Citrus Sinensis ID: 036300


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MERKEKEALYSTIQGFVGKWWNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGPVYDNSLVCSQCKIFKPPLQSPIEIPSSNWQKLANSLDSLEFGSNPRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRLALAGNQINGQIPASIGGLTKLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYNNLQEKIPKEIGNLHNVTFLDLRSNNFLGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEIWIF
ccHHHHHHHHHHHHHcccccccccccccccccccccccEEccccccccEEEcccccccccccccccccccccccccccccccccHHHHHcccccEEEcccccccEEcccccccccccccEEEccccccEEccccccccccccccEEcccccccccccccccccccccEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccccEEcc
ccHHHHHHHHHHHHHHcccccccccccccccccccccEEEEccccccccccccHHcccccccEEEcccccccccccccccccccHHHcccccccEEEEcccccccEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHccccccccEEEEcc
MERKEKEALYSTIQGFVgkwwngsdlypdpfgrtglqgvscdffHGLWHvsaisigpvydnslvcsqckifkpplqspieipssnWQKLANSldslefgsnprligtipTSIDYLKNLQSLVLLEkgltgklpiepsklVNLRRLALAGnqingqipasiGGLTKLLIFDLSrnnlsgsmLLTLGKLARLLKLDLSYNNLqekipkeignlhnvtfldlrsnnflgGLVGSIEEMVSLKEMvvsnnpifggglngirwenlqNLEIWIF
merkekeaLYSTIQGFVGKWWNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGPVYDNSLVCSQCKIFKPPLQSPIEIPSSNWQKLANSLDSLEFGSNPRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRLALAGNQINGQIPASIGGLTKLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYNNLQEKIPKEIGNLHNVTFLDLRSNNFLGGLVGSIEEMVSLKEMVVSNNPifggglngirwenlqNLEIWIF
MERKEKEALYSTIQGFVGKWWNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGPVYDNSLVCSQCKIFKPPLQSPIEIPSSNWQKLANSLDSLEFGSNPRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRLALAGNQINGQIPASIGGLTKLLIFDLSRNNLSGSMlltlgklarllkldlSYNNLQEKIPKEIGNLHNVTFLDLRSNNFLGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEIWIF
********LYSTIQGFVGKWWNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGPVYDNSLVCSQCKIFKPPLQSPIEIPSSNWQKLANSLDSLEFGSNPRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRLALAGNQINGQIPASIGGLTKLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYNNLQEKIPKEIGNLHNVTFLDLRSNNFLGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEIWI*
**RKEKEALYSTIQGFVGKWWNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGPVYDNSLVCSQCKIFKPPLQSPIEIPSSNWQKLANSLDSLEFGSNPRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRLALAGNQINGQIPASIGGLTKLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYNNLQEKIPKEIGNLHNVTFLDLRSNNFLGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEIWIF
*********YSTIQGFVGKWWNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGPVYDNSLVCSQCKIFKPPLQSPIEIPSSNWQKLANSLDSLEFGSNPRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRLALAGNQINGQIPASIGGLTKLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYNNLQEKIPKEIGNLHNVTFLDLRSNNFLGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEIWIF
*ERKEKEALYSTIQGFVGKWWNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGPVYDNSLVCSQCKIFKPPLQSPIEIPSSNWQKLANSLDSLEFGSNPRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRLALAGNQINGQIPASIGGLTKLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYNNLQEKIPKEIGNLHNVTFLDLRSNNFLGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEIWIF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERKEKEALYSTIQGFVGKWWNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGPVYDNSLVCSQCKIFKPPLQSPIEIPSSNWQKLANSLDSLEFGSNPRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRLALAGNQINGQIPASIGGLTKLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYNNLQEKIPKEIGNLHNVTFLDLRSNNFLGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEIWIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query269 2.2.26 [Sep-21-2011]
Q5PP26 424 Piriformospora indica-ins no no 0.988 0.627 0.475 2e-63
Q42371 976 LRR receptor-like serine/ no no 0.631 0.174 0.360 2e-19
Q9C9H7 847 Receptor-like protein 12 no no 0.617 0.195 0.369 1e-18
Q9LHP4 1141 Receptor-like protein kin no no 0.602 0.141 0.347 2e-18
Q9LP24 1120 Probable leucine-rich rep no no 0.602 0.144 0.376 4e-18
C0LGV1 1135 LRR receptor-like serine/ no no 0.594 0.140 0.347 5e-18
Q8VZG8 1045 Probable LRR receptor-lik no no 0.539 0.138 0.385 8e-18
C0LGF5 1072 Probable LRR receptor-lik no no 0.609 0.152 0.363 1e-17
C0LGQ5 1249 LRR receptor-like serine/ no no 0.539 0.116 0.371 3e-17
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.583 0.125 0.389 3e-17
>sp|Q5PP26|PII2_ARATH Piriformospora indica-insensitive protein 2 OS=Arabidopsis thaliana GN=PII-2 PE=2 SV=1 Back     alignment and function desciption
 Score =  242 bits (618), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 134/282 (47%), Positives = 178/282 (63%), Gaps = 16/282 (5%)

Query: 1   MERKEKEALYSTIQGFVGKWWNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGPVYD 60
           M+++E+EALYS IQGFVG  WNGS LYPDP G T +QGVSCD ++ LW+V+ +S+G +Y+
Sbjct: 36  MDKREREALYSAIQGFVGDSWNGSALYPDPCGWTPIQGVSCDIYNDLWYVTDLSLGLIYE 95

Query: 61  NSLVCSQCKIFKPPL---------------QSPIEIPSSN-WQKLANSLDSLEFGSNPRL 104
           NSL CS     +P L                SP+ I     W   A++L+SLEF SNP L
Sbjct: 96  NSLPCSSSLQIRPELFELKHLRSLSFFNCFISPMVIAKEELWTNFASNLESLEFRSNPGL 155

Query: 105 IGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRLALAGNQINGQIPASIGGLT 164
           IG +P +I  L  L+SLV+LE G +G+LP     L  L+RL  AGN   G IP    GL 
Sbjct: 156 IGELPETIGNLTKLKSLVVLENGFSGELPASICNLKRLKRLVFAGNSFAGMIPNCFKGLK 215

Query: 165 KLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYNNLQEKIPKEIGNLHNVTFLDLRSNNF 224
           +LLI DLSRN+ SG++  + G L  LLKLDLS N L+  +P+E+G L N+T LDLR+N F
Sbjct: 216 ELLILDLSRNSFSGTLPTSFGDLVSLLKLDLSNNLLEGNLPQELGFLKNLTLLDLRNNRF 275

Query: 225 LGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEI 266
            GGL  +IE + SL E+V+SNNP+    + G  W  + NL +
Sbjct: 276 SGGLSKNIENIQSLTELVLSNNPMGEEDMVGTNWGKMSNLVV 317




Required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica.
Arabidopsis thaliana (taxid: 3702)
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
255566807 443 serine-threonine protein kinase, plant-t 0.985 0.598 0.554 8e-77
224101663 406 predicted protein [Populus trichocarpa] 0.985 0.652 0.557 2e-75
357443135 499 Piriformospora indica-insensitive protei 0.985 0.531 0.562 3e-75
356496010 432 PREDICTED: piriformospora indica-insensi 0.985 0.613 0.554 4e-74
359473008 446 PREDICTED: piriformospora indica-insensi 0.985 0.594 0.550 4e-73
147815740 584 hypothetical protein VITISV_038921 [Viti 0.985 0.453 0.550 5e-73
356535577 443 PREDICTED: piriformospora indica-insensi 0.985 0.598 0.550 3e-71
356576273 443 PREDICTED: piriformospora indica-insensi 0.985 0.598 0.550 3e-71
356499743 433 PREDICTED: piriformospora indica-insensi 0.985 0.612 0.527 4e-70
356565242 474 PREDICTED: piriformospora indica-insensi 0.981 0.556 0.536 1e-69
>gi|255566807|ref|XP_002524387.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223536348|gb|EEF37998.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  292 bits (748), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 158/285 (55%), Positives = 192/285 (67%), Gaps = 20/285 (7%)

Query: 1   MERKEKEALYSTIQGFVGKWWNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGPVYD 60
           ME  E+ ALYS IQGFVG WWNGSDLYPDP G T +QGVSCD F GLW+V+ +SIGP++D
Sbjct: 1   MEDGERAALYSAIQGFVGNWWNGSDLYPDPCGWTPIQGVSCDIFDGLWYVTDLSIGPIHD 60

Query: 61  NSLVCSQCKIFKP-------------------PLQSPIEIPSSNWQKLANSLDSLEFGSN 101
           NS  CS    F+P                   P + PI IP+ NW+KLA +L+ LEF SN
Sbjct: 61  NSFDCSLNAEFRPHLFQLTHIKSLSFFNCFLSPFKHPITIPTKNWEKLAANLEKLEFRSN 120

Query: 102 PRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRLALAGNQINGQIPASIG 161
           P LIG +PT+   L  LQSLVLLE GLTG+LP     L NL+RL LAGN  +G+IP S G
Sbjct: 121 PGLIGRVPTTFGGLIKLQSLVLLENGLTGELPSNFGALANLKRLVLAGNWFSGRIPDSFG 180

Query: 162 GLTKLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYNNLQEKIPKEIGNLHNVTFLDLRS 221
            L++LLI DLSRN LSG +  T G ++ LLKLD S N L+  +P EIG L N+T LDLR+
Sbjct: 181 RLSQLLILDLSRNLLSGPLPSTFGGMSSLLKLDCSNNQLEGNLPVEIGYLKNLTLLDLRN 240

Query: 222 NNFLGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEI 266
           N F GGL  S++EM SL+EM +SNNPI  G L+ I W+ LQNL I
Sbjct: 241 NKFSGGLTKSLQEMFSLEEMALSNNPIH-GDLHAIEWQKLQNLVI 284




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224101663|ref|XP_002312373.1| predicted protein [Populus trichocarpa] gi|222852193|gb|EEE89740.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357443135|ref|XP_003591845.1| Piriformospora indica-insensitive protein [Medicago truncatula] gi|355480893|gb|AES62096.1| Piriformospora indica-insensitive protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356496010|ref|XP_003516863.1| PREDICTED: piriformospora indica-insensitive protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|359473008|ref|XP_002278514.2| PREDICTED: piriformospora indica-insensitive protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147815740|emb|CAN74874.1| hypothetical protein VITISV_038921 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356535577|ref|XP_003536321.1| PREDICTED: piriformospora indica-insensitive protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356576273|ref|XP_003556257.1| PREDICTED: piriformospora indica-insensitive protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356499743|ref|XP_003518696.1| PREDICTED: piriformospora indica-insensitive protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356565242|ref|XP_003550851.1| PREDICTED: piriformospora indica-insensitive protein 2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
TAIR|locus:2102330 475 AT3G25670 [Arabidopsis thalian 0.988 0.56 0.469 2.4e-60
TAIR|locus:2031880 424 AT1G13230 [Arabidopsis thalian 0.988 0.627 0.446 2.5e-56
TAIR|locus:2012433 432 AT1G68780 [Arabidopsis thalian 0.747 0.465 0.463 6.1e-39
TAIR|locus:2052367 462 RLP29 "receptor like protein 2 0.918 0.534 0.304 3.1e-19
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.628 0.150 0.353 5.1e-19
TAIR|locus:2005507 976 ER "ERECTA" [Arabidopsis thali 0.631 0.174 0.337 2.3e-18
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.617 0.195 0.352 2.4e-18
TAIR|locus:2154344 1135 AT5G48940 [Arabidopsis thalian 0.646 0.153 0.318 4.7e-18
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.591 0.139 0.329 4.8e-18
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.795 0.170 0.318 8.8e-18
TAIR|locus:2102330 AT3G25670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 618 (222.6 bits), Expect = 2.4e-60, P = 2.4e-60
 Identities = 132/281 (46%), Positives = 172/281 (61%)

Query:     1 MERKEKEALYSTIQGFVGKWWNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGPVYD 60
             ME+ E+EALYS IQGFVG  WNGSDLYPDP G T +QGVSCD +  LW+V+ +++G V++
Sbjct:    33 MEKTEQEALYSAIQGFVGDSWNGSDLYPDPCGWTPIQGVSCDLYGDLWYVTDLTLGLVHE 92

Query:    61 NSLVCSQCKIFKPPL---------------QSPIEIPSSNWQKLANSLDSLEFGSNPRLI 105
             NSL C+     KP L                SPI IP  +W  LA++L+SLEF SNP LI
Sbjct:    93 NSLSCATSLEIKPQLFKLKHLKSLTFFNCFTSPIRIPKEDWINLASNLESLEFRSNPGLI 152

Query:   106 GTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRLALAGNQINGQIPASIGGLTK 165
             G +P +I  L  L+SLV+LE G  GKLP     L  L+RL LAGN   G IP    G   
Sbjct:   153 GELPETIGSLTKLKSLVVLENGFNGKLPTRICNLTRLKRLVLAGNLFTGTIPDCFNGFKD 212

Query:   166 LLIFDLSRNNLSGSMXXXXXXXXXXXXXXXSYNNLQEKIPKEIGNLHNVTFLDLRSNNFL 225
             LLI D+SRN+ SG +               S N L+ ++P+EIG L N+T LDLR+N   
Sbjct:   213 LLILDMSRNSFSGILPLSVGEMVSLLKLDLSNNQLEGRLPQEIGFLKNLTLLDLRNNRIS 272

Query:   226 GGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEI 266
             GGL  +IE++ SL ++V+S NP+    + GI+WEN+ NL I
Sbjct:   273 GGLFENIEKIPSLTDLVLSGNPMGSDDMMGIKWENMGNLVI 313




GO:0005886 "plasma membrane" evidence=ISM
GO:0007165 "signal transduction" evidence=IC;RCA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2031880 AT1G13230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012433 AT1G68780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052367 RLP29 "receptor like protein 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005507 ER "ERECTA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.VIII.2940.1
hypothetical protein (406 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pg.C_scaffold_1082000001
hypothetical protein (367 aa)
       0.501
gw1.VI.2319.1
hypothetical protein (308 aa)
       0.468
grail3.0053020202
SubName- Full=Putative uncharacterized protein; (371 aa)
       0.460
gw1.XVIII.384.1
hypothetical protein (300 aa)
       0.458
eugene3.162250001
hypothetical protein (262 aa)
       0.458
fgenesh4_pg.C_scaffold_243000006
hypothetical protein (350 aa)
       0.448
fgenesh4_pg.C_scaffold_20023000001
hypothetical protein (307 aa)
       0.433
fgenesh4_pg.C_scaffold_1268000001
hypothetical protein (327 aa)
       0.420
eugene3.90370001
hypothetical protein (187 aa)
       0.419
fgenesh4_pg.C_scaffold_9298000001
hypothetical protein (238 aa)
       0.403

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-21
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-21
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-20
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-17
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 93.8 bits (233), Expect = 1e-21
 Identities = 65/167 (38%), Positives = 85/167 (50%), Gaps = 2/167 (1%)

Query: 100 SNPRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRLALAGNQINGQIPAS 159
           SN  L G IP  I    +L+ L L    L GK+P   + L +L  L LA NQ+ GQIP  
Sbjct: 148 SNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE 207

Query: 160 IGGLTKLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYNNLQEKIPKEIGNLHNVTFLDL 219
           +G +  L    L  NNLSG +   +G L  L  LDL YNNL   IP  +GNL N+ +L L
Sbjct: 208 LGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFL 267

Query: 220 RSNNFLGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEI 266
             N   G +  SI  +  L  + +S+N + G     +    LQNLEI
Sbjct: 268 YQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELV--IQLQNLEI 312


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 269
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.83
KOG0617264 consensus Ras suppressor protein (contains leucine 99.82
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.79
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.75
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.73
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.73
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.72
PLN03150623 hypothetical protein; Provisional 99.71
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.7
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.65
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.63
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.63
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.58
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.56
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.55
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.54
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.53
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.53
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.51
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.48
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.44
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.41
PLN03150623 hypothetical protein; Provisional 99.36
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.35
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.32
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.31
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.25
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.21
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.98
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.94
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.77
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.7
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.7
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.69
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.63
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.62
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.58
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.57
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.55
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.52
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.42
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.4
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.36
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.15
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.14
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.13
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.06
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.03
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.99
PRK15386 426 type III secretion protein GogB; Provisional 97.97
PRK15386 426 type III secretion protein GogB; Provisional 97.95
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.92
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.91
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.84
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.79
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.78
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.77
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.57
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.2
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.87
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.89
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.78
KOG1947 482 consensus Leucine rich repeat proteins, some prote 95.14
KOG0473 326 consensus Leucine-rich repeat protein [Function un 95.02
KOG4308 478 consensus LRR-containing protein [Function unknown 94.88
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.84
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.59
KOG4341483 consensus F-box protein containing LRR [General fu 93.4
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.77
KOG4341483 consensus F-box protein containing LRR [General fu 91.81
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.78
smart0037026 LRR Leucine-rich repeats, outliers. 91.78
smart0037026 LRR Leucine-rich repeats, outliers. 90.97
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.97
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.76
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.56
KOG4308 478 consensus LRR-containing protein [Function unknown 89.84
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.4e-32  Score=264.42  Aligned_cols=254  Identities=31%  Similarity=0.431  Sum_probs=144.1

Q ss_pred             CHHHHHHHHHHHhcccC-----CCCCCCCCCCCCCCCCCCCceEeecCCCceEEEEEEeCC------CCCCCcccccccc
Q 036300            2 ERKEKEALYSTIQGFVG-----KWWNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGP------VYDNSLVCSQCKI   70 (269)
Q Consensus         2 ~~~~~~~l~~~~~~~~~-----~~W~~~~~~~~~C~~~~~~gv~C~~~~~~~~v~~l~l~~------~~~~~~~~~~l~~   70 (269)
                      .++|++||++|++++.+     .+|+..   .++|.|.   ||+|+..+   +|+.|++..      +++.....+.+..
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~---~~~c~w~---gv~c~~~~---~v~~L~L~~~~i~~~~~~~~~~l~~L~~   97 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSS---ADVCLWQ---GITCNNSS---RVVSIDLSGKNISGKISSAIFRLPYIQT   97 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCC---CCCCcCc---ceecCCCC---cEEEEEecCCCccccCChHHhCCCCCCE
Confidence            46899999999999864     468655   3899998   99998654   899999842      2222223445555


Q ss_pred             cCCCCC-CCcccCchhHHhhcCCccEEEccCCCCceeccC----------------------ccccCCCCCCEEEcccCC
Q 036300           71 FKPPLQ-SPIEIPSSNWQKLANSLDSLEFGSNPRLIGTIP----------------------TSIDYLKNLQSLVLLEKG  127 (269)
Q Consensus        71 ~~~~~~-~~~~lp~~~~~~l~~~L~~L~l~~n~~l~~~~p----------------------~~l~~l~~L~~L~L~~n~  127 (269)
                      +....+ +.|.+|..++..+ ++|++|++++| .+.+.+|                      ..++.+++|++|++++|.
T Consensus        98 L~Ls~n~~~~~ip~~~~~~l-~~L~~L~Ls~n-~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~  175 (968)
T PLN00113         98 INLSNNQLSGPIPDDIFTTS-SSLRYLNLSNN-NFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNV  175 (968)
T ss_pred             EECCCCccCCcCChHHhccC-CCCCEEECcCC-ccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCc
Confidence            554443 3467887776444 66777776666 5555444                      444444444444444444


Q ss_pred             CCCCCCCCCCCCCCCCEEEccCCcCCCCCccccCCCCCCCEEEccCCcCCchhhhhhcCcccCCEEeCcCCcCCCcCchh
Q 036300          128 LTGKLPIEPSKLVNLRRLALAGNQINGQIPASIGGLTKLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYNNLQEKIPKE  207 (269)
Q Consensus       128 l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~ls~n~l~~~~p~~  207 (269)
                      +.+.+|..++++++|++|++++|.+++.+|..+..+++|++|++++|.+++.+|..++.+++|++|++++|++.+.+|..
T Consensus       176 l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~  255 (968)
T PLN00113        176 LVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSS  255 (968)
T ss_pred             ccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChh
Confidence            44444444444444555555444444444444444555555555555554444545555555555555555555445555


Q ss_pred             hcCCCCCCEEEccCCccCCcchhhhhcCCCCCeEEccCCCCCCCCCCccccccCcCCceec
Q 036300          208 IGNLHNVTFLDLRSNNFLGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEIWI  268 (269)
Q Consensus       208 ~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~~p~~~~~~l~~L~~L~  268 (269)
                      ++++++|++|++++|.+++.+|..+..+++|++|++++|.+ .+.+|. .+.++++|+.|+
T Consensus       256 l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l-~~~~p~-~~~~l~~L~~L~  314 (968)
T PLN00113        256 LGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSL-SGEIPE-LVIQLQNLEILH  314 (968)
T ss_pred             HhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCee-ccCCCh-hHcCCCCCcEEE
Confidence            55555555555555555555555555555555555555555 444443 445555555554



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-09
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-05
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-09
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-05
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-06
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 58.2 bits (139), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 55/175 (31%), Positives = 81/175 (46%), Gaps = 8/175 (4%) Query: 80 EIPSSNWQKLANSLDSLEFGSNPRLIGTIPTSIDYLKN-LQSLVLLEKGLTGKLPIEPSK 138 E+P S L+ SL +L+ SN +P KN LQ L L G TGK+P S Sbjct: 355 ELPES-LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN 413 Query: 139 LVNLRRLALAGNQINGQIPASIGGLTKLLIFDLSRNNLSGSMXXXXXXXXXXXXXXXSYN 198 L L L+ N ++G IP+S+G L+KL L N L G + +N Sbjct: 414 CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFN 473 Query: 199 NLQEKIPKEIGNLHNVTFLDLRSNNFLGGL---VGSIEEMVSLKEMVVSNNPIFG 250 +L +IP + N N+ ++ L +N G + +G +E + LK +SNN G Sbjct: 474 DLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILK---LSNNSFSG 525
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-31
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-29
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-27
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-28
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-27
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-26
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-26
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-25
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-25
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-23
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-23
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-18
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-20
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-17
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-17
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-16
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-07
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 8e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-07
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-11
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-08
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-09
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 8e-07
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-06
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 9e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  138 bits (349), Expect = 3e-39
 Identities = 58/233 (24%), Positives = 95/233 (40%), Gaps = 27/233 (11%)

Query: 21  WNGSDLYPDPFGRTGLQGVSCDFFHGLWHVSAISIGPVYDNSLVCSQCKIFKPPLQSPIE 80
           W  +             GV CD     + V+ + +      +            L  P  
Sbjct: 27  WLPTT----DCCNRTWLGVLCDTDTQTYRVNNLDLS---GLN------------LPKPYP 67

Query: 81  IPSSNWQKLAN--SLDSLEFGSNPRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSK 138
           IPSS    LAN   L+ L  G    L+G IP +I  L  L  L +    ++G +P   S+
Sbjct: 68  IPSS----LANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQ 123

Query: 139 LVNLRRLALAGNQINGQIPASIGGLTKLLIFDLSRNNLSGSMLLTLGKLARLLK-LDLSY 197
           +  L  L  + N ++G +P SI  L  L+      N +SG++  + G  ++L   + +S 
Sbjct: 124 IKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISR 183

Query: 198 NNLQEKIPKEIGNLHNVTFLDLRSNNFLGGLVGSIEEMVSLKEMVVSNNPIFG 250
           N L  KIP    NL N+ F+DL  N   G          + +++ ++ N +  
Sbjct: 184 NRLTGKIPPTFANL-NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAF 235


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.9
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.89
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.89
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.89
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.89
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.88
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.87
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.87
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.87
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.86
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.86
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.84
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.81
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.81
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.8
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.8
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.79
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.79
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.78
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.78
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.78
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.78
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.78
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.77
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.76
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.75
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.75
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.74
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.74
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.73
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.72
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.71
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.7
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.66
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.6
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.58
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.58
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.52
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.48
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.44
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.43
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.42
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.42
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.39
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.38
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.37
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.94
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.88
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.79
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.76
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.71
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.55
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.46
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.43
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.4
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.39
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.37
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.33
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.27
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.81
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.29
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.23
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.96
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=3.9e-37  Score=264.44  Aligned_cols=255  Identities=25%  Similarity=0.308  Sum_probs=191.5

Q ss_pred             CHHHHHHHHHHHhcccC----CCCCCCCCCCCCCC--CCCCCceEeecCCCceEEEEEEeC--------CCCCCCccccc
Q 036300            2 ERKEKEALYSTIQGFVG----KWWNGSDLYPDPFG--RTGLQGVSCDFFHGLWHVSAISIG--------PVYDNSLVCSQ   67 (269)
Q Consensus         2 ~~~~~~~l~~~~~~~~~----~~W~~~~~~~~~C~--~~~~~gv~C~~~~~~~~v~~l~l~--------~~~~~~~~~~~   67 (269)
                      .++|++||++||+++.+    ++|..+   .+||.  |.   ||.|+......+|+.+++.        .+++....+..
T Consensus         4 ~~~~~~aL~~~k~~~~~~~~l~~W~~~---~~~C~~~w~---gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~   77 (313)
T 1ogq_A            4 NPQDKQALLQIKKDLGNPTTLSSWLPT---TDCCNRTWL---GVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPY   77 (313)
T ss_dssp             CHHHHHHHHHHHHHTTCCGGGTTCCTT---SCTTTTCST---TEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred             CHHHHHHHHHHHHhcCCcccccCCCCC---CCCCcCCCc---ceEeCCCCCCceEEEEECCCCCccCCcccChhHhCCCC
Confidence            47899999999999976    579765   38998  87   9999865411289999983        23333344455


Q ss_pred             ccccCCC--CCCCcccCchhHHhhcCCccEEEccCCCCceeccCccccCCCCCCEEEcccCCCCCCCCCCCCCCCCCCEE
Q 036300           68 CKIFKPP--LQSPIEIPSSNWQKLANSLDSLEFGSNPRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRL  145 (269)
Q Consensus        68 l~~~~~~--~~~~~~lp~~~~~~l~~~L~~L~l~~n~~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L  145 (269)
                      +..+...  .+..+.+|..+ .. +++|++|++++| .+.+.+|..+..+++|++|++++|.+++.+|..+..+++|++|
T Consensus        78 L~~L~L~~~n~l~~~~p~~l-~~-l~~L~~L~Ls~n-~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L  154 (313)
T 1ogq_A           78 LNFLYIGGINNLVGPIPPAI-AK-LTQLHYLYITHT-NVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGI  154 (313)
T ss_dssp             CSEEEEEEETTEESCCCGGG-GG-CTTCSEEEEEEE-CCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEE
T ss_pred             CCeeeCCCCCcccccCChhH-hc-CCCCCEEECcCC-eeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeE
Confidence            5555554  34556777765 44 488999999988 7888888888889999999999999888888888888999999


Q ss_pred             EccCCcCCCCCccccCCCC-CCCEEEccCCcCCchhhhhhcCcccCCEEeCcCCcCCCcCchhhcCCCCCCEEEccCCcc
Q 036300          146 ALAGNQINGQIPASIGGLT-KLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYNNLQEKIPKEIGNLHNVTFLDLRSNNF  224 (269)
Q Consensus       146 ~L~~n~l~~~~p~~l~~l~-~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~ls~n~l~~~~p~~~~~l~~L~~L~L~~N~l  224 (269)
                      ++++|.+++.+|..+..++ +|++|++++|.+++.+|..+..+. |+.|++++|++++..|..+..+++|++|++++|.+
T Consensus       155 ~L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l  233 (313)
T 1ogq_A          155 TFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSL  233 (313)
T ss_dssp             ECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEE
T ss_pred             ECcCCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCce
Confidence            9999988888888888887 888888888888877777777766 77777777777776777777777777777777777


Q ss_pred             CCcchhhhhcCCCCCeEEccCCCCCCCCCCccccccCcCCceecC
Q 036300          225 LGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEIWIF  269 (269)
Q Consensus       225 ~~~~~~~~~~l~~L~~L~l~~N~l~~~~~p~~~~~~l~~L~~L~l  269 (269)
                      ++.+|. +..+++|++|++++|.+ .+.+|. .+..+++|++|++
T Consensus       234 ~~~~~~-~~~l~~L~~L~Ls~N~l-~~~~p~-~l~~l~~L~~L~L  275 (313)
T 1ogq_A          234 AFDLGK-VGLSKNLNGLDLRNNRI-YGTLPQ-GLTQLKFLHSLNV  275 (313)
T ss_dssp             CCBGGG-CCCCTTCCEEECCSSCC-EECCCG-GGGGCTTCCEEEC
T ss_pred             eeecCc-ccccCCCCEEECcCCcc-cCcCCh-HHhcCcCCCEEEC
Confidence            655544 56667777777777777 555654 5666777776654



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 269
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-09
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-07
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-07
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.003
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 58.1 bits (139), Expect = 2e-10
 Identities = 24/84 (28%), Positives = 36/84 (42%), Gaps = 6/84 (7%)

Query: 139 LVNLRRLALAGNQINGQIPASIGGLTKLLIFDLSRNNLSGSMLLTLGKLARLLKLDLSYN 198
           L NL  L L  N I+   P  +  LTKL     + N +S   + +L  L  +  L   +N
Sbjct: 306 LKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHN 361

Query: 199 NLQEKIPKEIGNLHNVTFLDLRSN 222
            + +  P  + NL  +T L L   
Sbjct: 362 QISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.82
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.81
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.8
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.8
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.69
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.66
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.47
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.46
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.44
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.39
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.25
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.23
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.99
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.89
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.79
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.68
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.07
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.83
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.59
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1e-36  Score=259.51  Aligned_cols=255  Identities=26%  Similarity=0.355  Sum_probs=178.1

Q ss_pred             CHHHHHHHHHHHhcccC----CCCCCCCCCCCCCC--CCCCCceEeecCCCceEEEEEEeCC--------CCCCCccccc
Q 036300            2 ERKEKEALYSTIQGFVG----KWWNGSDLYPDPFG--RTGLQGVSCDFFHGLWHVSAISIGP--------VYDNSLVCSQ   67 (269)
Q Consensus         2 ~~~~~~~l~~~~~~~~~----~~W~~~~~~~~~C~--~~~~~gv~C~~~~~~~~v~~l~l~~--------~~~~~~~~~~   67 (269)
                      .++|++||++||+++.+    ++|..++   |||.  |.   ||+|+..++..||++|++..        +|+....+..
T Consensus         4 ~~~e~~aLl~~k~~~~~~~~l~sW~~~~---d~C~~~w~---gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~   77 (313)
T d1ogqa_           4 NPQDKQALLQIKKDLGNPTTLSSWLPTT---DCCNRTWL---GVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPY   77 (313)
T ss_dssp             CHHHHHHHHHHHHHTTCCGGGTTCCTTS---CTTTTCST---TEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred             CHHHHHHHHHHHHHCCCCCcCCCCCCCC---CCCCCcCC---CeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCcc
Confidence            47899999999999976    6797653   9994  87   99999877777999999942        2233333444


Q ss_pred             ccccCCC--CCCCcccCchhHHhhcCCccEEEccCCCCceeccCccccCCCCCCEEEcccCCCCCCCCCCCCCCCCCCEE
Q 036300           68 CKIFKPP--LQSPIEIPSSNWQKLANSLDSLEFGSNPRLIGTIPTSIDYLKNLQSLVLLEKGLTGKLPIEPSKLVNLRRL  145 (269)
Q Consensus        68 l~~~~~~--~~~~~~lp~~~~~~l~~~L~~L~l~~n~~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L  145 (269)
                      +..+...  .++.|+||+.+. + +++|++|++++| .+.+..+..+..+++|+++++++|.+.+.+|..+.++++++++
T Consensus        78 L~~L~Ls~~N~l~g~iP~~i~-~-L~~L~~L~Ls~N-~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l  154 (313)
T d1ogqa_          78 LNFLYIGGINNLVGPIPPAIA-K-LTQLHYLYITHT-NVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGI  154 (313)
T ss_dssp             CSEEEEEEETTEESCCCGGGG-G-CTTCSEEEEEEE-CCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEE
T ss_pred             ccccccccccccccccccccc-c-ccccchhhhccc-cccccccccccchhhhcccccccccccccCchhhccCccccee
Confidence            4444332  234556666542 2 366666666666 5666666666666666666666666666666667777777777


Q ss_pred             EccCCcCCCCCccccCCCCCC-CEEEccCCcCCchh-----------------------hhhhcCcccCCEEeCcCCcCC
Q 036300          146 ALAGNQINGQIPASIGGLTKL-LIFDLSRNNLSGSM-----------------------LLTLGKLARLLKLDLSYNNLQ  201 (269)
Q Consensus       146 ~L~~n~l~~~~p~~l~~l~~L-~~L~l~~n~l~~~~-----------------------~~~~~~l~~L~~L~ls~n~l~  201 (269)
                      ++++|.+++.+|..+..+..+ +.+++++|++++..                       |..+..+++++.+++++|.+.
T Consensus       155 ~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~  234 (313)
T d1ogqa_         155 TFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLA  234 (313)
T ss_dssp             ECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEEC
T ss_pred             eccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            777777766667666665554 55666666554332                       333345566777777777777


Q ss_pred             CcCchhhcCCCCCCEEEccCCccCCcchhhhhcCCCCCeEEccCCCCCCCCCCccccccCcCCceecC
Q 036300          202 EKIPKEIGNLHNVTFLDLRSNNFLGGLVGSIEEMVSLKEMVVSNNPIFGGGLNGIRWENLQNLEIWIF  269 (269)
Q Consensus       202 ~~~p~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~~p~~~~~~l~~L~~L~l  269 (269)
                      +.+| .+..+++|+.|++++|++++.+|..++++++|++|+|++|++ ++.+|.  +.++++|+.+++
T Consensus       235 ~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l-~g~iP~--~~~L~~L~~l~l  298 (313)
T d1ogqa_         235 FDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNL-CGEIPQ--GGNLQRFDVSAY  298 (313)
T ss_dssp             CBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEE-EEECCC--STTGGGSCGGGT
T ss_pred             cccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcc-cccCCC--cccCCCCCHHHh
Confidence            6544 577888999999999999988999999999999999999999 778884  567788877654



>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure