Citrus Sinensis ID: 036193

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
PSPSHPQKSESLHMENSCSSHSRTVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMKLPMHVTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDARGIRSGILNVSVRVKEGSGLGLLKSRYEYCSSSPSAQQKPVIGADAKKFNGLVAEIPVWNPYPV
cccccccHHHccccccccccccEEEEEEEEEEccccccccccccccEEEEEEcccccEEEEEccccccccccccEEEEEEccccccEEEEEEEEEccccccccEEEEEEEccccccccccccccEEEEEEEEcccccccEEEEEEEEEEcccccccccccccccccccccccccEEccccccccccEEEEcccccccc
ccccccccccccccccccccccEEEEEEEEEccccccccccccccEEEEEEEccccccccccccccccccccccEEEEEccccccEEEEEEEEEcccccccccEEEEEEEHHHHccccccccccEEEEEEEEcccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEEEccccc
pspshpqkseslhmenscsshsrtVEITVLSAEDLRVDGRSVKKKAFAVVkldpfnnrvtkvdaiggsypawdeklvmklPMHVTFITLEVQcrtcsgsgdrlvGRATLLVSDfiggyvpenHLNFLSYLLRDARGIRSGILNVSVRVKEGSGLGLLKSRyeycssspsaqqkpvigadakkFNGLvaeipvwnpypv
pspshpqkseslhmenscsshsrtVEITVLsaedlrvdgrsvkkkafavvkldpfnnrvtkvdaiGGSYPAWDEKLVMKLPMHVTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDARGIRSGILNVSVRVKEGSGLGLLKSRYEYCSSSPSAQQKPVIGADAKKFNGLvaeipvwnpypv
PSPSHPQKSESLHMENSCSSHSRTVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMKLPMHVTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDARGIRSGILNVSVRVKEGSGLGLLKSRYEYCSSSPSAQQKPVIGADAKKFNGLVAEIPVWNPYPV
*************************EITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMKLPMHVTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDARGIRSGILNVSVRVKEGSGLGLLKSRYEYC***********IGADAKKFNGLVAEIPVWN****
*************************EITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMKLPMHVTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSY*******I*SGILNVSVRV***********************************NGLVAEIPVWNPYP*
**********************RTVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMKLPMHVTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDARGIRSGILNVSVRVKEGSGLGLLKSRYEY**********PVIGADAKKFNGLVAEIPVWNPYPV
********************HSRTVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMKLPMHVTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDARGIRSGILNVSVRVKEG*****************************KKFNGLVAEIPVWNPYPV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PSPSHPQKSESLHMENSCSSHSRTVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMKLPMHVTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDARGIRSGILNVSVRVKEGSGLGLLKSRYEYCSSSPSAQQKPVIGADAKKFNGLVAEIPVWNPYPV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
Q58FX0207 BON1-associated protein 2 yes no 0.666 0.637 0.474 2e-29
Q941L2192 BON1-associated protein 1 no no 0.828 0.854 0.377 8e-22
>sp|Q58FX0|BAP2_ARATH BON1-associated protein 2 OS=Arabidopsis thaliana GN=BAP2 PE=1 SV=1 Back     alignment and function desciption
 Score =  128 bits (322), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 95/135 (70%), Gaps = 3/135 (2%)

Query: 17  SCSSHSRTVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKL 76
           S S+  R++EI V+SAE L+VD + +KKK ++VV++D   +  +KVD +GGSYP W ++ 
Sbjct: 2   SYSTFKRSLEIEVISAEGLKVDRKPLKKKTYSVVRIDE-KSWASKVDELGGSYPIWKDRF 60

Query: 77  VMKLPMH--VTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDA 134
            M++P++  V FI++EV  RT     D+ VG A + V+DF+GG+ P+ HLNFLSY LRD 
Sbjct: 61  DMEMPINASVRFISIEVYYRTSGSGRDKNVGYAKIPVTDFMGGFAPQGHLNFLSYRLRDE 120

Query: 135 RGIRSGILNVSVRVK 149
            G + GI+NVS+ VK
Sbjct: 121 YGDKCGIVNVSIMVK 135
Negative regulator of cell death and defense responses. Exhibits calcium-dependent phospholipid binding properties.
Arabidopsis thaliana (taxid: 3702)
>sp|Q941L2|BAP1_ARATH BON1-associated protein 1 OS=Arabidopsis thaliana GN=BAP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
255541484179 conserved hypothetical protein [Ricinus 0.868 0.960 0.459 1e-39
255541486196 conserved hypothetical protein [Ricinus 0.808 0.816 0.508 5e-38
224067852183 predicted protein [Populus trichocarpa] 0.848 0.918 0.480 1e-37
224130188184 predicted protein [Populus trichocarpa] 0.888 0.956 0.455 6e-37
225453712176 PREDICTED: BON1-associated protein 2-lik 0.838 0.943 0.477 2e-33
380706600176 BAP1 [Vitis vinifera] 0.838 0.943 0.477 3e-33
147802422176 hypothetical protein VITISV_017490 [Viti 0.636 0.715 0.581 1e-32
351723595179 uncharacterized protein LOC100527075 [Gl 0.641 0.709 0.550 2e-32
388513941171 unknown [Lotus japonicus] 0.818 0.947 0.463 4e-31
449433097183 PREDICTED: BON1-associated protein 2-lik 0.828 0.896 0.430 3e-30
>gi|255541484|ref|XP_002511806.1| conserved hypothetical protein [Ricinus communis] gi|223548986|gb|EEF50475.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 116/174 (66%), Gaps = 2/174 (1%)

Query: 20  SHSRTVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMK 79
           S SRT+EIT+ S EDLR+D RSVK   + VV+ D  N+  TK+D  GGSYP+W+EKL++ 
Sbjct: 3   STSRTLEITIFSCEDLRIDRRSVKNNTYVVVRTDHLNSTATKIDTQGGSYPSWNEKLIVD 62

Query: 80  LPMHVTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDARGIRS 139
           +P+H  FITLE +C+T   S DR++  A + V+DF+GGY+P+N+LN LSY LRD RG R+
Sbjct: 63  MPLHERFITLEARCKT--ASADRIIASARMPVTDFMGGYLPDNYLNILSYRLRDTRGERN 120

Query: 140 GILNVSVRVKEGSGLGLLKSRYEYCSSSPSAQQKPVIGADAKKFNGLVAEIPVW 193
           GI+N+S++VK  +    L +R +    +  +   P+     +K   +V  IPVW
Sbjct: 121 GIINLSLKVKAAAADYYLSTRKKRLPGNTCSSGYPIQNNGGEKNLDVVTGIPVW 174

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255541486|ref|XP_002511807.1| conserved hypothetical protein [Ricinus communis] gi|223548987|gb|EEF50476.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224067852|ref|XP_002302565.1| predicted protein [Populus trichocarpa] gi|222844291|gb|EEE81838.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224130188|ref|XP_002320774.1| predicted protein [Populus trichocarpa] gi|222861547|gb|EEE99089.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225453712|ref|XP_002271138.1| PREDICTED: BON1-associated protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|380706600|gb|AFD97530.1| BAP1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147802422|emb|CAN72571.1| hypothetical protein VITISV_017490 [Vitis vinifera] Back     alignment and taxonomy information
>gi|351723595|ref|NP_001238308.1| uncharacterized protein LOC100527075 [Glycine max] gi|255631498|gb|ACU16116.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388513941|gb|AFK45032.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449433097|ref|XP_004134334.1| PREDICTED: BON1-associated protein 2-like [Cucumis sativus] gi|449480365|ref|XP_004155873.1| PREDICTED: BON1-associated protein 2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
TAIR|locus:2050782207 BAP2 "AT2G45760" [Arabidopsis 0.661 0.632 0.5 4.4e-29
TAIR|locus:2098931192 BAP1 "BON association protein 0.848 0.875 0.391 7.8e-23
TAIR|locus:2172828219 AT5G23950 "AT5G23950" [Arabido 0.732 0.662 0.319 1.7e-07
TAIR|locus:2041654 401 AT2G13350 "AT2G13350" [Arabido 0.737 0.364 0.251 1.7e-07
TAIR|locus:2102980 391 AT3G04360 "AT3G04360" [Arabido 0.641 0.324 0.242 1.4e-05
TAIR|locus:2124933250 AT4G01200 "AT4G01200" [Arabido 0.666 0.528 0.248 5.7e-05
TAIR|locus:2050782 BAP2 "AT2G45760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 323 (118.8 bits), Expect = 4.4e-29, P = 4.4e-29
 Identities = 68/136 (50%), Positives = 99/136 (72%)

Query:    17 SCSSHSRTVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKL 76
             S S+  R++EI V+SAE L+VD + +KKK ++VV++D   +  +KVD +GGSYP W ++ 
Sbjct:     2 SYSTFKRSLEIEVISAEGLKVDRKPLKKKTYSVVRIDE-KSWASKVDELGGSYPIWKDRF 60

Query:    77 VMKLPMH--VTFITLEVQCRTCSGSG-DRLVGRATLLVSDFIGGYVPENHLNFLSYLLRD 133
              M++P++  V FI++EV  RT SGSG D+ VG A + V+DF+GG+ P+ HLNFLSY LRD
Sbjct:    61 DMEMPINASVRFISIEVYYRT-SGSGRDKNVGYAKIPVTDFMGGFAPQGHLNFLSYRLRD 119

Query:   134 ARGIRSGILNVSVRVK 149
               G + GI+NVS+ VK
Sbjct:   120 EYGDKCGIVNVSIMVK 135
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009693 "ethylene biosynthetic process" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2098931 BAP1 "BON association protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172828 AT5G23950 "AT5G23950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041654 AT2G13350 "AT2G13350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102980 AT3G04360 "AT3G04360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124933 AT4G01200 "AT4G01200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00021443
hypothetical protein (183 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 8e-37
cd00030102 cd00030, C2, C2 domain 1e-07
smart00239101 smart00239, C2, Protein kinase C conserved region 1e-07
pfam0016885 pfam00168, C2, C2 domain 5e-04
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information 
 Score =  124 bits (313), Expect = 8e-37
 Identities = 48/126 (38%), Positives = 67/126 (53%), Gaps = 6/126 (4%)

Query: 24  TVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMKLPMH 83
           T+EIT++SAEDL+      K K +AVV +DP + + T VD  GG+ P W+E L   L   
Sbjct: 1   TLEITIISAEDLKNVNLFGKMKVYAVVWIDPSHKQSTPVDRDGGTNPTWNETLRFPLDER 60

Query: 84  V-----TFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDARGIR 138
           +       +T+EV C      GD+L+G   + + D + G  P   L FLSY LR   G  
Sbjct: 61  LLQQGRLALTIEVYCER-PSLGDKLIGEVRVPLKDLLDGASPAGELRFLSYQLRRPSGKP 119

Query: 139 SGILNV 144
            G+LN 
Sbjct: 120 QGVLNF 125

SRC2 production is a response to pathogen infiltration. The initial response of increased Ca2+ concentrations are coupled to downstream signal transduction pathways via calcium binding proteins. SRC2 contains a single C2 domain which localizes to the plasma membrane and is involved in Ca2+ dependent protein binding. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. Length = 125
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.95
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.93
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.92
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.91
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.91
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.91
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.91
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.9
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.9
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.9
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.9
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.89
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.89
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.89
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.88
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.88
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.88
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.88
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.87
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.87
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.87
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.87
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.86
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.86
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.86
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.86
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.86
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.85
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.84
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.84
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.84
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.84
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.84
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.84
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.83
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.83
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.83
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.83
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.83
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.82
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.82
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.82
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.82
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.82
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.82
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.81
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.81
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.81
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.81
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.81
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.81
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.81
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.8
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.8
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.8
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.8
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.8
PLN03008 868 Phospholipase D delta 99.8
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.79
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.79
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.79
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.79
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.79
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.78
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.78
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.78
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.77
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.77
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.77
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.77
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.76
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.74
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.74
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.74
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.74
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.74
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.73
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.73
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.73
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.73
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.72
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.72
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.71
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.71
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.71
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.71
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.71
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.7
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.7
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.7
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.69
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.69
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.66
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.66
PLN02270 808 phospholipase D alpha 99.65
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.64
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.63
PLN02223537 phosphoinositide phospholipase C 99.59
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 99.58
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.56
PLN02952599 phosphoinositide phospholipase C 99.55
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.55
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.5
PLN02230598 phosphoinositide phospholipase C 4 99.47
PLN02228567 Phosphoinositide phospholipase C 99.46
KOG0169746 consensus Phosphoinositide-specific phospholipase 99.45
PLN02222581 phosphoinositide phospholipase C 2 99.42
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.42
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.42
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.39
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 99.36
PLN02352 758 phospholipase D epsilon 99.31
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.25
KOG12641267 consensus Phospholipase C [Lipid transport and met 99.24
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 98.96
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 98.92
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 98.85
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 98.52
KOG1265 1189 consensus Phospholipase C [Lipid transport and met 98.4
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.32
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.32
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 98.19
KOG3837523 consensus Uncharacterized conserved protein, conta 98.14
KOG10111283 consensus Neurotransmitter release regulator, UNC- 98.08
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 97.92
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 97.87
PLN02964 644 phosphatidylserine decarboxylase 97.81
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 97.77
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 97.56
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 97.38
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 97.35
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.32
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 97.22
PF12416 340 DUF3668: Cep120 protein; InterPro: IPR022136 This 97.08
PF15627156 CEP76-C2: CEP76 C2 domain 97.01
PF11618107 DUF3250: Protein of unknown function (DUF3250); In 96.87
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 96.85
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 96.82
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 96.55
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 96.48
KOG1452 442 consensus Predicted Rho GTPase-activating protein 96.25
cd08397159 C2_PI3K_class_III C2 domain present in class III p 96.24
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 95.92
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 95.84
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 95.81
KOG1327 529 consensus Copine [Signal transduction mechanisms] 95.61
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 95.0
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 94.23
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 94.19
cd08679178 C2_DOCK180_related C2 domains found in Dedicator O 93.03
KOG1329 887 consensus Phospholipase D1 [Lipid transport and me 91.89
cd08696179 C2_Dock-C C2 domains found in Dedicator Of CytoKin 91.86
cd08697185 C2_Dock-D C2 domains found in Dedicator Of CytoKin 90.48
PF06219 460 DUF1005: Protein of unknown function (DUF1005); In 86.41
PTZ00447 508 apical membrane antigen 1-like protein; Provisiona 85.76
KOG1327 529 consensus Copine [Signal transduction mechanisms] 84.5
PF14924112 DUF4497: Protein of unknown function (DUF4497) 81.82
PF07162168 B9-C2: Ciliary basal body-associated, B9 protein; 81.62
PF14186147 Aida_C2: Cytoskeletal adhesion; PDB: 2QZQ_A 2QZ5_A 81.4
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information 
Probab=99.95  E-value=1.7e-26  Score=174.45  Aligned_cols=119  Identities=18%  Similarity=0.262  Sum_probs=101.2

Q ss_pred             CcEEEEEEEEccCCCCCCCCCCCCcEEEEEECCCCeeEeeecCCCCCCCeeceEEEEEeCCCCceEEEEEEecccCCCCC
Q 036193           22 SRTVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMKLPMHVTFITLEVQCRTCSGSGD  101 (198)
Q Consensus        22 ~~~L~V~VisA~~L~~~~~~~~~dpYv~v~l~~~~k~rT~v~~~~g~nP~WNE~f~f~v~~~~~~L~v~V~d~~~~~~~d  101 (198)
                      .|.|+|+|++|++|+..+ ++++||||++++++ ++++|+++++++.||+|||+|.|.+......|.|+|||++ .+.+|
T Consensus         1 ~g~L~v~v~~Ak~l~~~~-~g~sDPYv~i~lg~-~~~kT~v~~~~~~nP~WNe~F~f~v~~~~~~l~~~V~d~d-~~~~d   77 (121)
T cd04016           1 VGRLSITVVQAKLVKNYG-LTRMDPYCRIRVGH-AVYETPTAYNGAKNPRWNKTIQCTLPEGVDSIYIEIFDER-AFTMD   77 (121)
T ss_pred             CcEEEEEEEEccCCCcCC-CCCCCceEEEEECC-EEEEeEEccCCCCCCccCeEEEEEecCCCcEEEEEEEeCC-CCcCC
Confidence            378999999999998777 78999999999976 6889999988779999999999999876678999999998 56679


Q ss_pred             ceeEEEEEeCce-eeccccCCCcceeEEEEEEcCCC-CcceEEEEEEEE
Q 036193          102 RLVGRATLLVSD-FIGGYVPENHLNFLSYLLRDARG-IRSGILNVSVRV  148 (198)
Q Consensus       102 ~~lG~~~vpl~~-l~~~~~~~~~~~~~~~~L~~~~g-~~~G~L~l~v~f  148 (198)
                      ++||++.|++.+ +..+..     ...||+|...++ +..|.|+|+++|
T Consensus        78 d~iG~~~i~l~~~~~~g~~-----~~~W~~L~~~~~~~~~g~i~l~l~y  121 (121)
T cd04016          78 ERIAWTHITIPESVFNGET-----LDDWYSLSGKQGEDKEGMINLVFSY  121 (121)
T ss_pred             ceEEEEEEECchhccCCCC-----ccccEeCcCccCCCCceEEEEEEeC
Confidence            999999999964 554421     457999987655 467999999985

Tollip is a part of the Interleukin-1 receptor (IL-1R) signaling pathway. Tollip is proposed to link serine/threonine kinase IRAK to IL-1Rs as well as inhibiting phosphorylation of IRAK. There is a single C2 domain present in Tollip. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice varian
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>PF11618 DUF3250: Protein of unknown function (DUF3250); InterPro: IPR021656 This family of proteins represents a protein with unknown function Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins Back     alignment and domain information
>KOG1329 consensus Phospholipase D1 [Lipid transport and metabolism] Back     alignment and domain information
>cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>PF06219 DUF1005: Protein of unknown function (DUF1005); InterPro: IPR010410 This is a family of plant proteins with undetermined function Back     alignment and domain information
>PTZ00447 apical membrane antigen 1-like protein; Provisional Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>PF14924 DUF4497: Protein of unknown function (DUF4497) Back     alignment and domain information
>PF07162 B9-C2: Ciliary basal body-associated, B9 protein; InterPro: IPR010796 Proteins in this entry include the MSK1 protein (Q9NXB0 from SWISSPROT) and other known or predicted flagellar basal body proteome components [] or cilia-containing species Back     alignment and domain information
>PF14186 Aida_C2: Cytoskeletal adhesion; PDB: 2QZQ_A 2QZ5_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 6e-04
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
 Score = 37.7 bits (88), Expect = 6e-04
 Identities = 17/96 (17%), Positives = 37/96 (38%), Gaps = 10/96 (10%)

Query: 24  TVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMKLPMH 83
           T+E+ ++SA+ L           +  +     + + + V    G+ P W+E  +  +   
Sbjct: 11  TLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQK-SNVAEGMGTTPEWNETFIFTVSEG 69

Query: 84  VTFITLEV----QCRTCSGSGDRLVGRATLLVSDFI 115
            T +  ++          G+ D  VG AT+ +    
Sbjct: 70  TTELKAKIFDKDV-----GTEDDAVGEATIPLEPVF 100

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.93
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.93
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.91
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.91
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.91
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.91
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.9
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.9
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.89
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.89
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.88
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.88
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.86
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.83
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.83
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.83
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.83
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.83
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.83
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.82
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.82
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.82
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.82
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.82
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.82
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.82
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.82
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.81
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.81
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.81
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.81
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.81
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.8
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.8
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.79
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.79
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.78
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.77
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.76
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.74
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.72
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.68
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.66
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.62
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.6
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.59
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.57
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.57
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.47
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 99.26
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 99.2
2yrb_A156 Protein fantom; beta sandwich, NPPSFA, national pr 96.76
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 95.48
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 95.08
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 94.35
1e7u_A 961 Phosphatidylinositol 3-kinase catalytic subunit; p 92.17
2y3a_A 1092 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 91.69
2qzq_A152 Axin interactor, dorsalization associated protein; 82.88
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.93  E-value=9.9e-25  Score=165.37  Aligned_cols=129  Identities=21%  Similarity=0.257  Sum_probs=108.3

Q ss_pred             CCCCcCcEEEEEEEEccCCCCCCCCCCCCcEEEEEECCCCeeEeeecCCCCCCCeeceEEEEEeCC----CCceEEEEEE
Q 036193           17 SCSSHSRTVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMKLPM----HVTFITLEVQ   92 (198)
Q Consensus        17 ~~s~~~~~L~V~VisA~~L~~~~~~~~~dpYv~v~l~~~~k~rT~v~~~~g~nP~WNE~f~f~v~~----~~~~L~v~V~   92 (198)
                      |.|...+.|+|+|++|++|+..+. +.+||||++++++ ++++|++.+++ .||+|||+|.|.+..    ....|.|+||
T Consensus         1 g~s~~~g~L~v~v~~a~~L~~~~~-g~~dpyv~v~~~~-~~~kT~v~~~t-~nP~wne~f~f~v~~~~~~~~~~l~i~V~   77 (140)
T 2dmh_A            1 GSSGSSGMLRVIVESASNIPKTKF-GKPDPIVSVIFKD-EKKKTKKVDNE-LNPVWNEILEFDLRGIPLDFSSSLGIIVK   77 (140)
T ss_dssp             CCSCBCCEEEEEEEEEESCCCCSS-SCCCEEEEEECSS-CEEECCCCCSC-SSCEEEEEEEEECSSCCCCTTCEEEEEEE
T ss_pred             CCCCCCcEEEEEEEEeeCCCCCCC-CCCCeEEEEEECC-EeEEeeeecCC-CCCccCcEEEEEecccccCCCCEEEEEEE
Confidence            356778999999999999998887 8999999999986 58999999875 999999999999963    3589999999


Q ss_pred             ecccCCCCCceeEEEEEeCceeeccccCCCcceeEEEE---EEcCCC-CcceEEEEEEEEEecCCC
Q 036193           93 CRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYL---LRDARG-IRSGILNVSVRVKEGSGL  154 (198)
Q Consensus        93 d~~~~~~~d~~lG~~~vpl~~l~~~~~~~~~~~~~~~~---L~~~~g-~~~G~L~l~v~f~~~~~~  154 (198)
                      |++ ...+|++||++.|+|.++..+.     ....||+   |.+..+ +.+|+|+|+++|.+.+++
T Consensus        78 d~d-~~~~~~~lG~~~i~l~~l~~~~-----~~~~w~~l~~l~~~~~~~~~G~l~l~~~~~p~~~~  137 (140)
T 2dmh_A           78 DFE-TIGQNKLIGTATVALKDLTGDQ-----SRSLPYKLISLLNEKGQDTGATIDLVIGYDPPSGP  137 (140)
T ss_dssp             ETT-CSSSCCCCEEEEEEGGGTCSSS-----CEEEEEEEEEEECTTCCEEEEEEEEEEEECCCBSS
T ss_pred             ECC-CCCCCceEEEEEEEHHHhccCC-----CceeEEeeeeccCCCCCCCCCEEEEEEEEECCCCC
Confidence            998 4567899999999999987553     1345776   777654 567999999999987653
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>2qzq_A Axin interactor, dorsalization associated protein; beta sheet sandwich, coiled coil, signaling protein, lipid binding protein; 1.90A {Danio rerio} PDB: 2qz5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 198
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 5e-07
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 3e-04
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 3e-04
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 6e-04
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 0.001
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 0.001
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 0.002
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 0.002
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain protein At1g63220
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 45.1 bits (106), Expect = 5e-07
 Identities = 22/129 (17%), Positives = 49/129 (37%), Gaps = 7/129 (5%)

Query: 19  SSHSRTVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVM 78
           S    T+E+ ++SA+ L           +  +     + + + V    G+ P W+E  + 
Sbjct: 6   SGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQK-SNVAEGMGTTPEWNETFIF 64

Query: 79  KLPMHVTFITLEVQCRTCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDARGIR 138
            +    T +  ++  +   G+ D  VG AT+ +         E  +   +Y +       
Sbjct: 65  TVSEGTTELKAKIFDK-DVGTEDDAVGEATIPLEPVF----VEGSIPPTAYNVV-KDEEY 118

Query: 139 SGILNVSVR 147
            G + V++ 
Sbjct: 119 KGEIWVALS 127
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.94
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.92
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.9
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.88
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.88
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.88
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.84
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.83
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.81
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.81
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.79
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.77
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.76
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.74
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.73
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.73
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.73
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.72
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.71
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.65
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 96.81
d2yrba1142 Fantom {Human (Homo sapiens) [TaxId: 9606]} 94.15
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain protein At1g63220
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.94  E-value=1.1e-26  Score=174.50  Aligned_cols=131  Identities=17%  Similarity=0.234  Sum_probs=111.4

Q ss_pred             CCCCCCcCcEEEEEEEEccCCCCCCCCCCCCcEEEEEECCCCeeEeeecCCCCCCCeeceEEEEEeCCCCceEEEEEEec
Q 036193           15 ENSCSSHSRTVEITVLSAEDLRVDGRSVKKKAFAVVKLDPFNNRVTKVDAIGGSYPAWDEKLVMKLPMHVTFITLEVQCR   94 (198)
Q Consensus        15 ~~~~s~~~~~L~V~VisA~~L~~~~~~~~~dpYv~v~l~~~~k~rT~v~~~~g~nP~WNE~f~f~v~~~~~~L~v~V~d~   94 (198)
                      .++.+...|+|+|+|++|++|+..+.++++||||++++++ ++.+|+++++++.||+|||+|.|.+......|.|+|||+
T Consensus         2 ~~~~~~p~G~L~V~v~~a~~L~~~d~~g~~Dpyv~v~~~~-~~~~t~~~~~~~~nP~Wne~f~f~v~~~~~~L~v~V~d~   80 (136)
T d1wfja_           2 SSGSSGPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRT-QDQKSNVAEGMGTTPEWNETFIFTVSEGTTELKAKIFDK   80 (136)
T ss_dssp             CCCCCCCEEEEEEEEEEEEECSSCCSSCSSCCCEEEESSS-CEEECCCCTTCCSSCEEEEEEEEEEESSCCEEEEEECCS
T ss_pred             CCCCCCCcEEEEEEEEEeeCCCCCCCCCCCCccEEEEEee-eeEEEEEEecCCCcEEEeeEEEEEEcCccceEEEEEEEe
Confidence            4556666899999999999999988889999999999986 588999888767999999999999987667899999999


Q ss_pred             ccCCCCCceeEEEEEeCceeeccccCCCcceeEEEEEEcCCCCcceEEEEEEEEEecC
Q 036193           95 TCSGSGDRLVGRATLLVSDFIGGYVPENHLNFLSYLLRDARGIRSGILNVSVRVKEGS  152 (198)
Q Consensus        95 ~~~~~~d~~lG~~~vpl~~l~~~~~~~~~~~~~~~~L~~~~g~~~G~L~l~v~f~~~~  152 (198)
                      + ....|++||++.|+|.++....    .....||.|.. +++.+|+|+|++.|.|..
T Consensus        81 d-~~~~d~~iG~~~i~L~~l~~~~----~~~~~~~~l~~-~~~~~G~i~l~l~~~p~~  132 (136)
T d1wfja_          81 D-VGTEDDAVGEATIPLEPVFVEG----SIPPTAYNVVK-DEEYKGEIWVALSFKPSG  132 (136)
T ss_dssp             S-SCTTTCCSEEEEEESHHHHHHS----EEEEEEEEEEE-TTEEEEEEEEEEEEEECC
T ss_pred             c-CCCCCCEEEEEEEEhHHhcccC----CcCcEEEEecC-CCccCEEEEEEEEEEeCC
Confidence            8 4567999999999999987643    23456888875 467899999999998754
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2yrba1 b.7.1.1 (A:596-737) Fantom {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure