Citrus Sinensis ID: 036269


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620---
MHDVVRYVAQQIASKNKFLIKAGVELKDWPSINTFEDLTGISLMFNDIHEVHEGLQCPRLQALFLQKNDLLDIPDPFFQGMKDLKVLDLGGSGVFSLFSLPSSLSFLINLRTLSLHDCQHFGDLSLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCYNLELIPRGVLSRLRKLEELYMSKTFCHWQFENEDDSRSNAKFIELGALSRLTSLHIDIPEGEIMPSDMSFQNLTSFSITIGGPEEVPLSDFIEVFSRKFKKRCSRAMGLSQDMRISALPSWIKNLLLRSEILALGDVNDLENIVSDLAHDGFNELMFLAIVGCNEMKYLLNSLERTLRVTLLKLEWLMIVDNRNFVEICHGQLPAGCLSNVKRLDVRDCGSVLKILPSHLVQSFQNLQRLRVEGCELLVSVFEIERVNIAKEETELFSSLEKLTLIGLPRMTDIWKGDTQFVSLHDLKKIRVVFCDELRQVFPANLGKKAAAEEMVLYRNRRDQIHIHATTSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVSRCPTLQEIIMNDEGEVGLQGASTEKITFPSLFSIQLCLLDSLTCFCSSGSHATVEFLALEALQIIDCPGMKTF
ccHHHHHHHHHHHHccEEEEEcccccccccccccccccEEEEEEcccccccccccccccccEEEccccccccccHHHHcccccccEEEccccccccccccccHHHccccccEEEccccccccccccccccccccEEEccccccccccHHHcccccccEEccccccccccccHHHHHccccccEEEccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHccccccEEEccccccccccccccccccccccEEEEEcccccEEEccccccccccccccccEEEEcccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccEEEEccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccHHccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccEEc
ccHHHHHHHHHHHccccEEEEccccccccccHHHHccEEEEEEccccHHHccccccccccEEEEEcccccccccHHHHHHccccEEEEcccccccccccccccHHHHHcccEEEccccccccccHHHHHHHccEEEEcccccHHHccHHHHHHHcccEEEccccccccEccHHHHHHHHcccEEEEcccccEEEEcccccccccccHHHHHHHccccEEEEEEccccccccccccccccEEEEEEEEccccccccccccccHHHHHHHHHHHEccccccccccHHHHHHHHHHccEEEEcccccccEcccccccccccccEEEEEEccccHHHccccccccHHHHcccccEEEEcccHcHHHHHcccccccccccccEEEEcccHHHHHHccccHHcccccccEEEEcccccHHEEEcccccccccccccccccccEEEEcccccccEEcccccccccccccEEEEEcccHHHHHcccHHHHHHHHHccEEEEccccccEEEEccccccccccccccccEEEEcccHcHHHcccHHHHHHHHcccEEEEcccHHHHHHEcccccHHcccccccccEEcccccEEEEcccccccEccccccccccccccccEEEEEcccccccc
MHDVVRYVAQQIASKNKFLIKAGvelkdwpsintfedltgislmFNDIHevheglqcprlQALFlqkndlldipdpffqgmkdlkvldlggsgvfslfslpssLSFLINLRtlslhdcqhfgdlsligeLSLLEIldlsesdvseipvsfgrlghlrlldltdcynleliprGVLSRLRKLEELYMSKTFChwqfeneddsrsnaKFIELGALSRLtslhidipegeimpsdmsfqnltsfsitiggpeevplsDFIEVFSRKFKKRCSRAMGLSQDMRISALPSWIKNLLLRSEILalgdvndlENIVSDLAHDGFNELMFLAIVGCNEMKYLLNSLERTLRVTLLKLEWLMIVDNRNfveichgqlpagclsnvkrldvrdcgsvlkilpSHLVQSFQNLQRLRVEGCELLVSVFEIERVNIAKEETELFSSLEKLtliglprmtdiwkgdtqfvsLHDLKKIRVVFCDELRQVFPANLGKKAAAEEMVLYRNRRDQihihattstssptpslgnlvsITIRGCGKLRNLFTTSMVKSLVRleslevsrcptlqeiimndegevglqgastekitfpsLFSIQLCLLDsltcfcssgshaTVEFLALEALqiidcpgmktf
MHDVVRYVAQQIASKNKFLIKAGVELKDWPSINTFEDLTGISLMFNDIHEVHEGLQCPRLQALFLQKNDLLDIPDPFFQGMKDLKVLDLGGSGVFSLFSLPSSLSFLINLRTLSLHDCQHFGDLSLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCYNLELIPRGVLSRLRKLEELYMSKTFCHWQFENEDDSRSNAKFIELGALSRLTSLHIDIPEGEIMPSDMSFQNLTSFSITIGGPEEVPLSDFIEVFSRKFKKRCSRamglsqdmRISALPSWIKNLLLRSEILALGDVNDLENIVSDLAHDGFNELMFLAIVGCNEMKYLLNSLERTLRVTLLKLEWLMIVDNRNFVEICHGQLPAGCLSNVKRLDVRDCGSVLKILPSHLVQSFQNLQRLRVEGCELLVSVFEIERVNIAKEETELFSSLEKLTLIGLPRMTDIWKGDTQFVSLHDLKKIRVVFCDELRQvfpanlgkkaaAEEMVLYRNRRDQIHIhattstssptpslgNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVSRCPTLQEIIMNDEGEVGLQGASTEKITFPSLFSIQLCLLDSLTCFCSSGSHATVEFLALEALQIIDCPGMKTF
MHDVVRYVAQQIASKNKFLIKAGVELKDWPSINTFEDLTGISLMFNDIHEVHEGLQCPRLQALFLQKNDLLDIPDPFFQGMKDLKVldlggsgvfslfslpsslsflINLRTLSLHDCQHFgdlsligelslleildlsesdVSEIPVSFGRLGHLRLLDLTDCYNLELIPRGVLSRLRKLEELYMSKTFCHWQFENEDDSRSNAKFIELGALSRLTSLHIDIPEGEIMPSDMSFQNLTSFSITIGGPEEVPLSDFIEVFSRKFKKRCSRAMGLSQDMRISALPSWIKNLLLRSEILALGDVNDLENIVSDLAHDGFNELMFLAIVGCNEMKYLLNSLERTLRVTLLKLEWLMIVDNRNFVEICHGQLPAGCLSNVKRLDVRDCGSVLKILPSHLVQSFQNLQRLRVEGCELLVSVFEIERVNIAKEETELFSSLEKLTLIGLPRMTDIWKGDTQFVSLHDLKKIRVVFCDELRQVFPANLGKKAAAEEMVLYRNRRDQIHIHAttstssptpsLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVSRCPTLQEIIMNDEGEVGLQGASTEKITFPSLFSIQLCLLDSLTCFCSSGSHATVEFLALEALQIIDCPGMKTF
***VVRYVAQQIASKNKFLIKAGVELKDWPSINTFEDLTGISLMFNDIHEVHEGLQCPRLQALFLQKNDLLDIPDPFFQGMKDLKVLDLGGSGVFSLFSLPSSLSFLINLRTLSLHDCQHFGDLSLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCYNLELIPRGVLSRLRKLEELYMSKTFCHWQFENE*****NAKFIELGALSRLTSLHIDIPEGEIMPSDMSFQNLTSFSITIGGPEEVPLSDFIEVFSRKFKKRCSRAMGLSQDMRISALPSWIKNLLLRSEILALGDVNDLENIVSDLAHDGFNELMFLAIVGCNEMKYLLNSLERTLRVTLLKLEWLMIVDNRNFVEICHGQLPAGCLSNVKRLDVRDCGSVLKILPSHLVQSFQNLQRLRVEGCELLVSVFEIERVNIAKEETELFSSLEKLTLIGLPRMTDIWKGDTQFVSLHDLKKIRVVFCDELRQVFPANLGKKAAAEEMVLYRNRRDQIHIHA**********LGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVSRCPTLQEIIMNDEGEVGLQGASTEKITFPSLFSIQLCLLDSLTCFCSSGSHATVEFLALEALQIIDCP*****
MHDVVRYVAQQIASKNKFLIKAGVELKDWPSINTFEDLTGISLMFNDIHEVHEGLQCPRLQALFLQKNDLLDIPDPFFQGMKDLKVLDLGGSGVFSLFSLPSSLSFLINLRTLSLHDCQHFGDLSLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCYNLELIPRGVLSRLRKLEELYMSKTFCHW**************IELGALSRLTSLHIDIPEGEIMPSDMSFQNLTSFSITIGGPEEVPLSDFIEVFSRKFKKRCSRAMGLSQDMRISALPSWIKNLLLRSEILALGDVNDLENIVSDLAHDGFNELMFLAIVGCNEMKYLLNSLERTLRVTLLKLEWLMIVDNRNFVEICHGQLPAGCLSNVKRLDVRDCGSVLKILPSHLVQSFQNLQRLRVEGCELLVSV***************FSSLEKLTLIGLPRMTDIWKGDTQFVSLHDLKKIRVVFCDELRQVFPANLGKKAAAEEMVLYRNRRDQIHIHATTSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVSRCPTLQEIIMN*************KITFPSLFSIQLCLLDSLTCFCSSGSHATVEFLALEALQIIDCPGMKTF
MHDVVRYVAQQIASKNKFLIKAGVELKDWPSINTFEDLTGISLMFNDIHEVHEGLQCPRLQALFLQKNDLLDIPDPFFQGMKDLKVLDLGGSGVFSLFSLPSSLSFLINLRTLSLHDCQHFGDLSLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCYNLELIPRGVLSRLRKLEELYMSKTFCHWQFENEDDSRSNAKFIELGALSRLTSLHIDIPEGEIMPSDMSFQNLTSFSITIGGPEEVPLSDFIEVFSRKFKKRCSRAMGLSQDMRISALPSWIKNLLLRSEILALGDVNDLENIVSDLAHDGFNELMFLAIVGCNEMKYLLNSLERTLRVTLLKLEWLMIVDNRNFVEICHGQLPAGCLSNVKRLDVRDCGSVLKILPSHLVQSFQNLQRLRVEGCELLVSVFEIERVNIAKEETELFSSLEKLTLIGLPRMTDIWKGDTQFVSLHDLKKIRVVFCDELRQVFPANLGKKAAAEEMVLYRNRRDQIHIHATTSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVSRCPTLQEIIMNDEGEVGLQGASTEKITFPSLFSIQLCLLDSLTCFCSSGSHATVEFLALEALQIIDCPGMKTF
*HDVVRYVAQQIASKNKFLIKAGVELKDWPSINTFEDLTGISLMFNDIHEVHEGLQCPRLQALFLQKNDLLDIPDPFFQGMKDLKVLDLGGSGVFSLFSLPSSLSFLINLRTLSLHDCQHFGDLSLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCYNLELIPRGVLSRLRKLEELYMSKTFCHWQFENEDDSRSNAKFIELGALSRLTSLHIDIPEGEIMPSDMSFQNLTSFSITIGGPEEVPLSDFIEVFSRKFKKRCSRAMGLSQDMRISALPSWIKNLLLRSEILALGDVNDLENIVSDLAHDGFNELMFLAIVGCNEMKYLLNSLERTLRVTLLKLEWLMIVDNRNFVEICHGQLPAGCLSNVKRLDVRDCGSVLKILPSHLVQSFQNLQRLRVEGCELLVSVFEIERVNIAKEETELFSSLEKLTLIGLPRMTDIWKGDTQFVSLHDLKKIRVVFCDELRQVFPANLGKKAAAEEMVLYRNRRDQIHIHATTSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVSRCPTLQEIIMNDEGE*GLQGASTEKITFPSLFSIQLCLLDSLTCFCSSGSHATVEFLALEALQIIDCPGMK**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDVVRYVAQQIASKNKFLIKAGVELKDWPSINTFEDLTGISLMFNDIHEVHEGLQCPRLQALFLQKNDLLDIPDPFFQGMKDLKVLDLGGSGVFSLFSLPSSLSFLINLRTLSLHDCQHFGDLSLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCYNLELIPRGVLSRLRKLEELYMSKTFCHWQFENEDDSRSNAKFIELGALSRLTSLHIDIPEGEIMPSDMSFQNLTSFSITIGGPEEVPLSDFIEVFSRKFKKRCSRAMGLSQDMRISALPSWIKNLLLRSEILALGDVNDLENIVSDLAHDGFNELMFLAIVGCNEMKYLLNSLERTLRVTLLKLEWLMIVDNRNFVEICHGQLPAGCLSNVKRLDVRDCGSVLKILPSHLVQSFQNLQRLRVEGCELLVSVFEIERVNIAKEETELFSSLEKLTLIGLPRMTDIWKGDTQFVSLHDLKKIRVVFCDELRQVFPANLGKKAAAEEMVLYRNRRDQIHIHATTSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVSRCPTLQEIIMNDEGEVGLQGASTEKITFPSLFSIQLCLLDSLTCFCSSGSHATVEFLALEALQIIDCPGMKTF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query623 2.2.26 [Sep-21-2011]
Q9T048985 Disease resistance protei yes no 0.492 0.311 0.300 8e-19
Q42484909 Disease resistance protei no no 0.601 0.412 0.269 3e-18
O81825919 Probable disease resistan no no 0.346 0.235 0.314 1e-16
O64973889 Disease resistance protei no no 0.253 0.177 0.368 5e-15
Q940K0889 Probable disease resistan no no 0.219 0.154 0.341 2e-14
P60838894 Probable disease resistan no no 0.218 0.152 0.359 1e-13
P60839884 Probable disease resistan no no 0.181 0.127 0.404 3e-13
Q8RXS5888 Probable disease resistan no no 0.181 0.127 0.383 4e-11
O23317719 Probable disease resistan no no 0.223 0.193 0.340 4e-11
O64789925 Probable disease resistan no no 0.219 0.148 0.317 5e-11
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function desciption
 Score = 95.9 bits (237), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 101/336 (30%), Positives = 154/336 (45%), Gaps = 29/336 (8%)

Query: 1   MHDVVRYVAQQIASKNK----FLIKAGVELKDWPSINTFEDLTGISLMFNDIHEVHEGLQ 56
           MHDVVR  A  I S ++     L+ +G  L+D         L  +SLM N +  + + ++
Sbjct: 462 MHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVE 521

Query: 57  --CPRLQALFLQKNDLL-DIPDPFFQGMKDLKVLDLGGSGVFSLFSLPSSLSFLINLRTL 113
             C +   L LQ N LL ++P  F Q    L++L+L G+ + S  S   SL  L +L +L
Sbjct: 522 EFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPS--CSLLRLFSLHSL 579

Query: 114 SLHDCQHFGDLSLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCYNLELIPRG 173
            L DC     L  +  L+ LE+LDL  + + E P     L   R LDL+   +LE IP  
Sbjct: 580 FLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPAR 639

Query: 174 VLSRLRKLEELYMSKTFCHWQFENEDDSRSNAKFIELGALSRLTSLHIDIPEGEIM--PS 231
           V+SRL  LE L M+ +   W  + E   +  A   E+G L RL  L I +     +    
Sbjct: 640 VVSRLSSLETLDMTSSHYRWSVQGE-TQKGQATVEEIGCLQRLQVLSIRLHSSPFLLNKR 698

Query: 232 DMSFQNLTSFSITIGGPEEVPLSDFIEVFSRKFKKRCSRAMGLSQDMRISALPSWIKNLL 291
           +   + L  F + +G       S +I + +R  K+R + +      + +S +   I  LL
Sbjct: 699 NTWIKRLKKFQLVVG-------SRYI-LRTRHDKRRLTIS-----HLNVSQVS--IGWLL 743

Query: 292 LRSEILALGDVNDLENIVSDLAHD--GFNELMFLAI 325
             +  LAL     +E ++  L  D  GF  L  L I
Sbjct: 744 AYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTI 779




Disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|O23317|DRL24_ARATH Probable disease resistance protein At4g14610 OS=Arabidopsis thaliana GN=At4g14610 PE=3 SV=1 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query623
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.948 0.449 0.328 4e-77
359494129 1144 PREDICTED: disease resistance protein At 0.977 0.532 0.342 3e-76
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.948 0.441 0.338 2e-72
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.945 0.440 0.336 7e-71
297735461 1063 unnamed protein product [Vitis vinifera] 0.873 0.511 0.342 1e-70
147832986 975 hypothetical protein VITISV_010740 [Viti 0.873 0.557 0.340 6e-70
225445915 1063 PREDICTED: disease resistance protein At 0.871 0.510 0.345 1e-69
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.950 0.240 0.323 4e-67
297735460 1042 unnamed protein product [Vitis vinifera] 0.834 0.499 0.331 1e-64
359488103 1530 PREDICTED: disease resistance protein At 0.902 0.367 0.316 1e-64
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  295 bits (755), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 212/645 (32%), Positives = 336/645 (52%), Gaps = 54/645 (8%)

Query: 1    MHDVVRYVAQQIASKNKFLIKAGVELKDWPSINTFEDLTGISLMFNDIHEVHEGLQCPRL 60
            MHDVV   A  +A ++  ++    E K+WP+ +  +  T ISL F  I ++   L+CP L
Sbjct: 460  MHDVVHSFAISVALRDHHVLTVADEFKEWPANDVLQQYTAISLPFRKIPDLPAILECPNL 519

Query: 61   QA-LFLQKNDLLDIPDPFFQGMKDLKVLDLGGSGVFSLFSLPSSLSFLINLRTLSLHDCQ 119
             + L L K+  L IPD FF+ MK+LK+LDL      +L  LPSSL FL NL+TL L  C 
Sbjct: 520  NSFLLLNKDPSLQIPDSFFREMKELKILDLTE---VNLSPLPSSLQFLENLQTLCLDHCV 576

Query: 120  HFGDLSLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCYNLELIPRGVLSRLR 179
               D+S+IGEL+ L++L L  S++  +P   G++  L+LLDL++C  LE+I    LS L 
Sbjct: 577  -LEDISIIGELNKLKVLSLMSSNIVRLPREIGKVTRLQLLDLSNCERLEVISPNALSSLT 635

Query: 180  KLEELYMSKTFCHWQFENEDDSRSNAKFIELGALSRLTSLHIDIPEGEIMPSDM--SFQN 237
            +LE+LYM  +F  W+ E     R+NA   EL  LS L++LH+ I + + MP D+  SFQN
Sbjct: 636  RLEDLYMGNSFVKWETEGSSSQRNNACLSELKHLSNLSTLHMQITDADNMPKDLFSSFQN 695

Query: 238  LTSFSITIGGPEEVPLSDFIEVFSRKFKKRCSRAMGLSQDMRISALPSWIKNLLLRSEIL 297
            L  F I IG   +  + D     SR  K + +  + L +          +  LL  +E L
Sbjct: 696  LERFRIFIGDGWDWSVKD---ATSRTLKLKLNTVIQLEEG---------VNTLLKITEEL 743

Query: 298  ALGDVNDLENIVSDLAHDGFNELMFLAIVGCNEMKYLLNSLERTLRVTLLKLEWLMIVDN 357
             L ++N +++I++DL  +GF +L  L +  C  ++Y++NS+    R   L L+ L + + 
Sbjct: 744  HLQELNGVKSILNDLDGEGFPQLRHLHVQNCPGVQYIINSIRMGPRTAFLNLDSLFLENL 803

Query: 358  RNFVEICHGQLPAGCLSNVKRLDVRDCGSVLKILPSHLVQSFQNLQRLRVEGCELLVSVF 417
             N  +ICHGQL A  L N++ L V  C  +  +    + +    L+ + +  C+++  V 
Sbjct: 804  DNLEKICHGQLMAESLGNLRILKVESCHRLKNLFSVSMARRLVRLEEITIIDCKIMEEVV 863

Query: 418  EIERVNIAKEETEL--FSSLEKLTLIGLPRMTDIWKGDTQFVSLH-------DLKKIRVV 468
              E  N A +   +  F+ L +LTL  LP          QF S H       D ++ + +
Sbjct: 864  AEESENDAADGEPIIEFTQLRRLTLQCLP----------QFTSFHSNVEESSDSQRRQKL 913

Query: 469  FCDELR--QVFPAN-LGKKAAA-EEMVLYRNRRD------QIHIHATTSTSSPTPSLGNL 518
               E R  ++   N LG   +     +L+ N  D      ++        S  +P + NL
Sbjct: 914  LASEARSKEIVAGNELGTSMSLFNTKILFPNLEDLKLSSIKVEKIWHDQPSVQSPCVKNL 973

Query: 519  VSITIRGCGKLRNLFTTSMVKSLVRLESLEVSRCPTLQEIIMNDEGEVGLQGASTEKITF 578
             SI +  C  L  L T+SMV+SL +L+ LE+  C +++EI++ +  ++G +G    K+ F
Sbjct: 974  ASIAVENCRNLNYLLTSSMVESLAQLKKLEICNCKSMEEIVVPE--DIG-EGKMMSKMLF 1030

Query: 579  PSLFSIQLCLLDSLTCFCSSGSHATVEFLALEALQIIDCPGMKTF 623
            P L  + L  L  LT FC+S     +E  +L+ L + +CP +K F
Sbjct: 1031 PKLLILSLIRLPKLTRFCTSN---LLECHSLKVLTVGNCPELKEF 1072




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359494129|ref|XP_002278428.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297735461|emb|CBI17901.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147832986|emb|CAN77367.1| hypothetical protein VITISV_010740 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225445915|ref|XP_002263288.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297735460|emb|CBI17900.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query623
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.707 0.447 0.248 7e-14
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.415 0.284 0.255 1.2e-12
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.138 0.096 0.417 1.7e-11
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.736 0.499 0.229 2e-11
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.138 0.097 0.347 7.2e-10
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.138 0.095 0.406 1.6e-09
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.138 0.095 0.351 3.5e-09
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.126 0.088 0.411 1.8e-08
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.138 0.097 0.391 3.2e-08
TAIR|locus:2008510967 AT1G61190 "AT1G61190" [Arabido 0.138 0.088 0.362 3.8e-08
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 215 (80.7 bits), Expect = 7.0e-14, P = 7.0e-14
 Identities = 124/498 (24%), Positives = 200/498 (40%)

Query:     1 MHDVVRYVAQQIASKNK----FLIKAGVELKDWPSINTFEDLTGISLMFNDIHEVHEGLQ 56
             MHDVVR  A  I S ++     L+ +G  L+D         L  +SLM N +  + + ++
Sbjct:   462 MHDVVRDFAIWIMSSSQDDSHSLVMSGTGLQDIRQDKLAPSLRRVSLMNNKLESLPDLVE 521

Query:    57 --CPRLQALFLQKNDLL-DIPDPFFQGMKDLKVXXXXXXXXXXXXXXXXXXXXXINLRTL 113
               C +   L LQ N LL ++P  F Q    L++                      +L +L
Sbjct:   522 EFCVKTSVLLLQGNFLLKEVPIGFLQAFPTLRILNLSGTRIKSFPSCSLLRL--FSLHSL 579

Query:   114 SLHDCQHFXXXXXXXXXXXXXXXXXXXXXVSEIPVSFGRLGHLRLLDLTDCYNLELIPRG 173
              L DC                        + E P     L   R LDL+   +LE IP  
Sbjct:   580 FLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSRTLHLESIPAR 639

Query:   174 VLSRLRKLEELYMSKTFCHWQFENEDDSRSNAKFIELGALSRLTSLHIDIPEGEIMPSDM 233
             V+SRL  LE L M+ +   W  + E   +  A   E+G L RL  L I +     + +  
Sbjct:   640 VVSRLSSLETLDMTSSHYRWSVQGETQ-KGQATVEEIGCLQRLQVLSIRLHSSPFLLNKR 698

Query:   234 S--FQNLTSFSITIGGPEEVPLSDFIEVFSRKFKKRCSRA-MGLSQDMRISALPSWIKNL 290
             +   + L  F + +G       S +I + +R  K+R + + + +SQ   +S    W   L
Sbjct:   699 NTWIKRLKKFQLVVG-------SRYI-LRTRHDKRRLTISHLNVSQ---VSI--GW---L 742

Query:   291 LLRSEILALGDVNDLENIVSDLAHD--GFNELMFLAI----VGCN---EMKYLLNSLERT 341
             L  +  LAL     +E ++  L  D  GF  L  L I    +  N   EM     S + +
Sbjct:   743 LAYTTSLALNHCQGIEAMMKKLVSDNKGFKNLKSLTIENVIINTNSWVEMVSTNTSKQSS 802

Query:   342 LRVTLL-KLEWLMI--VDNRNFVEICHGQLPAGC-LSNVKRLDVRDCGSVLKILPSHLVQ 397
               + LL  LE L +  VD   F E+   Q   G  L  +K +++  C  +  +L      
Sbjct:   803 DILDLLPNLEELHLRRVDLETFSEL---QTHLGLKLETLKIIEITMCRKLRTLLDKRNFL 859

Query:   398 SFQNLQRLRVEGCELLVSVFEIERVNIAKEETELFSSLEKLTLIGLPRMTDI--WKGDTQ 455
             +  NL+ + +  C+ L ++ E    +          +L  L L  LP +  I  W G+  
Sbjct:   860 TIPNLEEIEISYCDSLQNLHEALLYH-----QPFVPNLRVLKLRNLPNLVSICNW-GEVW 913

Query:   456 FVSLHDLKKIRVVFCDEL 473
                   L+++ V+ C++L
Sbjct:   914 ----ECLEQVEVIHCNQL 927




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00027341001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (963 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query623
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 0.002
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 46.5 bits (110), Expect = 3e-05
 Identities = 55/217 (25%), Positives = 83/217 (38%), Gaps = 17/217 (7%)

Query: 31  SINTFEDLTGISLM-----FNDI-HEVHEGLQCPRLQALFLQKNDLLDIPDPFFQGMKDL 84
            I     L   +L       N I          P L+ L L  NDL D+P      + +L
Sbjct: 130 DIPPLIGLLKSNLKELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLP-KLLSNLSNL 188

Query: 85  KVLDLGGSGVFSLFSLPSSLSFLINLRTLSLHDCQHFGDLSLIGELSLLEILDLSESDVS 144
             LDL G+    +  LP  +  L  L  L L +      LS +  L  L  L+LS + + 
Sbjct: 189 NNLDLSGNK---ISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLE 245

Query: 145 EIPVSFGRLGHLRLLDLTDCYNLELIPRGVLSRLRKLEELYMSKT-------FCHWQFEN 197
           ++P S G L +L  LDL++     +   G L+ LR+L+    S +             E 
Sbjct: 246 DLPESIGNLSNLETLDLSNNQISSISSLGSLTNLRELDLSGNSLSNALPLIALLLLLLEL 305

Query: 198 EDDSRSNAKFIELGALSRLTSLHIDIPEGEIMPSDMS 234
             +     K +EL   S L + +I        P  +S
Sbjct: 306 LLNLLLTLKALELKLNSILLNNNILSNGETSSPEALS 342


Length = 394

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 623
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.84
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.56
KOG4237498 consensus Extracellular matrix protein slit, conta 99.54
KOG4237498 consensus Extracellular matrix protein slit, conta 99.54
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.53
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.48
KOG4341483 consensus F-box protein containing LRR [General fu 99.45
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.4
KOG4341483 consensus F-box protein containing LRR [General fu 99.32
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.3
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.25
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.2
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.98
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.94
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.9
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.86
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.86
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.79
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.49
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.49
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.41
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.38
PLN03150623 hypothetical protein; Provisional 98.34
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.33
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.33
PLN03150623 hypothetical protein; Provisional 98.33
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.29
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.27
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.27
PRK15386 426 type III secretion protein GogB; Provisional 98.21
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.14
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.1
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.09
PRK15386 426 type III secretion protein GogB; Provisional 98.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.92
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.82
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.81
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.69
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.67
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.67
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.62
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.44
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.33
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.28
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.05
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.95
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.93
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.59
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.38
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.12
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.6
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.58
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.96
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.66
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.62
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 90.67
smart0037026 LRR Leucine-rich repeats, outliers. 88.36
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.36
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 87.82
smart0037026 LRR Leucine-rich repeats, outliers. 86.98
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.98
KOG0473326 consensus Leucine-rich repeat protein [Function un 83.12
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.2e-38  Score=357.69  Aligned_cols=516  Identities=20%  Similarity=0.224  Sum_probs=331.5

Q ss_pred             CCCCCCCCCCC--CCCCcEEEcccCCccc-ccccC-CCCCcceEEccCCCCC-CCChhhHhCCCcccEEEccCCcccccC
Q 036269           24 VELKDWPSINT--FEDLTGISLMFNDIHE-VHEGL-QCPRLQALFLQKNDLL-DIPDPFFQGMKDLKVLDLGGSGVFSLF   98 (623)
Q Consensus        24 ~~~~~~~~~~~--~~~l~~L~l~~~~~~~-l~~~~-~~~~L~~L~l~~~~~~-~l~~~~~~~l~~Lr~L~l~~~~~~~~~   98 (623)
                      .....|.++..  ..+++.|+++++.+.. ++..+ .+++|+.|++++|.+. .+|..++..+++||+|++++|.+.  +
T Consensus        55 ~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~--~  132 (968)
T PLN00113         55 ADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFT--G  132 (968)
T ss_pred             CCCCcCcceecCCCCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccc--c
Confidence            44566766643  4579999999998764 34444 8899999999999988 889888889999999999999986  5


Q ss_pred             CCchhhhccccCcEEeccCCcCCC-Cc-ccccCCcCCcEEEcCCCCCc-cccccccCCCccCEEeccCCCCCCcCchhhh
Q 036269           99 SLPSSLSFLINLRTLSLHDCQHFG-DL-SLIGELSLLEILDLSESDVS-EIPVSFGRLGHLRLLDLTDCYNLELIPRGVL  175 (623)
Q Consensus        99 ~lp~~~~~l~~L~~L~l~~~~~l~-~i-~~~~~l~~L~~L~l~~~~i~-~lp~~i~~l~~L~~L~l~~~~~~~~l~~~~~  175 (623)
                      .+|.  ..+++|++|++++|. +. .+ ..++++++|++|++++|.+. .+|..++++++|++|++++|.....+|.. +
T Consensus       133 ~~p~--~~l~~L~~L~Ls~n~-~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-l  208 (968)
T PLN00113        133 SIPR--GSIPNLETLDLSNNM-LSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE-L  208 (968)
T ss_pred             ccCc--cccCCCCEEECcCCc-ccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChH-H
Confidence            6664  468899999999998 64 34 56889999999999999876 77888999999999999997766677776 8


Q ss_pred             hccccCcEEEecccccccccccccccccccccccccCCCCccEEEeecCCCc-cCCCc-ccccCccEEEEEeCCCCCCCc
Q 036269          176 SRLRKLEELYMSKTFCHWQFENEDDSRSNAKFIELGALSRLTSLHIDIPEGE-IMPSD-MSFQNLTSFSITIGGPEEVPL  253 (623)
Q Consensus       176 ~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~-~~~~~-~~~~~L~~L~l~~~~~~~~~~  253 (623)
                      +++++|++|++++|.+.           ...+..++++++|+.|++++|.+. .+|.. ..+++|+.|+++.+......+
T Consensus       209 ~~l~~L~~L~L~~n~l~-----------~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p  277 (968)
T PLN00113        209 GQMKSLKWIYLGYNNLS-----------GEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIP  277 (968)
T ss_pred             cCcCCccEEECcCCccC-----------CcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCc
Confidence            89999999999988773           456677888889999999888754 45554 778888888888776433222


Q ss_pred             chhhhhhhhcccccccceeeeccccccccchHHHHHHHhhceeEeecccCCcccccccccccCccCccEEEEecccCcee
Q 036269          254 SDFIEVFSRKFKKRCSRAMGLSQDMRISALPSWIKNLLLRSEILALGDVNDLENIVSDLAHDGFNELMFLAIVGCNEMKY  333 (623)
Q Consensus       254 ~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~  333 (623)
                      ..+.       ..+.++.+++..+...+.+|.++..+ ++|+.|++.+|......+..+  ..+++|+.|++++|.-...
T Consensus       278 ~~l~-------~l~~L~~L~Ls~n~l~~~~p~~~~~l-~~L~~L~l~~n~~~~~~~~~~--~~l~~L~~L~L~~n~l~~~  347 (968)
T PLN00113        278 PSIF-------SLQKLISLDLSDNSLSGEIPELVIQL-QNLEILHLFSNNFTGKIPVAL--TSLPRLQVLQLWSNKFSGE  347 (968)
T ss_pred             hhHh-------hccCcCEEECcCCeeccCCChhHcCC-CCCcEEECCCCccCCcCChhH--hcCCCCCEEECcCCCCcCc
Confidence            1221       34567777777766555677776655 788888887776544333333  4577888888888732222


Q ss_pred             ecccccccccccccccceeecccCcccccccccccCC--CcCCCccEEEEeecCCcccccchhHHHhccccceEEEeccc
Q 036269          334 LLNSLERTLRVTLLKLEWLMIVDNRNFVEICHGQLPA--GCLSNVKRLDVRDCGSVLKILPSHLVQSFQNLQRLRVEGCE  411 (623)
Q Consensus       334 ~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~--~~~~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~l~~c~  411 (623)
                      ++.     ....+++|+.|+++++. +.    +.+|.  ..+++|+.|++++| .+.+..|.. +..+++|+.|++++ +
T Consensus       348 ~p~-----~l~~~~~L~~L~Ls~n~-l~----~~~p~~~~~~~~L~~L~l~~n-~l~~~~p~~-~~~~~~L~~L~L~~-n  414 (968)
T PLN00113        348 IPK-----NLGKHNNLTVLDLSTNN-LT----GEIPEGLCSSGNLFKLILFSN-SLEGEIPKS-LGACRSLRRVRLQD-N  414 (968)
T ss_pred             CCh-----HHhCCCCCcEEECCCCe-eE----eeCChhHhCcCCCCEEECcCC-EecccCCHH-HhCCCCCCEEECcC-C
Confidence            222     34456778888887775 22    22221  23566777777764 344445544 56677777777777 3


Q ss_pred             cceeeeeccceeccccccccccCccEEecCCccchhhcccCCCcccccCCccEEEEEcCCCcceeccCcccCcccchhhh
Q 036269          412 LLVSVFEIERVNIAKEETELFSSLEKLTLIGLPRMTDIWKGDTQFVSLHDLKKIRVVFCDELRQVFPANLGKKAAAEEMV  491 (623)
Q Consensus       412 ~l~~i~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~i~~~~~~~~~l~~L~~L~l~~C~~l~~~~~~~l~~~~~L~~l~  491 (623)
                      .++...        +..+..+++|+.|++++|.-...+   +.....+++|+.|++++|.-. ..+|..+ ...+|+.|+
T Consensus       415 ~l~~~~--------p~~~~~l~~L~~L~Ls~N~l~~~~---~~~~~~l~~L~~L~L~~n~~~-~~~p~~~-~~~~L~~L~  481 (968)
T PLN00113        415 SFSGEL--------PSEFTKLPLVYFLDISNNNLQGRI---NSRKWDMPSLQMLSLARNKFF-GGLPDSF-GSKRLENLD  481 (968)
T ss_pred             EeeeEC--------ChhHhcCCCCCEEECcCCcccCcc---ChhhccCCCCcEEECcCceee-eecCccc-ccccceEEE
Confidence            343322        444556666666766666322222   222334566666666665332 2223332 235566666


Q ss_pred             hhcccccccceeccccCCCCCCCCCCccEEEEecCCCcceecchhhhhccCCCCEEEEccCCchhhhhcCCCCcccCcCC
Q 036269          492 LYRNRRDQIHIHATTSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVSRCPTLQEIIMNDEGEVGLQGA  571 (623)
Q Consensus       492 ~~~~~~~~l~~~~~~~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~l~~L~~L~i~~c~~l~~l~~~~~~~~~~~~~  571 (623)
                      +.+|..       .+..|..+..+++|+.|++++|.-...+|.  .+.++++|++|++++|.-...++.           
T Consensus       482 ls~n~l-------~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~--~~~~l~~L~~L~Ls~N~l~~~~p~-----------  541 (968)
T PLN00113        482 LSRNQF-------SGAVPRKLGSLSELMQLKLSENKLSGEIPD--ELSSCKKLVSLDLSHNQLSGQIPA-----------  541 (968)
T ss_pred             CcCCcc-------CCccChhhhhhhccCEEECcCCcceeeCCh--HHcCccCCCEEECCCCcccccCCh-----------
Confidence            665532       334455555566666666666432223322  245566666666666652222211           


Q ss_pred             CcceeecCcccceecccCcccceecCCCCcceeecCCccEEEeccCC
Q 036269          572 STEKITFPSLFSIQLCLLDSLTCFCSSGSHATVEFLALEALQIIDCP  618 (623)
Q Consensus       572 ~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~L~~L~i~~c~  618 (623)
                        ....+++|+.|++++|.....++. ...   .+++|+.+++++|+
T Consensus       542 --~~~~l~~L~~L~Ls~N~l~~~~p~-~l~---~l~~L~~l~ls~N~  582 (968)
T PLN00113        542 --SFSEMPVLSQLDLSQNQLSGEIPK-NLG---NVESLVQVNISHNH  582 (968)
T ss_pred             --hHhCcccCCEEECCCCcccccCCh-hHh---cCcccCEEeccCCc
Confidence              233455566666665554444433 221   24556666665554



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query623
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
 Score = 85.8 bits (213), Expect = 1e-18
 Identities = 35/162 (21%), Positives = 55/162 (33%), Gaps = 10/162 (6%)

Query: 33  NTFEDLTGISLMFNDIHEVHEGL--QCPRLQALFLQKNDL--LDIPDPFFQGMKDLKVLD 88
                 T + L  N +  +  G+  +  +L  L L  N L           G   LK LD
Sbjct: 25  GIPSSATRLELESNKLQSLPHGVFDKLTQLTKLSLSSNGLSFKGCCSQSDFGTTSLKYLD 84

Query: 89  LGGSGVFSLFSLPSSLSFLINLRTLSLHDCQ--HFGDLSLIGELSLLEILDLSESDVSEI 146
           L  +    + ++ S+   L  L  L           + S+   L  L  LD+S +     
Sbjct: 85  LSFN---GVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVA 141

Query: 147 PV-SFGRLGHLRLLDLTDCYNLELIPRGVLSRLRKLEELYMS 187
               F  L  L +L +      E     + + LR L  L +S
Sbjct: 142 FNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLS 183


>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query623
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.98
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.98
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.84
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.83
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.83
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.8
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.79
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.76
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.73
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.7
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.64
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.64
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.64
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.64
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.64
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.62
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.61
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.61
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.61
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.61
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.59
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.59
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.57
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.55
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.55
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.52
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.52
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.52
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.52
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.38
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.37
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.36
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.35
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.35
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.27
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.23
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.19
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.16
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.14
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.03
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.88
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.84
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.82
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.81
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.76
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.76
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.72
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.68
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.63
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.51
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.4
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.4
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.38
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.2
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.99
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.94
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.74
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.59
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.5
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.41
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.15
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.76
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.63
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=8.6e-40  Score=362.82  Aligned_cols=531  Identities=18%  Similarity=0.115  Sum_probs=351.6

Q ss_pred             CCCCCCCCcEEEcccCCcc-cccc--cC-CCCCcceEEccCCCCC-CCChhhHhCCCcccEEEccCCcccccCCCchh--
Q 036269           31 SINTFEDLTGISLMFNDIH-EVHE--GL-QCPRLQALFLQKNDLL-DIPDPFFQGMKDLKVLDLGGSGVFSLFSLPSS--  103 (623)
Q Consensus        31 ~~~~~~~l~~L~l~~~~~~-~l~~--~~-~~~~L~~L~l~~~~~~-~l~~~~~~~l~~Lr~L~l~~~~~~~~~~lp~~--  103 (623)
                      .+..+++|++|++++|.+. .+|.  .+ .+++|++|++++|.+. ..+..++.++++|++|++++|.+.  +..|..  
T Consensus        95 ~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~--~~~~~~~~  172 (768)
T 3rgz_A           95 GFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSIS--GANVVGWV  172 (768)
T ss_dssp             CCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCE--EETHHHHH
T ss_pred             hhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccC--CcCChhhh
Confidence            5677788999999999885 3555  44 7889999999998876 445444477888888888888885  445544  


Q ss_pred             -hhccccCcEEeccCCcCCCCcccccCCcCCcEEEcCCCCCccccccccCCCccCEEeccCCCCCCcCchhhhhccccCc
Q 036269          104 -LSFLINLRTLSLHDCQHFGDLSLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCYNLELIPRGVLSRLRKLE  182 (623)
Q Consensus       104 -~~~l~~L~~L~l~~~~~l~~i~~~~~l~~L~~L~l~~~~i~~lp~~i~~l~~L~~L~l~~~~~~~~l~~~~~~~l~~L~  182 (623)
                       +.++++|++|++++|. +........+++|++|++++|.+...+..++++++|++|++++|...+.+|.. +.++++|+
T Consensus       173 ~~~~l~~L~~L~Ls~n~-l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-l~~l~~L~  250 (768)
T 3rgz_A          173 LSDGCGELKHLAISGNK-ISGDVDVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSGDFSRA-ISTCTELK  250 (768)
T ss_dssp             HTTCCTTCCEEECCSSE-EESCCBCTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSCCCSCHHHH-TTTCSSCC
T ss_pred             hhccCCCCCEEECCCCc-ccccCCcccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCcCCCcccHH-HhcCCCCC
Confidence             6677888888888887 65443447778888888888877743334788888888888885544455554 77788888


Q ss_pred             EEEecccccccccccc-----------cccccccccccccCC-CCccEEEeecCCCc-cCCCc-ccccCccEEEEEeCCC
Q 036269          183 ELYMSKTFCHWQFENE-----------DDSRSNAKFIELGAL-SRLTSLHIDIPEGE-IMPSD-MSFQNLTSFSITIGGP  248 (623)
Q Consensus       183 ~L~l~~~~~~~~~~~~-----------~~~~~~~~~~~l~~l-~~L~~L~l~~~~~~-~~~~~-~~~~~L~~L~l~~~~~  248 (623)
                      +|++++|.+....+..           .......++..+... ++|+.|++++|.+. .+|.. ..+++|++|+++.+..
T Consensus       251 ~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l  330 (768)
T 3rgz_A          251 LLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNF  330 (768)
T ss_dssp             EEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEE
T ss_pred             EEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcc
Confidence            8888777664222110           001112344444443 66666666666653 33333 5666677777666543


Q ss_pred             C-CCCcchhhhhhhhcccccccceeeeccccccccchHHHHHHHhhceeEeecccCCcccccccccccCccCccEEEEec
Q 036269          249 E-EVPLSDFIEVFSRKFKKRCSRAMGLSQDMRISALPSWIKNLLLRSEILALGDVNDLENIVSDLAHDGFNELMFLAIVG  327 (623)
Q Consensus       249 ~-~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~  327 (623)
                      . ..+...+       ...+.++.+.+..+...+.+|.++....++|+.|++++|.....+++.+....+++|++|++++
T Consensus       331 ~~~ip~~~l-------~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~  403 (768)
T 3rgz_A          331 SGELPMDTL-------LKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQN  403 (768)
T ss_dssp             EEECCHHHH-------TTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCS
T ss_pred             cCcCCHHHH-------hcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCC
Confidence            3 1211111       1456778888887766667777777764488888888876544444444323367899999988


Q ss_pred             ccCceeecccccccccccccccceeecccCcccccccccccC--CCcCCCccEEEEeecCCcccccchhHHHhccccceE
Q 036269          328 CNEMKYLLNSLERTLRVTLLKLEWLMIVDNRNFVEICHGQLP--AGCLSNVKRLDVRDCGSVLKILPSHLVQSFQNLQRL  405 (623)
Q Consensus       328 ~~~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~--~~~~~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L  405 (623)
                      | .+......    ....+++|+.|+++++. +.    +.+|  .+.+++|+.|++++| .+++..|.. +..+++|++|
T Consensus       404 n-~l~~~~p~----~l~~l~~L~~L~Ls~N~-l~----~~~p~~l~~l~~L~~L~L~~n-~l~~~~p~~-~~~l~~L~~L  471 (768)
T 3rgz_A          404 N-GFTGKIPP----TLSNCSELVSLHLSFNY-LS----GTIPSSLGSLSKLRDLKLWLN-MLEGEIPQE-LMYVKTLETL  471 (768)
T ss_dssp             S-EEEEECCG----GGGGCTTCCEEECCSSE-EE----SCCCGGGGGCTTCCEEECCSS-CCCSCCCGG-GGGCTTCCEE
T ss_pred             C-ccccccCH----HHhcCCCCCEEECcCCc-cc----CcccHHHhcCCCCCEEECCCC-cccCcCCHH-HcCCCCceEE
Confidence            8 44422221    45668889999999886 32    2222  246788999999885 455556665 6788899999


Q ss_pred             EEeccccceeeeeccceeccccccccccCccEEecCCccchhhcccCCCcccccCCccEEEEEcCCCcceeccCcccCcc
Q 036269          406 RVEGCELLVSVFEIERVNIAKEETELFSSLEKLTLIGLPRMTDIWKGDTQFVSLHDLKKIRVVFCDELRQVFPANLGKKA  485 (623)
Q Consensus       406 ~l~~c~~l~~i~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~i~~~~~~~~~l~~L~~L~l~~C~~l~~~~~~~l~~~~  485 (623)
                      ++++ +.++...        |..+..+++|++|++++|.-...+   +..++.+++|++|++++| +++...|..++.++
T Consensus       472 ~L~~-N~l~~~~--------p~~l~~l~~L~~L~L~~N~l~~~~---p~~~~~l~~L~~L~L~~N-~l~~~~p~~l~~l~  538 (768)
T 3rgz_A          472 ILDF-NDLTGEI--------PSGLSNCTNLNWISLSNNRLTGEI---PKWIGRLENLAILKLSNN-SFSGNIPAELGDCR  538 (768)
T ss_dssp             ECCS-SCCCSCC--------CGGGGGCTTCCEEECCSSCCCSCC---CGGGGGCTTCCEEECCSS-CCEEECCGGGGGCT
T ss_pred             EecC-CcccCcC--------CHHHhcCCCCCEEEccCCccCCcC---ChHHhcCCCCCEEECCCC-cccCcCCHHHcCCC
Confidence            9988 5555332        666778888999999888533344   455667888899999885 56656688888888


Q ss_pred             cchhhhhhccccc-ccc--------------------------------------------------------------e
Q 036269          486 AAEEMVLYRNRRD-QIH--------------------------------------------------------------I  502 (623)
Q Consensus       486 ~L~~l~~~~~~~~-~l~--------------------------------------------------------------~  502 (623)
                      +|+.|++.+|... .+.                                                              .
T Consensus       539 ~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~  618 (768)
T 3rgz_A          539 SLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSR  618 (768)
T ss_dssp             TCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSC
T ss_pred             CCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccc
Confidence            8888888876431 000                                                              1


Q ss_pred             eccccCCCCCCCCCCccEEEEecCCCcceecchhhhhccCCCCEEEEccCCchh-hhhcCCCCcccCcCCCcceeecCcc
Q 036269          503 HATTSTSSPTPSLGNLVSITIRGCGKLRNLFTTSMVKSLVRLESLEVSRCPTLQ-EIIMNDEGEVGLQGASTEKITFPSL  581 (623)
Q Consensus       503 ~~~~~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~l~~L~~L~i~~c~~l~-~l~~~~~~~~~~~~~~~~~~~l~~L  581 (623)
                      .+.+..|..+..+++|+.|++++|.--..+|.  .+.++++|+.|++++|. ++ .+|.             ....+++|
T Consensus       619 ~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~--~l~~l~~L~~L~Ls~N~-l~g~ip~-------------~l~~L~~L  682 (768)
T 3rgz_A          619 VYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPK--EIGSMPYLFILNLGHND-ISGSIPD-------------EVGDLRGL  682 (768)
T ss_dssp             EEEEECCCSCSSSBCCCEEECCSSCCBSCCCG--GGGGCTTCCEEECCSSC-CCSCCCG-------------GGGGCTTC
T ss_pred             eecccCchhhhccccccEEECcCCcccccCCH--HHhccccCCEEeCcCCc-cCCCCCh-------------HHhCCCCC
Confidence            22233455667788899999998543334433  37888999999999887 44 4443             45567777


Q ss_pred             cceecccCcccceecCCCCcceeecCCccEEEeccC
Q 036269          582 FSIQLCLLDSLTCFCSSGSHATVEFLALEALQIIDC  617 (623)
Q Consensus       582 ~~L~l~~c~~l~~~~~~~~~~~~~~~~L~~L~i~~c  617 (623)
                      +.|+++++.--..++. ..   ..+++|++|+++++
T Consensus       683 ~~LdLs~N~l~g~ip~-~l---~~l~~L~~L~ls~N  714 (768)
T 3rgz_A          683 NILDLSSNKLDGRIPQ-AM---SALTMLTEIDLSNN  714 (768)
T ss_dssp             CEEECCSSCCEECCCG-GG---GGCCCCSEEECCSS
T ss_pred             CEEECCCCcccCcCCh-HH---hCCCCCCEEECcCC
Confidence            7777777654444444 22   23577777777776



>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 623
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 63.9 bits (154), Expect = 2e-11
 Identities = 37/188 (19%), Positives = 73/188 (38%), Gaps = 25/188 (13%)

Query: 18  FLIKAGVELKDWPSINTFEDLTGISLMFNDIHEVHEGLQCPRLQALFLQKNDLLDIPDPF 77
            LI    ++ D   +    +L  +SL  N + ++        L  L L  N + ++    
Sbjct: 201 SLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAP-- 258

Query: 78  FQGMKDLKVLDLGGSGVFSLFSLPSSLSF------------------LINLRTLSLHDCQ 119
             G+  L  L LG + + ++  L    +                   L NL  L+L+   
Sbjct: 259 LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNN 318

Query: 120 HFGDLSLIGELSLLEILDLSESDVSEIPVSFGRLGHLRLLDLTDCYNLELIPRGVLSRLR 179
              D+S +  L+ L+ L  + + VS++  S   L ++  L        +L P   L+ L 
Sbjct: 319 -ISDISPVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP---LANLT 373

Query: 180 KLEELYMS 187
           ++ +L ++
Sbjct: 374 RITQLGLN 381


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query623
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.76
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.72
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.71
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.7
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.24
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.95
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.88
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.85
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.62
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.81
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.75
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.96
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.31
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.19
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.88  E-value=3.7e-21  Score=193.69  Aligned_cols=85  Identities=15%  Similarity=0.289  Sum_probs=46.7

Q ss_pred             CCCCcceEEccCCCCCCCChhhHhCCCcccEEEccCCcccccCCCchhhhccccCcEEeccCCcCCCCcccccCCcCCcE
Q 036269           56 QCPRLQALFLQKNDLLDIPDPFFQGMKDLKVLDLGGSGVFSLFSLPSSLSFLINLRTLSLHDCQHFGDLSLIGELSLLEI  135 (623)
Q Consensus        56 ~~~~L~~L~l~~~~~~~l~~~~~~~l~~Lr~L~l~~~~~~~~~~lp~~~~~l~~L~~L~l~~~~~l~~i~~~~~l~~L~~  135 (623)
                      .+.+|++|+++++.+.++..  +.++++|++|++++|.+   +.+|. +.++++|++|++++|. +.++..++++++|+.
T Consensus        42 ~l~~l~~L~l~~~~I~~l~g--l~~L~nL~~L~Ls~N~l---~~l~~-l~~L~~L~~L~L~~n~-i~~i~~l~~l~~L~~  114 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSIDG--VEYLNNLTQINFSNNQL---TDITP-LKNLTKLVDILMNNNQ-IADITPLANLTNLTG  114 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCTT--GGGCTTCCEEECCSSCC---CCCGG-GTTCTTCCEEECCSSC-CCCCGGGTTCTTCCE
T ss_pred             HhCCCCEEECCCCCCCCccc--cccCCCCCEEeCcCCcC---CCCcc-ccCCcccccccccccc-ccccccccccccccc
Confidence            34455566666655555432  35566666666666655   34442 5555666666666655 555544555556666


Q ss_pred             EEcCCCCCcccc
Q 036269          136 LDLSESDVSEIP  147 (623)
Q Consensus       136 L~l~~~~i~~lp  147 (623)
                      |+++++.++.++
T Consensus       115 L~~~~~~~~~~~  126 (384)
T d2omza2         115 LTLFNNQITDID  126 (384)
T ss_dssp             EECCSSCCCCCG
T ss_pred             cccccccccccc
Confidence            665555555443



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure