Citrus Sinensis ID: 036258


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
KSCEDITGLLRCFMASLAMTTVKNITTDQSALLAFKAHIADPYSVLTKNCFYNISSLKMIRLSSNSLSGSLPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLALGMNKLRTIPNSITNASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLGLHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVGRLQQLQGLFLFGNNLQGSIPSDLCHWG
cccccccccHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccccEEEccccccEEcccHHHHcccccccEEcccccEEEEccccccccccccccccccccccccccccHHHccccccccccccccccEEEEcccHHHHccccccccEEccccccccccHHHHccccccEEEccccEEEEcccccccccccccEEEccccEEccccccccccccccccccccccEEEcccccccccccHHHHHcHHHcccEEccccEEEEccccccccccccccEEccccEEEEccccccccccccccEEcccccccccccccccccc
cccccccccccHHHcccccccEccccccHHHHHHHHHHccccccccccHHHccccccEEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEcccccccccccccHHHHHccHcccEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEccccccccccccccccccHHHcccccccEEEcccccccccccHHHHcHHHHccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccc
KSCEDITGLLRCFMASLAMTTVKNITTDQSALLAFKAhiadpysvltKNCFYNISSLKMIRLssnslsgslpndlcnrlpsLEQLVLrsngffgqiplslskctqLQHLWLEHnkftgrlpenignLSKLRSLVlghkahnslhghlpstlsvslpnlkwLALGMNklrtipnsitnasELTLLELgknsfsglvpntfgnLRFLSLLDlgnnylttrssttEWSFLSSLTNCIYLKVLGlhsnqlsgilpplignfsDSLQQFYAYDCelkgsipqeignlnglidlrlqdndlngtiptTVGRLQQLQGLFLfgnnlqgsipsdlchwg
KSCEDITGLLRCFMASLAMTTVKNITTDQSALLAFKAHIADPYSVLTKNCFYNISSLKMIRLSSNSLSGSLPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLALGMNKLRTIPNSITNASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLGLHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVGRLQQLQGLFLFGnnlqgsipsdlchwg
KSCEDITGLLRCFMASLAMTTVKNITTDQSALLAFKAHIADPYSVLTKNCFYNISSLKMIRlssnslsgslPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLALGMNKLRTIPNSITNASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLGLHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVGRlqqlqglflfgnnlqgSIPSDLCHWG
****DITGLLRCFMASLAMTTVKNITTDQSALLAFKAHIADPYSVLTKNCFYNISSLKMIRLSSNSLSGSLPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLALGMNKLRTIPNSITNASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLGLHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVGRLQQLQGLFLFGNNLQGSIPSDLC***
KSCEDITGLLRCFMASLAMTTVKNITTDQSALLAFKAHIADPYSVLTKNCFYNISSLKMIRLSSNSLSGSLPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLALGMNKLRTIPNSITNASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLGLHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVGRLQQLQGLFLFGNNLQGSIPSDLCHWG
KSCEDITGLLRCFMASLAMTTVKNITTDQSALLAFKAHIADPYSVLTKNCFYNISSLKMIRLSSNSLSGSLPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLALGMNKLRTIPNSITNASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLGLHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVGRLQQLQGLFLFGNNLQGSIPSDLCHWG
*****ITGLLRCFMASLAMTTVKNITTDQSALLAFKAHIADPYSVLTKNCFYNISSLKMIRLSSNSLSGSLPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLALGMNKLRTIPNSITNASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLGLHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVGRLQQLQGLFLFGNNLQGSIPSDL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KSCEDITGLLRCFMASLAMTTVKNITTDQSALLAFKAHIADPYSVLTKNCFYNISSLKMIRLSSNSLSGSLPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLALGMNKLRTIPNSITNASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLGLHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVGRLQQLQGLFLFGNNLQGSIPSDLCHWG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query331 2.2.26 [Sep-21-2011]
P93194 1109 Receptor-like protein kin N/A no 0.791 0.236 0.358 2e-36
C0LGP4 1010 Probable LRR receptor-lik yes no 0.815 0.267 0.384 6e-35
Q9LVP0 1102 Probable leucine-rich rep no no 0.776 0.233 0.362 5e-33
C0LGQ5 1249 LRR receptor-like serine/ no no 0.728 0.192 0.352 6e-32
Q9LHP4 1141 Receptor-like protein kin no no 0.788 0.228 0.380 1e-31
Q8VZG8 1045 Probable LRR receptor-lik no no 0.803 0.254 0.339 2e-30
C0LGS2 1136 Probable LRR receptor-lik no no 0.794 0.231 0.334 7e-30
Q9LP24 1120 Probable leucine-rich rep no no 0.797 0.235 0.344 1e-29
Q9FZ59 1088 Leucine-rich repeat recep no no 0.800 0.243 0.338 2e-29
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.809 0.214 0.348 3e-29
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function desciption
 Score =  153 bits (387), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 111/310 (35%), Positives = 160/310 (51%), Gaps = 48/310 (15%)

Query: 57  LKMIRLSSNSLSGSLPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNKF 116
           +  + LSS  +SG    ++ + L  L+++VL  NGFFG IP  L  C+ L+H+ L  N F
Sbjct: 70  VDTLNLSSYGISGEFGPEI-SHLKHLKKVVLSGNGFFGSIPSQLGNCSLLEHIDLSSNSF 128

Query: 117 TGRLPENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLALGMNKLR-TIPNSI 175
           TG +P+ +G L  LR+L L     NSL G  P +L +S+P+L+ +    N L  +IP++I
Sbjct: 129 TGNIPDTLGALQNLRNLSL---FFNSLIGPFPESL-LSIPHLETVYFTGNGLNGSIPSNI 184

Query: 176 TNASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNN-----------------YLTTR 218
            N SELT L L  N FSG VP++ GN+  L  L L +N                 YL  R
Sbjct: 185 GNMSELTTLWLDDNQFSGPVPSSLGNITTLQELYLNDNNLVGTLPVTLNNLENLVYLDVR 244

Query: 219 SSTTEWSFLSSLTNCIYLKVLGLHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQ- 277
           +++   +      +C  +  + L +NQ +G LPP +GN + SL++F A+ C L G IP  
Sbjct: 245 NNSLVGAIPLDFVSCKQIDTISLSNNQFTGGLPPGLGNCT-SLREFGAFSCALSGPIPSC 303

Query: 278 -----------------------EIGNLNGLIDLRLQDNDLNGTIPTTVGRLQQLQGLFL 314
                                  E+G    +IDL+LQ N L G IP  +G L QLQ L L
Sbjct: 304 FGQLTKLDTLYLAGNHFSGRIPPELGKCKSMIDLQLQQNQLEGEIPGELGMLSQLQYLHL 363

Query: 315 FGNNLQGSIP 324
           + NNL G +P
Sbjct: 364 YTNNLSGEVP 373




Possible role in short-day photoperiod floral induction.
Ipomoea nil (taxid: 35883)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
147853795 1420 hypothetical protein VITISV_005816 [Viti 0.842 0.196 0.443 1e-58
359485451 1454 PREDICTED: LRR receptor-like serine/thre 0.842 0.191 0.44 2e-58
255572272 1089 serine-threonine protein kinase, plant-t 0.833 0.253 0.440 4e-58
359485453 1202 PREDICTED: probable LRR receptor-like se 0.842 0.232 0.436 1e-57
359483685 1046 PREDICTED: LRR receptor-like serine/thre 0.842 0.266 0.437 3e-56
359497186 1140 PREDICTED: LRR receptor-like serine/thre 0.927 0.269 0.394 5e-56
359483677 1229 PREDICTED: LRR receptor-like serine/thre 0.842 0.227 0.421 9e-56
224139658 1019 predicted protein [Populus trichocarpa] 0.839 0.272 0.45 3e-55
147776333 1205 hypothetical protein VITISV_000078 [Viti 0.842 0.231 0.421 9e-55
147769371 1241 hypothetical protein VITISV_010511 [Viti 0.842 0.224 0.415 8e-54
>gi|147853795|emb|CAN81714.1| hypothetical protein VITISV_005816 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  233 bits (593), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 182/325 (56%), Gaps = 46/325 (14%)

Query: 51  FYNISSLKMIRLSSNSLSGSLPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLW 110
            +NISSL+MI L+ NSL GSLP D+C  L +L+ L L  N   GQ+P +LS C QL  L 
Sbjct: 331 IFNISSLQMIDLTDNSLHGSLPMDICKHLHNLQGLYLSFNQLSGQLPTTLSLCGQLLSLS 390

Query: 111 LEHNKFTGRLPENIGNLSKLRSLVLGHK-------------------------------- 138
           L  N+FTG +P + GNL+ L+ L L                                   
Sbjct: 391 LWGNRFTGNIPPSFGNLTVLQDLELXENNIQGNIPNELGNLINLQNLKLSVNNLTGIIPE 450

Query: 139 -------------AHNSLHGHLPSTLSVSLPNLKWLALGMNKLR-TIPNSITNASELTLL 184
                        A N   G LPS++   LP+L+ LA+G N+    IP SI+N SELT+L
Sbjct: 451 AIFNISKLQTLXLAQNHFSGSLPSSIGTQLPDLEGLAIGXNEFSGIIPMSISNMSELTVL 510

Query: 185 ELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLGLHSN 244
           ++  N F+G VP   GNLR L  L+LG N LT   ST+E  FL+SLTNC +L+ L +  N
Sbjct: 511 DIWANFFTGDVPKDLGNLRRLEFLNLGFNQLTDEHSTSEVGFLTSLTNCKFLRRLWIEDN 570

Query: 245 QLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVG 304
            L GILP  +GN S SL+ F A  C+ KG+IP  IGNL  LIDLRL DNDL G IP + G
Sbjct: 571 PLKGILPNSLGNLSISLESFDASACQFKGTIPTGIGNLINLIDLRLNDNDLTGLIPISFG 630

Query: 305 RLQQLQGLFLFGNNLQGSIPSDLCH 329
            LQ+LQ   + GN + GSIPS LCH
Sbjct: 631 HLQKLQWFAISGNRIHGSIPSVLCH 655




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359485451|ref|XP_002276944.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255572272|ref|XP_002527075.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223533580|gb|EEF35319.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359485453|ref|XP_003633276.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483685|ref|XP_002263372.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase EFR-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359497186|ref|XP_003635448.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483677|ref|XP_003633000.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224139658|ref|XP_002323215.1| predicted protein [Populus trichocarpa] gi|222867845|gb|EEF04976.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147776333|emb|CAN72034.1| hypothetical protein VITISV_000078 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147769371|emb|CAN72496.1| hypothetical protein VITISV_010511 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.746 0.240 0.372 5.6e-33
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.749 0.305 0.338 4e-32
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.688 0.225 0.4 4.6e-31
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.743 0.221 0.353 5.5e-31
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.809 0.259 0.328 6.5e-31
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.791 0.233 0.336 1.4e-29
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.752 0.199 0.345 5.6e-29
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.776 0.225 0.362 1.6e-28
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.821 0.265 0.345 2.9e-28
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.749 0.245 0.359 2e-27
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
 Score = 371 (135.7 bits), Expect = 5.6e-33, P = 5.6e-33
 Identities = 95/255 (37%), Positives = 138/255 (54%)

Query:    72 PNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLR 131
             P+ L N L SL++  L  N   G IP SL + + L  + L  N  +G +P +I NLS LR
Sbjct:   193 PSALGN-LTSLQEFDLSFNRLSGAIPSSLGQLSSLLTMNLGQNNLSGMIPNSIWNLSSLR 251

Query:   132 SLVLGHKAHNSLHGHLPSTLSVSLPNLKWLALGMNKLR-TIPNSITNASELTLLELGKNS 190
             +  +     N L G +P+    +L  L+ + +G N+    IP S+ NAS LT++++  N 
Sbjct:   252 AFSV---RENKLGGMIPTNAFKTLHLLEVIDMGTNRFHGKIPASVANASHLTVIQIYGNL 308

Query:   191 FSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLGLHSNQLSGIL 250
             FSG++ + FG LR L+ L L  N   TR    +W F+S LTNC  L+ L L  N L G+L
Sbjct:   309 FSGIITSGFGRLRNLTELYLWRNLFQTREQD-DWGFISDLTNCSKLQTLNLGENNLGGVL 367

Query:   251 PPLIGNFSDSLQQFYAYDC-ELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVGRXXXX 309
             P    N S SL  F A +  ++ GSIP++IGNL GL  L L +N+  G++P+++GR    
Sbjct:   368 PNSFSNLSTSLS-FLALELNKITGSIPKDIGNLIGLQHLYLCNNNFRGSLPSSLGRLKNL 426

Query:   310 XXXXXXXXXXXXSIP 324
                         SIP
Sbjct:   427 GILLAYENNLSGSIP 441


GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XVI000210
hypothetical protein (1019 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-32
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-30
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  139 bits (352), Expect = 1e-36
 Identities = 110/311 (35%), Positives = 157/311 (50%), Gaps = 29/311 (9%)

Query: 32  LLAFKAHIADPYSVLTK------NCFY------NISSLKMIRLSSNSLSGSLPNDLCNRL 79
           LL+FK+ I DP   L+        C +      N S +  I LS  ++SG + +    RL
Sbjct: 34  LLSFKSSINDPLKYLSNWNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKI-SSAIFRL 92

Query: 80  PSLEQLVLRSNGFFGQIPLSLSK-CTQLQHLWLEHNKFTGRLPENIGNLSKLRSLVLGHK 138
           P ++ + L +N   G IP  +    + L++L L +N FTG +P   G++  L +L L   
Sbjct: 93  PYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDL--- 147

Query: 139 AHNSLHGHLPSTLSVSLPNLKWLALGMNKLR-TIPNSITNASELTLLELGKNSFSGLVPN 197
           ++N L G +P+ +  S  +LK L LG N L   IPNS+TN + L  L L  N   G +P 
Sbjct: 148 SNNMLSGEIPNDIG-SFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPR 206

Query: 198 TFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLGLHSNQLSGILPPLIGNF 257
             G ++ L  + LG N L+      E   L+SL +      L L  N L+G +P  +GN 
Sbjct: 207 ELGQMKSLKWIYLGYNNLSGEIPY-EIGGLTSLNH------LDLVYNNLTGPIPSSLGNL 259

Query: 258 SDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVGRLQQLQGLFLFGN 317
            + LQ  + Y  +L G IP  I +L  LI L L DN L+G IP  V +LQ L+ L LF N
Sbjct: 260 KN-LQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSN 318

Query: 318 NLQGSIPSDLC 328
           N  G IP  L 
Sbjct: 319 NFTGKIPVALT 329


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 331
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.87
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.84
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.82
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.81
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.78
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.69
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.37
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.27
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.26
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.21
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.17
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.13
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.11
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.06
PLN03150623 hypothetical protein; Provisional 99.05
PLN03150 623 hypothetical protein; Provisional 99.02
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.95
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.91
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.87
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.56
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.5
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.47
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.46
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.43
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.41
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.38
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.29
PRK15386 426 type III secretion protein GogB; Provisional 98.27
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.27
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.27
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.09
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.05
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.04
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.96
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.89
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.85
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.83
KOG4341483 consensus F-box protein containing LRR [General fu 97.81
PRK15386 426 type III secretion protein GogB; Provisional 97.71
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.53
KOG4341483 consensus F-box protein containing LRR [General fu 97.21
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.04
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.02
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.01
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.97
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.85
KOG4308 478 consensus LRR-containing protein [Function unknown 95.82
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.68
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.45
KOG4308478 consensus LRR-containing protein [Function unknown 95.35
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.04
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.97
smart0037026 LRR Leucine-rich repeats, outliers. 94.97
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.23
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.25
smart0037026 LRR Leucine-rich repeats, outliers. 92.25
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.61
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 90.21
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.04
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.42
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.5e-31  Score=264.62  Aligned_cols=298  Identities=34%  Similarity=0.539  Sum_probs=174.4

Q ss_pred             ChhhHHHHHHHHHhccCCCCCCCcc------------------------------------hhcCCCCccEEEcCCCcCc
Q 036258           25 ITTDQSALLAFKAHIADPYSVLTKN------------------------------------CFYNISSLKMIRLSSNSLS   68 (331)
Q Consensus        25 ~~~~~~~l~~~~~~~~~~~~~~~~~------------------------------------~~~~~~~L~~L~l~~~~i~   68 (331)
                      .+.+..++..|+..+.+|......|                                    .|..+++|++|++++|.+.
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~  106 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLS  106 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecCCCCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccC
Confidence            3567788899988776554433333                                    1456778888888888887


Q ss_pred             cCCChhhhcCCCCCcEEEccCCcccccCCccCcCCCCCCEEEccCccccccCCccccCcccccccccCccccccccccCC
Q 036258           69 GSLPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLRSLVLGHKAHNSLHGHLP  148 (331)
Q Consensus        69 ~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~  148 (331)
                      +.+|..+|..+++|++|++++|.+.+..|.  +.+++|++|++++|.+.+..|..+..+++|++|++++|..   .+.++
T Consensus       107 ~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l---~~~~p  181 (968)
T PLN00113        107 GPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVL---VGKIP  181 (968)
T ss_pred             CcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcc---cccCC
Confidence            778887776777777777777776655443  3455666666666666555666666666666666644332   22233


Q ss_pred             cchhcCCCCCcEEEcCCCCCC-CCcccccCCCCCceeeCcCccccccCchhccCCCCCCEEEccCCcccCccCCC-----
Q 036258          149 STLSVSLPNLKWLALGMNKLR-TIPNSITNASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTT-----  222 (331)
Q Consensus       149 ~~~~~~l~~L~~L~l~~~~l~-~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~-----  222 (331)
                      ..+. .+++|++|++++|.+. .+|..+..+++|+.|++++|.+.+..|..+..+++|++|++++|.+.......     
T Consensus       182 ~~~~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~  260 (968)
T PLN00113        182 NSLT-NLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLK  260 (968)
T ss_pred             hhhh-hCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCC
Confidence            3222 4555555555555543 34444555555555555555554444444555555555555555443210000     


Q ss_pred             ------------ccccccccccCCCCcEEEeecccccccCCchhhhccccccEEEeccCcccccCCccccCCCCCCEEEc
Q 036258          223 ------------EWSFLSSLTNCIYLKVLGLHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRL  290 (331)
Q Consensus       223 ------------~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l  290 (331)
                                  ....+..+..+++|++|++++|.+.+.+|..+..+. +|+.|++++|.+.+..|..+..+++|+.|++
T Consensus       261 ~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~-~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L  339 (968)
T PLN00113        261 NLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQ-NLEILHLFSNNFTGKIPVALTSLPRLQVLQL  339 (968)
T ss_pred             CCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCC-CCcEEECCCCccCCcCChhHhcCCCCCEEEC
Confidence                        002333445555555555555555555555555444 6666666666666556666666666666666


Q ss_pred             cCCCCcccCCcCccCCCCCCeEeccCCeeeecCCccccC
Q 036258          291 QDNDLNGTIPTTVGRLQQLQGLFLFGNNLQGSIPSDLCH  329 (331)
Q Consensus       291 ~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~p~~~~~  329 (331)
                      ++|.+.+.+|..+..+++|+.|++++|.+++.+|+.++.
T Consensus       340 ~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~  378 (968)
T PLN00113        340 WSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCS  378 (968)
T ss_pred             cCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhC
Confidence            666666666666666666777777777766666666554



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-19
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-19
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-13
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 92.4 bits (228), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 91/295 (30%), Positives = 131/295 (44%), Gaps = 65/295 (22%) Query: 72 PNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLR 131 PN N +L++L L++NGF G+IP +LS C++L L L N +G +P ++G+LSKLR Sbjct: 386 PNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLR 445 Query: 132 SLVL------GHKAH---------------NSLHGHLPSTLSVSLPNLKWLALGMNKLR- 169 L L G N L G +PS LS + NL W++L N+L Sbjct: 446 DLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLS-NCTNLNWISLSNNRLTG 504 Query: 170 TIPNSITNASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLT--------TRSST 221 IP I L +L+L NSFSG +P G+ R L LDL N +S Sbjct: 505 EIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGK 564 Query: 222 TEWSFLSSLTNCIYLK----------------VLGLHSNQLS----------------GI 249 +F++ +Y+K G+ S QL+ G Sbjct: 565 IAANFIAG-KRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGH 623 Query: 250 LPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVG 304 P N + +Y+ L G IP+EIG++ L L L ND++G+IP VG Sbjct: 624 TSPTFDNNGSMMFLDMSYNM-LSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVG 677
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-63
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-60
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-58
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-55
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-54
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-52
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-52
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-43
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-36
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-57
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-31
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-31
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-31
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-23
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-18
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-25
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-24
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-20
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-20
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-21
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-16
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-21
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-15
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-16
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 8e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-14
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-14
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-13
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  214 bits (546), Expect = 1e-63
 Identities = 85/282 (30%), Positives = 128/282 (45%), Gaps = 15/282 (5%)

Query: 53  NISSLKMIRLSSNSLSGSLPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLE 112
            + SL+ + L+ N  +G +P+ L     +L  L L  N F+G +P     C+ L+ L L 
Sbjct: 267 PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALS 326

Query: 113 HNKFTGRLP-ENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLALGMNKLR-T 170
            N F+G LP + +  +  L+ L L     N   G LP +L+    +L  L L  N     
Sbjct: 327 SNNFSGELPMDTLLKMRGLKVLDLS---FNEFSGELPESLTNLSASLLTLDLSSNNFSGP 383

Query: 171 IPNSITN--ASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLS 228
           I  ++     + L  L L  N F+G +P T  N   L  L L  NYL+        +  S
Sbjct: 384 ILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS-------GTIPS 436

Query: 229 SLTNCIYLKVLGLHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDL 288
           SL +   L+ L L  N L G +P  +     +L+       +L G IP  + N   L  +
Sbjct: 437 SLGSLSKLRDLKLWLNMLEGEIPQELMYVK-TLETLILDFNDLTGEIPSGLSNCTNLNWI 495

Query: 289 RLQDNDLNGTIPTTVGRLQQLQGLFLFGNNLQGSIPSDLCHW 330
            L +N L G IP  +GRL+ L  L L  N+  G+IP++L   
Sbjct: 496 SLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDC 537


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.98
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.98
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.76
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.39
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.37
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.28
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.16
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.04
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.84
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.84
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.7
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.51
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.34
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.24
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.21
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.59
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.46
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.13
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.59
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 86.71
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 86.59
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=1.4e-34  Score=249.54  Aligned_cols=282  Identities=29%  Similarity=0.443  Sum_probs=242.2

Q ss_pred             cCChhhHHHHHHHHHhccCCCCCCCcc------h---------hcCC--CCccEEEcCCCcCcc--CCChhhhcCCCCCc
Q 036258           23 KNITTDQSALLAFKAHIADPYSVLTKN------C---------FYNI--SSLKMIRLSSNSLSG--SLPNDLCNRLPSLE   83 (331)
Q Consensus        23 ~~~~~~~~~l~~~~~~~~~~~~~~~~~------~---------~~~~--~~L~~L~l~~~~i~~--~~~~~~~~~~~~L~   83 (331)
                      .|.+.+..++.+||..+.+|. .+..|      |         -..-  .++++|+++++.+.+  .+|..+ ..+++|+
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~-~l~~W~~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l-~~l~~L~   79 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSL-ANLPYLN   79 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGG-GGCTTCS
T ss_pred             CCCHHHHHHHHHHHHhcCCcc-cccCCCCCCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccChhH-hCCCCCC
Confidence            366778889999998887653 33333      1         1111  689999999999997  788766 7899999


Q ss_pred             EEEccC-CcccccCCccCcCCCCCCEEEccCccccccCCccccCcccccccccCccccccccccCCcchhcCCCCCcEEE
Q 036258           84 QLVLRS-NGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLA  162 (331)
Q Consensus        84 ~L~L~~-n~i~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~  162 (331)
                      +|++++ |.+.+..|..|+.+++|++|++++|.+++.+|..+..+++|++|++++|..   .+.++..+. .+++|++|+
T Consensus        80 ~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l---~~~~p~~~~-~l~~L~~L~  155 (313)
T 1ogq_A           80 FLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNAL---SGTLPPSIS-SLPNLVGIT  155 (313)
T ss_dssp             EEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEE---ESCCCGGGG-GCTTCCEEE
T ss_pred             eeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCcc---CCcCChHHh-cCCCCCeEE
Confidence            999995 889889999999999999999999999988999999999999999965554   444555444 899999999


Q ss_pred             cCCCCCC-CCcccccCCC-CCceeeCcCccccccCchhccCCCCCCEEEccCCcccCccCCCccccccccccCCCCcEEE
Q 036258          163 LGMNKLR-TIPNSITNAS-ELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLG  240 (331)
Q Consensus       163 l~~~~l~-~~~~~~~~l~-~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~~~~~~~L~~L~  240 (331)
                      +++|.+. .+|..+..++ .|++|++++|.+.+..|..+..+. |++|++++|.+..       ..+..+..+++|++|+
T Consensus       156 L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~-------~~~~~~~~l~~L~~L~  227 (313)
T 1ogq_A          156 FDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEG-------DASVLFGSDKNTQKIH  227 (313)
T ss_dssp             CCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEEEE-------CCGGGCCTTSCCSEEE
T ss_pred             CcCCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCc-ccEEECcCCcccC-------cCCHHHhcCCCCCEEE
Confidence            9999998 7888899898 999999999999988898898887 9999999999986       3566788999999999


Q ss_pred             eecccccccCCchhhhccccccEEEeccCcccccCCccccCCCCCCEEEccCCCCcccCCcCccCCCCCCeEeccCCe-e
Q 036258          241 LHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVGRLQQLQGLFLFGNN-L  319 (331)
Q Consensus       241 l~~n~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~-~  319 (331)
                      +++|.+.+..+. +..++ +|++|++++|.+++.+|.++..+++|+.|++++|.+++.+|.. ..+++|+.+++++|+ +
T Consensus       228 L~~N~l~~~~~~-~~~l~-~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~-~~l~~L~~l~l~~N~~l  304 (313)
T 1ogq_A          228 LAKNSLAFDLGK-VGLSK-NLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNKCL  304 (313)
T ss_dssp             CCSSEECCBGGG-CCCCT-TCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGGGSCGGGTCSSSEE
T ss_pred             CCCCceeeecCc-ccccC-CCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCCC-ccccccChHHhcCCCCc
Confidence            999999866665 45454 9999999999999999999999999999999999999888886 889999999999999 6


Q ss_pred             ee
Q 036258          320 QG  321 (331)
Q Consensus       320 ~~  321 (331)
                      .|
T Consensus       305 c~  306 (313)
T 1ogq_A          305 CG  306 (313)
T ss_dssp             ES
T ss_pred             cC
Confidence            65



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 331
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 62.7 bits (151), Expect = 9e-12
 Identities = 57/276 (20%), Positives = 101/276 (36%), Gaps = 20/276 (7%)

Query: 56  SLKMIRLSSNSLSGSLPNDLCNRLPSLEQLVLRSNGFFGQIPLSLSKCTQLQHLWLEHNK 115
            L++++ S   L   +P DL    P    L L++N               L  L L +NK
Sbjct: 11  HLRVVQCSDLGLE-KVPKDL---PPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNK 66

Query: 116 FTGRLPENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLALGMNKLRTIPNSI 175
            +   P     L KL  L L      +    LP  +  +L  L+     + K+R    + 
Sbjct: 67  ISKISPGAFAPLVKLERLYL----SKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNG 122

Query: 176 TNASELTLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIY 235
            N   +  L       SG+    F  ++ LS + + +  +TT           SLT    
Sbjct: 123 LNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQ----GLPPSLTE--- 175

Query: 236 LKVLGLHSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDL 295
              L L  N+++ +    +    ++L +       +       + N   L +L L +N L
Sbjct: 176 ---LHLDGNKITKVDAASLKGL-NNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKL 231

Query: 296 NGTIPTTVGRLQQLQGLFLFGNNLQGSIPSDLCHWG 331
              +P  +   + +Q ++L  NN+     +D C  G
Sbjct: 232 V-KVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPG 266


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.66
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.59
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.55
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.28
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.22
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.94
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.85
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.53
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.35
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=5.6e-32  Score=231.50  Aligned_cols=286  Identities=30%  Similarity=0.470  Sum_probs=238.1

Q ss_pred             CChhhHHHHHHHHHhccCCCCCCCcc------h---hc--------CCCCccEEEcCCCcCcc--CCChhhhcCCCCCcE
Q 036258           24 NITTDQSALLAFKAHIADPYSVLTKN------C---FY--------NISSLKMIRLSSNSLSG--SLPNDLCNRLPSLEQ   84 (331)
Q Consensus        24 ~~~~~~~~l~~~~~~~~~~~~~~~~~------~---~~--------~~~~L~~L~l~~~~i~~--~~~~~~~~~~~~L~~   84 (331)
                      |.++|+.|+++||..+.+|. .+..|      |   +.        .-.+++.|+++++.+.+  .+|+.+ ..+++|++
T Consensus         3 c~~~e~~aLl~~k~~~~~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l-~~L~~L~~   80 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSL-ANLPYLNF   80 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGG-GGCTTCSE
T ss_pred             CCHHHHHHHHHHHHHCCCCC-cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHH-hcCccccc
Confidence            67899999999999988763 34444      2   11        22369999999998876  478877 78999999


Q ss_pred             EEccC-CcccccCCccCcCCCCCCEEEccCccccccCCccccCcccccccccCccccccccccCCcchhcCCCCCcEEEc
Q 036258           85 LVLRS-NGFFGQIPLSLSKCTQLQHLWLEHNKFTGRLPENIGNLSKLRSLVLGHKAHNSLHGHLPSTLSVSLPNLKWLAL  163 (331)
Q Consensus        85 L~L~~-n~i~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l  163 (331)
                      |+|++ |.+.+.+|..|+++++|++|++++|++.+..+..+..+.+|+.+++++|.   ....++..+. .+++++++++
T Consensus        81 L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~---~~~~~p~~l~-~l~~L~~l~l  156 (313)
T d1ogqa_          81 LYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNA---LSGTLPPSIS-SLPNLVGITF  156 (313)
T ss_dssp             EEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSE---EESCCCGGGG-GCTTCCEEEC
T ss_pred             cccccccccccccccccccccccchhhhccccccccccccccchhhhccccccccc---ccccCchhhc-cCcccceeec
Confidence            99997 78988999999999999999999999998888889999999999996544   4445565555 8999999999


Q ss_pred             CCCCCC-CCcccccCCCCC-ceeeCcCccccccCchhccCCCCCCEEEccCCcccCccCCCccccccccccCCCCcEEEe
Q 036258          164 GMNKLR-TIPNSITNASEL-TLLELGKNSFSGLVPNTFGNLRFLSLLDLGNNYLTTRSSTTEWSFLSSLTNCIYLKVLGL  241 (331)
Q Consensus       164 ~~~~l~-~~~~~~~~l~~L-~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~~~~~~~L~~L~l  241 (331)
                      .+|.+. .+|..+..+..+ +.+.+++|++.+..+..+..+. ...+++..+....       ..+..+..+++++.+++
T Consensus       157 ~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~-~~~l~l~~~~~~~-------~~~~~~~~~~~l~~l~~  228 (313)
T d1ogqa_         157 DGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEG-------DASVLFGSDKNTQKIHL  228 (313)
T ss_dssp             CSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEEEE-------CCGGGCCTTSCCSEEEC
T ss_pred             cccccccccccccccccccccccccccccccccccccccccc-ccccccccccccc-------ccccccccccccccccc
Confidence            999987 678888778776 8889999999988888887765 4579999887765       45666788999999999


Q ss_pred             ecccccccCCchhhhccccccEEEeccCcccccCCccccCCCCCCEEEccCCCCcccCCcCccCCCCCCeEeccCCe-ee
Q 036258          242 HSNQLSGILPPLIGNFSDSLQQFYAYDCELKGSIPQEIGNLNGLIDLRLQDNDLNGTIPTTVGRLQQLQGLFLFGNN-LQ  320 (331)
Q Consensus       242 ~~n~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~-~~  320 (331)
                      .++.+.+.++ .+.... +++.|++++|++++.+|.++.++++|+.|++++|.++|.+|+ ++.+++|+.+++++|+ +.
T Consensus       229 ~~~~l~~~~~-~~~~~~-~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~  305 (313)
T d1ogqa_         229 AKNSLAFDLG-KVGLSK-NLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLC  305 (313)
T ss_dssp             CSSEECCBGG-GCCCCT-TCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEE
T ss_pred             cccccccccc-cccccc-ccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCcccc
Confidence            9999986554 455554 999999999999999999999999999999999999998885 6789999999999998 66


Q ss_pred             ec-CCcc
Q 036258          321 GS-IPSD  326 (331)
Q Consensus       321 ~~-~p~~  326 (331)
                      |. +|.+
T Consensus       306 g~plp~c  312 (313)
T d1ogqa_         306 GSPLPAC  312 (313)
T ss_dssp             STTSSCC
T ss_pred             CCCCCCC
Confidence            64 6643



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure