Citrus Sinensis ID: 036360

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MVIIVAALILGAILGVFIFIPRHPTSGHSKSTHSSANSNKASKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGGDAILAHAGDDSTEGFYGPQHATRVFDMIDDFYIGDLKQ
cEEEHHHHHHHHHccEEEEccccccccccccccccccccccccEEEHHHHHHHcccccEEEEEccEEEEccccccccccHHHHHHHcccccccccccccccHHHHHHHHHcEEEEccc
ccEEHHHHHHHHHHHHHEEccccccccccccccccccccccccEEcHHHHcccEEccEEEEEEccEEEEccccccccccccHHHHHHcccccHcHHcccccHHHHHHHHHcEEccccc
MVIIVAALILGAILGVfifiprhptsghsksthssansnkaskiyskdevtlhnkrddcwIIIKNkvydvtsyveehpggdailahagddstegfygpqhatRVFDMIddfyigdlkq
MVIIVAALILGAILGVFIFIPRHPTSghsksthssansnkaskiyskdevtlhnkrddcwiIIKNKVYDVTSYVEEHPGGDAILAHAGDDSTEGFYGPQHATRVFDMIDDFYIGDLKQ
MviivaalilgailgvfifiPRHPTSGHSKSTHSSANSNKASKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGGDAILAHAGDDSTEGFYGPQHATRVFDMIDDFYIGDLKQ
*VIIVAALILGAILGVFIFIP****************************VTLHNKRDDCWIIIKNKVYDVTSYVEEHPGGDAILAHAGDDSTEGFYGPQHATRVFDMIDDFYIG****
MVIIVAALILGAILGVF******************************DEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGGDAILAHAGDDSTEGFYGPQHATRVFDMIDDFYIGDLKQ
MVIIVAALILGAILGVFIFIPRHP****************ASKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGGDAILAHAGDDSTEGFYGPQHATRVFDMIDDFYIGDLKQ
MVIIVAALILGAILGVFIFIPRH******************SKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGGDAILAHAGDDSTEGFYGPQHATRVFDMIDDFYIGDLK*
iHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIIVAALILGAILGVFIFIPRHPTSGHSKSTHSSANSNKASKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGGDAILAHAGDDSTEGFYGPQHATRVFDMIDDFYIGDLKQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
P49100137 Cytochrome b5 OS=Oryza sa no no 0.669 0.576 0.45 4e-16
P39865 881 Nitrate reductase [NADH] N/A no 0.728 0.097 0.454 2e-14
O04354132 Cytochrome b5 OS=Borago o N/A no 0.627 0.560 0.466 2e-14
P49098136 Cytochrome b5 OS=Nicotian N/A no 0.635 0.551 0.421 4e-14
Q9HFV1131 Cytochrome b5 OS=Rhizopus N/A no 0.652 0.587 0.423 8e-14
Q42342134 Cytochrome b5 isoform A O no no 0.627 0.552 0.453 9e-14
P49099135 Cytochrome b5, seed isofo N/A no 0.635 0.555 0.421 1e-13
Q9ZWT2140 Cytochrome B5 isoform D O no no 0.627 0.528 0.426 2e-13
P39870 890 Inducible nitrate reducta no no 0.728 0.096 0.431 2e-13
P40934134 Cytochrome b5 OS=Brassica N/A no 0.627 0.552 0.44 2e-13
>sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 Back     alignment and function desciption
 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%), Gaps = 1/80 (1%)

Query: 38  SNKASKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGG-DAILAHAGDDSTEGFY 96
           SN   K+Y+ +EV  HN +DDCW+II  KVY+V+ ++E+HPGG D +L+  G D+T+ F 
Sbjct: 2   SNDNKKVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGGDDVLLSSTGKDATDDFE 61

Query: 97  GPQHATRVFDMIDDFYIGDL 116
              H+T    M+D++Y+GD+
Sbjct: 62  DVGHSTTARAMMDEYYVGDI 81
Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 Back     alignment and function description
>sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 Back     alignment and function description
>sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 Back     alignment and function description
>sp|Q42342|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CYTB5-A PE=1 SV=2 Back     alignment and function description
>sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 Back     alignment and function description
>sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 Back     alignment and function description
>sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
224142209118 predicted protein [Populus trichocarpa] 1.0 1.0 0.754 2e-46
255546309118 cytochrome B5 isoform 1, putative [Ricin 1.0 1.0 0.686 9e-42
351728070119 uncharacterized protein LOC100527821 [Gl 0.830 0.823 0.806 7e-41
356495869119 PREDICTED: nitrate reductase [NADH] 1-li 0.847 0.840 0.79 8e-41
388507718119 unknown [Medicago truncatula] 0.915 0.907 0.731 4e-40
388507960116 unknown [Lotus japonicus] gi|388517965|g 0.847 0.862 0.766 1e-39
225442456117 PREDICTED: cytochrome b5-like [Vitis vin 0.822 0.829 0.755 6e-37
29774318498 unnamed protein product [Vitis vinifera] 0.771 0.928 0.782 9e-36
449487961115 PREDICTED: cytochrome b5-like [Cucumis s 0.957 0.982 0.703 1e-35
449446520115 PREDICTED: cytochrome b5-like [Cucumis s 0.957 0.982 0.694 2e-35
>gi|224142209|ref|XP_002324451.1| predicted protein [Populus trichocarpa] gi|222865885|gb|EEF03016.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 99/118 (83%)

Query: 1   MVIIVAALILGAILGVFIFIPRHPTSGHSKSTHSSANSNKASKIYSKDEVTLHNKRDDCW 60
           MVI V ALI G +LGVFI IPR+  S  ++  +S+ N  KASK +SK EV+LHNKR DCW
Sbjct: 1   MVIAVVALIFGVLLGVFILIPRNRKSAQTEKAYSNENRIKASKTFSKAEVSLHNKRTDCW 60

Query: 61  IIIKNKVYDVTSYVEEHPGGDAILAHAGDDSTEGFYGPQHATRVFDMIDDFYIGDLKQ 118
           IIIK+KVYDVTSYVEEHPGGDAILAHAGDDSTEGF+GPQHATRVFDMI DFYI DLKQ
Sbjct: 61  IIIKDKVYDVTSYVEEHPGGDAILAHAGDDSTEGFFGPQHATRVFDMIGDFYIADLKQ 118

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255546309|ref|XP_002514214.1| cytochrome B5 isoform 1, putative [Ricinus communis] gi|223546670|gb|EEF48168.1| cytochrome B5 isoform 1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351728070|ref|NP_001237950.1| uncharacterized protein LOC100527821 [Glycine max] gi|255633304|gb|ACU17009.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356495869|ref|XP_003516793.1| PREDICTED: nitrate reductase [NADH] 1-like [Glycine max] Back     alignment and taxonomy information
>gi|388507718|gb|AFK41925.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388507960|gb|AFK42046.1| unknown [Lotus japonicus] gi|388517965|gb|AFK47044.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225442456|ref|XP_002283614.1| PREDICTED: cytochrome b5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743184|emb|CBI36051.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449487961|ref|XP_004157887.1| PREDICTED: cytochrome b5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449446520|ref|XP_004141019.1| PREDICTED: cytochrome b5-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
TAIR|locus:2036536121 CB5LP "cytochrome B5-like prot 0.627 0.611 0.837 2.3e-32
DICTYBASE|DDB_G0269488128 DDB_G0269488 [Dictyostelium di 0.754 0.695 0.494 2.7e-20
TAIR|locus:2028721135 CB5-A "cytochrome B5 isoform A 0.652 0.570 0.461 9.5e-18
ZFIN|ZDB-GENE-040426-2614153 cyb5b "cytochrome b5 type B" [ 0.754 0.581 0.411 1.8e-16
TAIR|locus:2168666134 CB5-E "cytochrome B5 isoform E 0.627 0.552 0.453 1.6e-15
TAIR|locus:2156534140 CB5-D "cytochrome B5 isoform D 0.627 0.528 0.426 2e-15
DICTYBASE|DDB_G0277079149 cyb5B "cytochrome b5 B" [Dicty 0.610 0.483 0.465 3.3e-15
FB|FBgn0032652137 CG6870 [Drosophila melanogaste 0.584 0.503 0.471 5.4e-15
TAIR|locus:2046417134 CB5-B "cytochrome B5 isoform B 0.635 0.559 0.407 5.4e-15
DICTYBASE|DDB_G0278567 461 DDB_G0278567 "cytochrome b5 re 0.610 0.156 0.506 7.3e-15
TAIR|locus:2036536 CB5LP "cytochrome B5-like protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 354 (129.7 bits), Expect = 2.3e-32, P = 2.3e-32
 Identities = 62/74 (83%), Positives = 70/74 (94%)

Query:    43 KIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGGDAILAHAGDDSTEGFYGPQHAT 102
             K YSK EV +HNKR+DCWIIIK+KVYD+TSYVEEHPGGDAIL HAGDDST+GF+GPQHAT
Sbjct:    47 KSYSKSEVAVHNKRNDCWIIIKDKVYDITSYVEEHPGGDAILDHAGDDSTDGFFGPQHAT 106

Query:   103 RVFDMIDDFYIGDL 116
             RVFDMI+DFYIG+L
Sbjct:   107 RVFDMIEDFYIGEL 120
GO:0005739 "mitochondrion" evidence=ISM
GO:0020037 "heme binding" evidence=IEA
GO:0016126 "sterol biosynthetic process" evidence=RCA
DICTYBASE|DDB_G0269488 DDB_G0269488 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2028721 CB5-A "cytochrome B5 isoform A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2614 cyb5b "cytochrome b5 type B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2168666 CB5-E "cytochrome B5 isoform E" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156534 CB5-D "cytochrome B5 isoform D" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277079 cyb5B "cytochrome b5 B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0032652 CG6870 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2046417 CB5-B "cytochrome B5 isoform B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0278567 DDB_G0278567 "cytochrome b5 reductase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
PLN02252 888 PLN02252, PLN02252, nitrate reductase [NADPH] 2e-26
pfam0017374 pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid 6e-25
PLN03198 526 PLN03198, PLN03198, delta6-acyl-lipid desaturase; 5e-21
COG5274164 COG5274, CYB5, Cytochrome b involved in lipid meta 1e-19
PLN03199 485 PLN03199, PLN03199, delta6-acyl-lipid desaturase-l 6e-15
>gnl|CDD|215141 PLN02252, PLN02252, nitrate reductase [NADPH] Back     alignment and domain information 
 Score =  101 bits (254), Expect = 2e-26
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 3/90 (3%)

Query: 29  SKSTHSSA-NSNKASKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGG-DAILAH 86
            KS  +   N+N  SK Y+  EV  HN  D CWI++   VYD T ++++HPGG D+IL +
Sbjct: 503 KKSVSTPFMNTNTGSKQYTMSEVRKHNSEDSCWIVVHGHVYDCTRFLKDHPGGADSILIN 562

Query: 87  AGDDSTEGFYGPQHATRVFDMIDDFYIGDL 116
           AG D TE F    H+ +   M++D+ IG+L
Sbjct: 563 AGTDCTEEFDA-IHSDKAKKMLEDYRIGEL 591

Length = 888
>gnl|CDD|201057 pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid binding domain Back     alignment and domain information
>gnl|CDD|178739 PLN03198, PLN03198, delta6-acyl-lipid desaturase; Provisional Back     alignment and domain information
>gnl|CDD|227599 COG5274, CYB5, Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|178740 PLN03199, PLN03199, delta6-acyl-lipid desaturase-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
KOG0537124 consensus Cytochrome b5 [Energy production and con 99.94
PF0017376 Cyt-b5: Cytochrome b5-like Heme/Steroid binding do 99.89
KOG0536145 consensus Flavohemoprotein b5+b5R [Energy producti 99.81
PLN03199 485 delta6-acyl-lipid desaturase-like protein; Provisi 99.79
PLN03198 526 delta6-acyl-lipid desaturase; Provisional 99.79
COG5274164 CYB5 Cytochrome b involved in lipid metabolism [En 99.77
PLN02252 888 nitrate reductase [NADPH] 99.75
KOG4576167 consensus Sulfite oxidase, heme-binding component 99.63
KOG4232 430 consensus Delta 6-fatty acid desaturase/delta-8 sp 99.5
COG489281 Predicted heme/steroid binding protein [General fu 99.04
KOG1110183 consensus Putative steroid membrane receptor Hpr6. 98.79
KOG1108 281 consensus Predicted heme/steroid binding protein [ 97.86
PF1490194 Jiv90: Cleavage inducing molecular chaperone 88.82
>KOG0537 consensus Cytochrome b5 [Energy production and conversion] Back     alignment and domain information 
Probab=99.94  E-value=5.8e-28  Score=166.47  Aligned_cols=78  Identities=47%  Similarity=0.942  Sum_probs=73.1

Q ss_pred             cCCccCHHHHhhhcCCCCeEEEEcCeeecccchhhhCCCcchhc-cccCCCccccccCCCCcHHHHHhhhhceeeeccC
Q 036360           41 ASKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGGDAIL-AHAGDDSTEGFYGPQHATRVFDMIDDFYIGDLKQ  118 (118)
Q Consensus        41 ~~~~~t~~ev~~h~~~~~~wvii~g~VYDvt~f~~~HPgG~~il-~~~G~D~T~~f~~~~Hs~~a~~~l~~~~IG~l~~  118 (118)
                      ..+.|+++|+++||..++|||+|+|+|||||.|+++||||..+| .+||+|+|+.|.+..||..|+++|++|+||.+.+
T Consensus         3 ~~k~~~~~EV~kHn~~~d~Wvii~gkVYDvT~Fl~eHPGG~~vLl~~AGkDaT~~F~~~gHS~~A~~ml~~y~ig~~~~   81 (124)
T KOG0537|consen    3 DLKYYTLSEVAKHNKKDDCWVIIHGKVYDVTSFLDEHPGGEDVLLEYAGKDATEAFEDVGHSKDAREMLEEYYIGEVPT   81 (124)
T ss_pred             ccccccHHHHHhhcCCCCeEEEECCEEEeccchhhhCCChHHHHHHHhchhhHHhccccCCcHHHHHHhhhcccccccC
Confidence            45789999999999999999999999999999999999998754 8999999999999899999999999999999863

>PF00173 Cyt-b5: Cytochrome b5-like Heme/Steroid binding domain This prints entry is a subset of the Pfam entry; InterPro: IPR001199 Cytochromes b5 are ubiquitous electron transport proteins found in animals, plants and yeasts [] Back     alignment and domain information
>KOG0536 consensus Flavohemoprotein b5+b5R [Energy production and conversion] Back     alignment and domain information
>PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional Back     alignment and domain information
>PLN03198 delta6-acyl-lipid desaturase; Provisional Back     alignment and domain information
>COG5274 CYB5 Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] Back     alignment and domain information
>PLN02252 nitrate reductase [NADPH] Back     alignment and domain information
>KOG4576 consensus Sulfite oxidase, heme-binding component [Energy production and conversion] Back     alignment and domain information
>KOG4232 consensus Delta 6-fatty acid desaturase/delta-8 sphingolipid desaturase [Lipid transport and metabolism] Back     alignment and domain information
>COG4892 Predicted heme/steroid binding protein [General function prediction only] Back     alignment and domain information
>KOG1110 consensus Putative steroid membrane receptor Hpr6 Back     alignment and domain information
>KOG1108 consensus Predicted heme/steroid binding protein [General function prediction only] Back     alignment and domain information
>PF14901 Jiv90: Cleavage inducing molecular chaperone Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
2i96_A108 Solution Structure Of The Oxidized Microsomal Human 1e-13
2m33_A104 Solution Nmr Structure Of Full-length Oxidized Micr 2e-13
1hko_A104 Nmr Structure Of Bovine Cytochrome B5 Length = 104 2e-13
1m2m_A82 Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cyt 4e-13
1cyo_A93 Bovine Cytochrome B(5) Length = 93 5e-13
1f03_A82 Solution Structure Of Oxidized Bovine Microsomal Cy 1e-12
1m20_A82 Crystal Structure Of F35y Mutant Of Trypsin-Solubil 1e-12
1do9_A94 Solution Structure Of Oxidized Microsomal Rabbit Cy 3e-12
1ehb_A82 Crystal Structure Of Recombinant Trypsin-Solubilize 3e-12
1es1_A82 Crystal Structure Of Val61his Mutant Of Trypsin-Sol 4e-12
1m2i_A82 Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME 4e-12
1i5u_A82 Solution Structure Of Cytochrome B5 Triple Mutant ( 4e-12
3ozz_B82 Structure Of A Cytochrome B5 Core-Swap Mutant Lengt 5e-12
2ibj_A88 Structure Of House Fly Cytochrome B5 Length = 88 5e-12
1awp_A92 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 8e-12
1bfx_A99 The Solution Nmr Structure Of The B Form Of Oxidize 9e-12
1i87_A98 Solution Structure Of The Water-Soluble Fragment Of 9e-12
1j0q_A82 Solution Structure Of Oxidized Bovine Microsomal Cy 9e-12
1u9u_A82 Crystal Structure Of F58y Mutant Of Cytochrome B5 L 9e-12
2i89_A93 Structure Of Septuple Mutant Of Rat Outer Mitochond 1e-11
1lr6_A82 Crystal Structure Of V45y Mutant Of Cytochrome B5 L 1e-11
1jex_A94 Solution Structure Of A67v Mutant Of Rat Ferro Cyto 1e-11
1u9m_A82 Crystal Structure Of F58w Mutant Of Cytochrome B5 L 1e-11
1eue_A86 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 1e-11
1ib7_A94 Solution Structure Of F35y Mutant Of Rat Ferro Cyto 2e-11
1lqx_A82 Crystal Structure Of V45e Mutant Of Cytochrome B5 L 2e-11
1b5m_A84 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 2e-11
3mus_A87 2a Resolution Structure Of Rat Type B Cytochrome B5 2e-11
1sh4_A82 Solution Structure Of Oxidized Bovine Microsomal Cy 2e-11
1icc_A87 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 2e-11
3ner_A92 Structure Of Human Type B Cytochrome B5 Length = 92 2e-11
1aqa_A94 Solution Structure Of Reduced Microsomal Rat Cytoch 4e-11
1lj0_A92 Structure Of Quintuple Mutant Of The Rat Outer Mito 4e-11
1m59_A82 Crystal Structure Of P40v Mutant Of Trypsin-Solubil 4e-11
1blv_A94 Solution Structure Of Oxidized Rat Microsomal Cytoc 5e-11
1cxy_A90 Structure And Characterization Of Ectothiorhodospir 1e-10
3ks0_A95 Crystal Structure Of The Heme Domain Of Flavocytoch 3e-10
2oz0_A 511 Mechanistic And Structural Studies Of H373q Flavocy 3e-10
1ltd_A 506 The 2.6 Angstroms Refined Structure Of The Escheric 3e-10
1ldc_A 511 X-Ray Structure Of Two Complexes Of The Y143f Flavo 3e-10
1fcb_A 511 Molecular Structure Of Flavocytochrome B2 At 2.4 An 3e-10
1sze_A 511 L230a Mutant Flavocytochrome B2 With Benzoylformate 3e-10
1szf_A 511 A198g:l230a Mutant Flavocytochrome B2 With Pyruvate 3e-10
3lf5_A88 Structure Of Human Nadh Cytochrome B5 Oxidoreductas 4e-10
1x3x_A82 Crystal Structure Of Cytochrome B5 From Ascaris Suu 1e-09
1mj4_A82 Crystal Structure Analysis Of The Cytochrome B5 Dom 5e-07
3r19_A 466 Chicken Sulfite Oxidase Triple Mutant With Altered 1e-04
3r18_A 466 Chicken Sulfite Oxidase Double Mutant With Altered 1e-04
3hc2_A 466 Crystal Structure Of Chicken Sulfite Oxidase Mutant 1e-04
1sox_A 466 Sulfite Oxidase From Chicken Liver Length = 466 2e-04
3hbq_A 466 Structure Of Recombinant Chicken Liver Sulfite Oxid 2e-04
3hbg_A 466 Structure Of Recombinant Chicken Liver Sulfite Oxid 2e-04
>pdb|2I96|A Chain A, Solution Structure Of The Oxidized Microsomal Human Cytochrome B5 Length = 108 Back     alignment and structure 
Iteration: 1

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 52/83 (62%), Gaps = 1/83 (1%)
Query: 35  SANSNKASKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGGDAIL-AHAGDDSTE 93
           +  S++A K Y+ +E+  HN     W+I+ +KVYD+T ++EEHPGG+ +L   AG D+TE
Sbjct: 2   AEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE 61
Query: 94  GFYGPQHATRVFDMIDDFYIGDL 116
            F    H+T   +M   F IG+L
Sbjct: 62  NFEDVGHSTDAREMSKTFIIGEL 84
>pdb|2M33|A Chain A, Solution Nmr Structure Of Full-length Oxidized Microsomal Rabbit Cytochrome B5 Length = 104 Back     alignment and structure
>pdb|1HKO|A Chain A, Nmr Structure Of Bovine Cytochrome B5 Length = 104 Back     alignment and structure
>pdb|1M2M|A Chain A, Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1CYO|A Chain A, Bovine Cytochrome B(5) Length = 93 Back     alignment and structure
>pdb|1F03|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant (E44a, E48a, E56a, D60a) And Its Interaction With Cytochrome C Length = 82 Back     alignment and structure
>pdb|1M20|A Chain A, Crystal Structure Of F35y Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1DO9|A Chain A, Solution Structure Of Oxidized Microsomal Rabbit Cytochrome B5. Factors Determining The Heterogeneous Binding Of The Heme Length = 94 Back     alignment and structure
>pdb|1EHB|A Chain A, Crystal Structure Of Recombinant Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1ES1|A Chain A, Crystal Structure Of Val61his Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1M2I|A Chain A, Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME B5 Length = 82 Back     alignment and structure
>pdb|1I5U|A Chain A, Solution Structure Of Cytochrome B5 Triple Mutant (E48aE56AD60A) Length = 82 Back     alignment and structure
>pdb|3OZZ|B Chain B, Structure Of A Cytochrome B5 Core-Swap Mutant Length = 82 Back     alignment and structure
>pdb|2IBJ|A Chain A, Structure Of House Fly Cytochrome B5 Length = 88 Back     alignment and structure
>pdb|1AWP|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 92 Back     alignment and structure
>pdb|1BFX|A Chain A, The Solution Nmr Structure Of The B Form Of Oxidized Rat Microsomal Cytochrome B5, Minimized Average Structure Length = 99 Back     alignment and structure
>pdb|1I87|A Chain A, Solution Structure Of The Water-Soluble Fragment Of Rat Hepatic Apocytochrome B5 Length = 98 Back     alignment and structure
>pdb|1J0Q|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V61h Length = 82 Back     alignment and structure
>pdb|1U9U|A Chain A, Crystal Structure Of F58y Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|2I89|A Chain A, Structure Of Septuple Mutant Of Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 93 Back     alignment and structure
>pdb|1LR6|A Chain A, Crystal Structure Of V45y Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1JEX|A Chain A, Solution Structure Of A67v Mutant Of Rat Ferro Cytochrome B5 Length = 94 Back     alignment and structure
>pdb|1U9M|A Chain A, Crystal Structure Of F58w Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1EUE|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 86 Back     alignment and structure
>pdb|1LQX|A Chain A, Crystal Structure Of V45e Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1B5M|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 84 Back     alignment and structure
>pdb|3MUS|A Chain A, 2a Resolution Structure Of Rat Type B Cytochrome B5 Length = 87 Back     alignment and structure
>pdb|1SH4|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V45h Length = 82 Back     alignment and structure
>pdb|1ICC|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 87 Back     alignment and structure
>pdb|3NER|A Chain A, Structure Of Human Type B Cytochrome B5 Length = 92 Back     alignment and structure
>pdb|1AQA|A Chain A, Solution Structure Of Reduced Microsomal Rat Cytochrome B5, Nmr, Minimized Average Structure Length = 94 Back     alignment and structure
>pdb|1LJ0|A Chain A, Structure Of Quintuple Mutant Of The Rat Outer Mitocondrial Cytochrome B5. Length = 92 Back     alignment and structure
>pdb|1M59|A Chain A, Crystal Structure Of P40v Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1BLV|A Chain A, Solution Structure Of Oxidized Rat Microsomal Cytochrome B5 In The Presence Of 2 M Guanidinium Chloride: Monitoring The Early Steps In Protein Unfolding Length = 94 Back     alignment and structure
>pdb|1CXY|A Chain A, Structure And Characterization Of Ectothiorhodospira Vacuolata Cytochrome B558, A Prokaryotic Homologue Of Cytochrome B5 Length = 90 Back     alignment and structure
>pdb|3KS0|A Chain A, Crystal Structure Of The Heme Domain Of Flavocytochrome B2 In Complex With Fab B2b4 Length = 95 Back     alignment and structure
>pdb|2OZ0|A Chain A, Mechanistic And Structural Studies Of H373q Flavocytochrome B2: Effects Of Mutating The Active Site Base Length = 511 Back     alignment and structure
>pdb|1LTD|A Chain A, The 2.6 Angstroms Refined Structure Of The Escherichia Coli Recombinant Saccharomyces Cerevisiae Flavocytochrome B2-Sulphite Complex Length = 506 Back     alignment and structure
>pdb|1LDC|A Chain A, X-Ray Structure Of Two Complexes Of The Y143f Flavocytochrome B2 Mutant Crystallized In The Presence Of Lactate Or Phenyl-Lactate Length = 511 Back     alignment and structure
>pdb|1FCB|A Chain A, Molecular Structure Of Flavocytochrome B2 At 2.4 Angstroms Resolution Length = 511 Back     alignment and structure
>pdb|1SZE|A Chain A, L230a Mutant Flavocytochrome B2 With Benzoylformate Length = 511 Back     alignment and structure
>pdb|1SZF|A Chain A, A198g:l230a Mutant Flavocytochrome B2 With Pyruvate Bound Length = 511 Back     alignment and structure
>pdb|3LF5|A Chain A, Structure Of Human Nadh Cytochrome B5 Oxidoreductase (Ncb5or) B5 Domain To 1.25a Resolution Length = 88 Back     alignment and structure
>pdb|1X3X|A Chain A, Crystal Structure Of Cytochrome B5 From Ascaris Suum Length = 82 Back     alignment and structure
>pdb|1MJ4|A Chain A, Crystal Structure Analysis Of The Cytochrome B5 Domain Of Human Sulfite Oxidase Length = 82 Back     alignment and structure
>pdb|3R19|A Chain A, Chicken Sulfite Oxidase Triple Mutant With Altered Activity And Substrate Affinity Length = 466 Back     alignment and structure
>pdb|3R18|A Chain A, Chicken Sulfite Oxidase Double Mutant With Altered Activity And Substrate Affinity Length = 466 Back     alignment and structure
>pdb|3HC2|A Chain A, Crystal Structure Of Chicken Sulfite Oxidase Mutant Tyr 322 Phe Length = 466 Back     alignment and structure
>pdb|1SOX|A Chain A, Sulfite Oxidase From Chicken Liver Length = 466 Back     alignment and structure
>pdb|3HBQ|A Chain A, Structure Of Recombinant Chicken Liver Sulfite Oxidase Mutant Cys 185 Ala Length = 466 Back     alignment and structure
>pdb|3HBG|A Chain A, Structure Of Recombinant Chicken Liver Sulfite Oxidase Mutant C185s Length = 466 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
1hko_A104 Cytochrome B5; electron transfer protein, heme, el 2e-35
3ner_A92 Cytochrome B5 type B; heme, electron transport; HE 1e-34
1x3x_A82 Cytochrome B5; hemoprotein, porcine parasitic nama 3e-34
2ibj_A88 Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif 3e-34
1cyo_A93 Cytochrome B5; electron transport; HET: HEM; 1.50A 4e-34
1cxy_A90 Cytochrome B5; helix, beta-strand, electron transp 2e-32
3lf5_A88 Cytochrome B5 reductase 4; NCB5OR, electron transf 2e-31
2keo_A112 Probable E3 ubiquitin-protein ligase HERC2; protei 2e-31
1mj4_A82 Sulfite oxidase; cytochrome B5, heme, oxidoreducta 7e-29
1kbi_A 511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 3e-22
1sox_A 466 Sulfite oxidase; oxidoreductase, sulfite oxidation 1e-13
>1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* Length = 104 Back     alignment and structure
 Score =  116 bits (292), Expect = 2e-35
 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 35  SANSNKASKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGG-DAILAHAGDDSTE 93
           +  S+KA K Y+ +E+  HN     W+I+  KVYD+T ++EEHPGG + +   AG D+TE
Sbjct: 1   AEESSKAVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATE 60

Query: 94  GFYGPQHATRVFDMIDDFYIGDLK 117
            F    H+T   ++   F IG+L 
Sbjct: 61  NFEDVGHSTDARELSKTFIIGELH 84
>3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* Length = 92 Back     alignment and structure
>1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} Length = 82 Back     alignment and structure
>2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} Length = 88 Back     alignment and structure
>1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... Length = 93 Back     alignment and structure
>1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 Length = 90 Back     alignment and structure
>3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} Length = 88 Back     alignment and structure
>2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 Length = 82 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Length = 511 Back     alignment and structure
>1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* Length = 466 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
3ner_A92 Cytochrome B5 type B; heme, electron transport; HE 99.95
1cxy_A90 Cytochrome B5; helix, beta-strand, electron transp 99.94
1cyo_A93 Cytochrome B5; electron transport; HET: HEM; 1.50A 99.94
1hko_A104 Cytochrome B5; electron transfer protein, heme, el 99.94
2ibj_A88 Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif 99.94
3lf5_A88 Cytochrome B5 reductase 4; NCB5OR, electron transf 99.93
1x3x_A82 Cytochrome B5; hemoprotein, porcine parasitic nama 99.93
1mj4_A82 Sulfite oxidase; cytochrome B5, heme, oxidoreducta 99.92
2keo_A112 Probable E3 ubiquitin-protein ligase HERC2; protei 99.92
1sox_A 466 Sulfite oxidase; oxidoreductase, sulfite oxidation 99.81
1kbi_A 511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 99.79
1j03_A102 Putative steroid binding protein; alpha and beta, 99.69
>3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} SCOP: d.120.1.1 PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* Back     alignment and structure
Probab=99.95  E-value=1.8e-28  Score=160.28  Aligned_cols=80  Identities=35%  Similarity=0.765  Sum_probs=74.2

Q ss_pred             CccCCccCHHHHhhhcCCCCeEEEEcCeeecccchhhhCCCcchhc-cccCCCccccccCCCCcHHHHHhhhhceeeecc
Q 036360           39 NKASKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGGDAIL-AHAGDDSTEGFYGPQHATRVFDMIDDFYIGDLK  117 (118)
Q Consensus        39 ~~~~~~~t~~ev~~h~~~~~~wvii~g~VYDvt~f~~~HPgG~~il-~~~G~D~T~~f~~~~Hs~~a~~~l~~~~IG~l~  117 (118)
                      .+..+.||++||++|++.++|||+|+|+|||||+|+..||||..++ .++|+|+|+.|....||..|+++|++|+||+|+
T Consensus         6 ~~~~~~~t~~Ev~~h~~~~~~wv~i~g~VYDvT~f~~~HPGG~~~l~~~aG~DaT~~F~~~~Hs~~a~~~L~~~~IG~l~   85 (92)
T 3ner_A            6 ETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIH   85 (92)
T ss_dssp             CCCSCEECHHHHTTCEETTEEEEEETTEEEECGGGTTTCTTCSHHHHTTTTSBCHHHHHHTTCCHHHHHHHGGGEEEEEC
T ss_pred             CCCCCeeCHHHHHhhCCCCCEEEEECCEEEEcccccccCCCHHHHHHHhcCCcchHHHHHcCCCHHHHHHHHhCeeEEEC
Confidence            4567899999999999999999999999999999999999999754 899999999998778999999999999999986


Q ss_pred             C
Q 036360          118 Q  118 (118)
Q Consensus       118 ~  118 (118)
                      +
T Consensus        86 ~   86 (92)
T 3ner_A           86 P   86 (92)
T ss_dssp             G
T ss_pred             h
Confidence            4
>1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 Back     alignment and structure
>1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... Back     alignment and structure
>1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* Back     alignment and structure
>2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} Back     alignment and structure
>3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} Back     alignment and structure
>1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} Back     alignment and structure
>1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 Back     alignment and structure
>2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1j03_A Putative steroid binding protein; alpha and beta, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.120.1.2 PDB: 1t0g_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 118
d1cyoa_88 d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [Ta 6e-26
d1cxya_81 d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira 1e-24
d1euea_86 d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegic 1e-23
d1kbia297 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal 4e-22
d1mj4a_80 d.120.1.1 (A:) Sulfite oxidase, N-terminal domain 4e-22
d1soxa291 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal dom 1e-20
>d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} Length = 88 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cytochrome b5-like heme/steroid binding domain
superfamily: Cytochrome b5-like heme/steroid binding domain
family: Cytochrome b5
domain: Cytochrome b5
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 90.7 bits (225), Expect = 6e-26
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 39  NKASKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGG-DAILAHAGDDSTEGFYG 97
           +KA K Y+ +E+  HN     W+I+  KVYD+T ++EEHPGG + +   AG D+TE F  
Sbjct: 1   SKAVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFED 60

Query: 98  PQHATRVFDMIDDFYIGDLK 117
             H+T   ++   F IG+L 
Sbjct: 61  VGHSTDARELSKTFIIGELH 80
>d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} Length = 81 Back     information, alignment and structure
>d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure
>d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d1euea_86 Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 101 99.96
d1cyoa_88 Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1cxya_81 Cytochrome b558 {Ectothiorhodospira vacuolata [Tax 99.95
d1soxa291 Sulfite oxidase, N-terminal domain {Chicken (Gallu 99.93
d1mj4a_80 Sulfite oxidase, N-terminal domain {Human (Homo sa 99.93
d1kbia297 Flavocytochrome b2, N-terminal domain {Baker's yea 99.92
d1t0ga_109 Putative steroid binding protein AT2G24940 {Thale 98.82
>d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cytochrome b5-like heme/steroid binding domain
superfamily: Cytochrome b5-like heme/steroid binding domain
family: Cytochrome b5
domain: Cytochrome b5
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.96  E-value=5e-30  Score=164.25  Aligned_cols=79  Identities=38%  Similarity=0.794  Sum_probs=73.8

Q ss_pred             ccCCccCHHHHhhhcCCCCeEEEEcCeeecccchhhhCCCcchhc-cccCCCccccccCCCCcHHHHHhhhhceeeeccC
Q 036360           40 KASKIYSKDEVTLHNKRDDCWIIIKNKVYDVTSYVEEHPGGDAIL-AHAGDDSTEGFYGPQHATRVFDMIDDFYIGDLKQ  118 (118)
Q Consensus        40 ~~~~~~t~~ev~~h~~~~~~wvii~g~VYDvt~f~~~HPgG~~il-~~~G~D~T~~f~~~~Hs~~a~~~l~~~~IG~l~~  118 (118)
                      +..+.||++||++||++++||++|+|+|||||+|+..||||..++ .++|+|+|+.|...+|+..|+++|++|+||+|++
T Consensus         2 p~~~~yt~~Ev~~H~~~~d~Wvii~g~VYDvT~f~~~HPGG~~~i~~~aG~D~T~~f~~~hhs~~a~~~l~~~~IG~l~~   81 (86)
T d1euea_           2 PAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEILLEQAGADATESFEDIGHSPDAREMLKQYYIGDVHP   81 (86)
T ss_dssp             CSCCEECHHHHTTCEETTEEEEEETTEEEECGGGGGGCTTCSHHHHTTTTSBCHHHHHHHTCCHHHHHHGGGGEEEEECG
T ss_pred             CCCCEECHHHHHhhCCCCCEEEEECCEEEecceeeeccCcchHHHHHHCCcCHHHHHHHhCCCHHHHHHHHhCcceEECc
Confidence            567899999999999999999999999999999999999998755 8999999999987789999999999999999874
>d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} Back     information, alignment and structure
>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t0ga_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure