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.14
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.01
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.01
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.97
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.96
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.92
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.88
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.86
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.86
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.85
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.83
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.83
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.78
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.74
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.73
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.6
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.51
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.51
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.42
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.29
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.25
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.24
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.07
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.95
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.71
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.69
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.61
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.46
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.34
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.17
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.14
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.07
2fna_A357 Conserved hypothetical protein; structural genomic 97.07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.03
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 96.41
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.87
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.89
2chg_A226 Replication factor C small subunit; DNA-binding pr 92.23
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 91.81
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 90.87
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 89.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 88.26
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 87.75
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 87.74
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 86.09
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 82.71
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.6e-44  Score=420.84  Aligned_cols=531  Identities=17%  Similarity=0.097  Sum_probs=346.2

Q ss_pred             hcCCCceeEEEeCCCcccccccc--cccCcCcCcEeEecCccccccccCCC-CC-------------------C---ccc
Q 036119          290 LNHLPRLRVFSLCGYRNIFNLPN--EIGNLKHLRCLNLSRTKWEEWIPCGA-GQ-------------------E---VDE  344 (839)
Q Consensus       290 ~~~l~~L~~L~L~~~~~~~~lp~--~i~~L~~L~~L~L~~~~~~~~~p~~~-~~-------------------~---~~~  344 (839)
                      |..+++|++|+|++|.+.+.+|.  .++++++|++|++++|.+.+.+|..+ ..                   .   ..+
T Consensus        96 ~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~  175 (768)
T 3rgz_A           96 FKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSD  175 (768)
T ss_dssp             CCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTT
T ss_pred             hccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhc
Confidence            45555555555555553344444  55555555555555555544444332 22                   0   011


Q ss_pred             cCCCccEEeccCccccccCCC-cCCCCccEEeecccC--cccccCCCCCCccEEEecccccee-----ecCCCccceeee
Q 036119          345 VFPKLRTLSLDNCCKLQGTLP-RRLLLLETLDITSCD--QLLVTIQCLPALSELQIDGCKRVV-----FSSPHLVHAVNV  416 (839)
Q Consensus       345 ~l~~L~~L~L~~~~~l~~~lp-~~l~~L~~L~l~~~~--~l~~~l~~l~~L~~L~l~~~~~~~-----~~~~~~l~~l~l  416 (839)
                      .+++|++|++++| .+.+..| ..+.+|++|++++|.  ..+..++.+++|++|++++|....     +.....++.+++
T Consensus       176 ~l~~L~~L~Ls~n-~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L  254 (768)
T 3rgz_A          176 GCGELKHLAISGN-KISGDVDVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNI  254 (768)
T ss_dssp             CCTTCCEEECCSS-EEESCCBCTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEEC
T ss_pred             cCCCCCEEECCCC-cccccCCcccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEEC
Confidence            1444444444443 3333333 245555555555554  112225556666666666555331     223344444444


Q ss_pred             cccccccccccccCCCCCCCCceecccCCCcccccccccccCCCCCCcCCceEEEeccCCCCCccccccCCCCCccEEee
Q 036119          417 REQAYFWRSETRLPQDIRSLNWLQISRCPQLISLVTVEEHDQQQPELPCRLQFLELSCCEGLTRLPQALLTLSSLTEMRI  496 (839)
Q Consensus       417 ~~l~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l  496 (839)
                      .........+.   ..+++|+.|++.++.-....+      ..+....++|+.|++++|.+.+.+|..++.+++|++|++
T Consensus       255 s~n~l~~~~~~---~~l~~L~~L~L~~n~l~~~ip------~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L  325 (768)
T 3rgz_A          255 SSNQFVGPIPP---LPLKSLQYLSLAENKFTGEIP------DFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLAL  325 (768)
T ss_dssp             CSSCCEESCCC---CCCTTCCEEECCSSEEEESCC------CCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEEC
T ss_pred             CCCcccCccCc---cccCCCCEEECcCCccCCccC------HHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEEC
Confidence            43332221111   145556666665543211111      111122257788888888776677777888888888888


Q ss_pred             cCCCCCcccCC--CCCCCCccEEEeccCccccccchhhhhCCCC-ccceEecccCCCCcCCCC-CCC--CCCccEEEEcC
Q 036119          497 HDCASLVSFPQ--AALPSQLRSVVIEECDALESLPEAWMQNSNS-SLECLAIRSCNSLVSFPE-VAL--PSQLRTIIIGG  570 (839)
Q Consensus       497 ~~~~~~~~l~~--~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~-~L~~L~l~~~~~l~~~~~-~~~--~~~L~~L~l~~  570 (839)
                      ++|...+.+|.  ...+++|++|++++|.....+|..+.  .++ +|+.|++++|.....++. ...  +++|+.|++++
T Consensus       326 ~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~--~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~  403 (768)
T 3rgz_A          326 SSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT--NLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN  403 (768)
T ss_dssp             CSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHH--HHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCS
T ss_pred             CCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHH--hhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCC
Confidence            88765555554  34577888888888776556665442  223 788888888766554442 222  56788888888


Q ss_pred             CCCCcCCchhhhcccCCCCcceEEEeecCCcccccCCCCcccccceeEeccCCCchhhhhhcC-CCCcceeeeccccccc
Q 036119          571 CHALESLPEAWMHNELPATLEHLEVSYCSNLALLSRNGNLPQSLKYLKIEDCSKLESLAERLD-NTSLEEISISVLENLK  649 (839)
Q Consensus       571 ~~~l~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~-~~~L~~L~l~~~~~~~  649 (839)
                      |.....+|..+...   ++|+.|++++|......+.....+++|+.|++++|.....++..+. .++|+.|++++|++.+
T Consensus       404 n~l~~~~p~~l~~l---~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~  480 (768)
T 3rgz_A          404 NGFTGKIPPTLSNC---SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTG  480 (768)
T ss_dssp             SEEEEECCGGGGGC---TTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCS
T ss_pred             CccccccCHHHhcC---CCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccC
Confidence            86555666554332   4788888888865545554444456788888888877666665544 4889999999998888


Q ss_pred             CccccccCCCCCCeEEecCCCCCcccCCCCCCCCCcceEecccccccccccccCcccccccccccccccCCccCCCC---
Q 036119          650 SLPADLHNLHHLQKIWIFGCPNLESFPEEGLPSTKLTELTIYDCENLKALPNCMHNLTSLLNLKISECPSVVSFPED---  726 (839)
Q Consensus       650 ~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~lp~~l~~l~~L~~L~l~~~~~~~~~~~~---  726 (839)
                      .+|..+..+++|++|++++|...+.+|..+..+++|++|++++|+..+.+|..+..+++|+.|++++|++...+|..   
T Consensus       481 ~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~  560 (768)
T 3rgz_A          481 EIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFK  560 (768)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGT
T ss_pred             cCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhc
Confidence            88888888999999999999888888888888889999999999888888888888999999999988877555521   


Q ss_pred             --------------------------------------------------------------------CCCCCcceEEec
Q 036119          727 --------------------------------------------------------------------GFPTNLQSLDVH  738 (839)
Q Consensus       727 --------------------------------------------------------------------~~~~~L~~L~l~  738 (839)
                                                                                          ..+++|++|+++
T Consensus       561 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs  640 (768)
T 3rgz_A          561 QSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMS  640 (768)
T ss_dssp             TTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECC
T ss_pred             ccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECc
Confidence                                                                                124678899999


Q ss_pred             CCCCCCccccccCCCccccceEEEecCCCCCcCCCC---CCcccceeeecCCCCCCccccCCCCCCccCeeeccCCCCcc
Q 036119          739 DLKISKPLLEWGSNRFTSLRRFTIWGGCPDLVSPPP---FPASLTNLWISDMPDLESISSIGENLTSLKTLRLSDCPKLK  815 (839)
Q Consensus       739 ~~~~~~~~~~~~~~~l~~L~~l~l~~~~~~~~~~~~---~~~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~c~~l~  815 (839)
                      +|++.+.+|.. +..+++|+.|++++|-.. ..+|.   -+++|+.||+++|...+.+|..+..+++|+.|++++|+--.
T Consensus       641 ~N~l~g~ip~~-l~~l~~L~~L~Ls~N~l~-g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g  718 (768)
T 3rgz_A          641 YNMLSGYIPKE-IGSMPYLFILNLGHNDIS-GSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSG  718 (768)
T ss_dssp             SSCCBSCCCGG-GGGCTTCCEEECCSSCCC-SCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEE
T ss_pred             CCcccccCCHH-HhccccCCEEeCcCCccC-CCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccc
Confidence            99999887763 577889999999885322 23443   35689999999999988999889999999999999996666


Q ss_pred             ccCCCCCCcccceeeecCCCCC
Q 036119          816 YFSEQGLPKSLLQLHIYACPLI  837 (839)
Q Consensus       816 ~l~~~~~~~sL~~L~i~~c~~l  837 (839)
                      .+|..+.+.++....+.|||.|
T Consensus       719 ~iP~~~~~~~~~~~~~~gN~~L  740 (768)
T 3rgz_A          719 PIPEMGQFETFPPAKFLNNPGL  740 (768)
T ss_dssp             ECCSSSSGGGSCGGGGCSCTEE
T ss_pred             cCCCchhhccCCHHHhcCCchh
Confidence            7887776667777777787754



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 839
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 84.5 bits (208), Expect = 2e-18
 Identities = 24/159 (15%), Positives = 45/159 (28%), Gaps = 28/159 (17%)

Query: 2   LKKQLFGKKFLLVLDDVWNENYSRWSELSCPFGAGAAGSKIVVTTRNLVVAERMGAD-PV 60
               +     L V DDV  E   RW        A     + +VTTR++ ++         
Sbjct: 128 CNALIDRPNTLFVFDDVVQEETIRW--------AQELRLRCLVTTRDVEISNAASQTCEF 179

Query: 61  YQLKELSDDDCLDFTRHQSLKE--------VGEQIVIKCGGLPLAAKTLGGLLRGRDDPR 112
            ++  L  D+C DF     +          V  + +    G P            +   +
Sbjct: 180 IEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEK 239

Query: 113 DWEFVLKTDIWNLRDSDILPALR---------LKQCFAY 142
             +  L   + +     +              L++C   
Sbjct: 240 MAQ--LNNKLESRGLVGVECITPYSYKSLAMALQRCVEV 276


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query839
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.76
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.75
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.62
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.59
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.56
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.55
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.51
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.48
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.39
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.38
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.33
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.31
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.29
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.29
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.27
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.24
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.24
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.13
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.09
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.04
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.04
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.01
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.99
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.9
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.88
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.56
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.54
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.45
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.38
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.3
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.34
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.77
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.65
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.01
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 92.96
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.82  E-value=6.3e-19  Score=188.03  Aligned_cols=77  Identities=17%  Similarity=0.247  Sum_probs=52.5

Q ss_pred             CCceeEEEeCCCcccccccccccCcCcCcEeEecCccccccccCCCCCCccccCCCccEEeccCccccccCCC--cCCCC
Q 036119          293 LPRLRVFSLCGYRNIFNLPNEIGNLKHLRCLNLSRTKWEEWIPCGAGQEVDEVFPKLRTLSLDNCCKLQGTLP--RRLLL  370 (839)
Q Consensus       293 l~~L~~L~L~~~~~~~~lp~~i~~L~~L~~L~L~~~~~~~~~p~~~~~~~~~~l~~L~~L~L~~~~~l~~~lp--~~l~~  370 (839)
                      +.+|++|+++++. +..++ .++.+++|++|++++|++.+ +|. +..     +++|++|++++| .+. .++  ..+++
T Consensus        43 l~~l~~L~l~~~~-I~~l~-gl~~L~nL~~L~Ls~N~l~~-l~~-l~~-----L~~L~~L~L~~n-~i~-~i~~l~~l~~  111 (384)
T d2omza2          43 LDQVTTLQADRLG-IKSID-GVEYLNNLTQINFSNNQLTD-ITP-LKN-----LTKLVDILMNNN-QIA-DITPLANLTN  111 (384)
T ss_dssp             HTTCCEEECCSSC-CCCCT-TGGGCTTCCEEECCSSCCCC-CGG-GTT-----CTTCCEEECCSS-CCC-CCGGGTTCTT
T ss_pred             hCCCCEEECCCCC-CCCcc-ccccCCCCCEEeCcCCcCCC-Ccc-ccC-----Cccccccccccc-ccc-cccccccccc
Confidence            4568888888888 77774 57888888888888888754 332 444     888888888886 454 233  24555


Q ss_pred             ccEEeecccC
Q 036119          371 LETLDITSCD  380 (839)
Q Consensus       371 L~~L~l~~~~  380 (839)
                      |+.|++.++.
T Consensus       112 L~~L~~~~~~  121 (384)
T d2omza2         112 LTGLTLFNNQ  121 (384)
T ss_dssp             CCEEECCSSC
T ss_pred             cccccccccc
Confidence            5565555443



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure