Citrus Sinensis ID: 036448

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580
MAFLRRSFEDRENLEPIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWKVEEIGQGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNTEEDEEMEMIGEEYFNILAARSFFQEFKKDDDDDIMSCKMHDIVHDFAQFVSRKECLWVEINGTKDSVINSFGDKVRHLGLNFQRGTSFPMSIRGLDRLRTLLIYDRSDFNLSLSSILSSFSSSKECIERLPKTLCELYNLQKLDIRRCRNLKELPAGIGKLKNMRSLLNGETDSLKYMPVGISKLTSLRTLDKFVVGGGVDGSNTCRLESLKNLQLVRECGIEGLGNVLYLDEVERLQLYNQQNLLRLRLEFGRVVDGEDEERRRKKEKDEQLLKALQLPLSVEKLGIILYGGNIFPKWLTSLTNLRNLYLRSCVKCEHLPPLGKLPLEKLVIIHLKSVKRVGNEFLGIEESSEDGPSSSSSSPSVIAFPKLKSLIIGAMEELEEWNYRITRKENISIMPRLSSLEVRSCNKLKALPDYLLQTTTLQDLTIWKCALLENRYREGKGEDWHKISHIPHIKWSPLP
cccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHccccccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEcHHHHHHHHHHHHHcEEEEEEccccccccccccccEEEEEEEccccccccccccccccEEEEEccccccccccccccccEEEccccccccccccHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccEEEccccccccccccccccccccccEEEEEcccccccccHHHHccccccccccEEEEEEcccccccHHHHHHHcccHHHHHHcccccccccEEEEEEEccccccccccccccccEEEEEcccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEEccccHHHHHccccccccccccccccccccccc
cccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHccccccccccccccHHHEEcHccccccHHHHHHHHHHHEccccccEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEHHHHHHHHHHHHcccEEEEEEcccccccccccccccEEEEEEEcccccccccHHHcccccEEEEEccccccccccccHccEEEcccccccccccccccccccEEEEEcccccHHHccHHHcccccccEEEEccccccccccccccccccccEEEEEEcccccccccccccHHHcHEEEccccccccccccccHHHHHHccccccccccEcccccccccccHHHHHccccccHHHHHHHccccccccEEEEEcccccccccHcccccccEEEEEccccccccccccccccccEEEEccccccccccHHHcccccccccccccccccccccccccccEEEEcccccHccccccccccccccccccccEEEEcccccHccccccccccccccEEEEcccHHHHHHccccccccccHHcccccEEEcccc
MAFLRrsfedrenlePIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWKVEEIGQGLLAPLllsyndlpsnsmvkqCFSYcavfpknynmnKEELISLWMAQgylnteedEEMEMIGEEYFNILAARSFFQefkkdddddimsckmhDIVHDFAQFVSRKECLWVEINGTKDSVINSFGDKVrhlglnfqrgtsfpmsirGLDRLRTLLIydrsdfnlsLSSILSSFSSSKECIERLPKTLCELYNLQKLDIRRCRNLKELPAGIGKLKNMRSLlngetdslkympvgiskltslrtldkfvvgggvdgsntcrlESLKNLQLVRECGIEGLGNVLYLDEVERLQLYNQQNLLRLRLefgrvvdgedeerRRKKEKDEQLLKALQLPLSVEKLGIILyggnifpkWLTSLTNLRNlylrscvkcehlpplgklpleKLVIIHLKSVKRVGneflgieessedgpsssssspsviafpklKSLIIGAMEELEEWNYRITRkenisimprlsslevrscnklkalpdyllqtttlqDLTIWKCALLENryregkgedwhkishiphikwsplp
maflrrsfedrenlepigrkiahkckglPLAAKVIgnllrskstgkEWQRILESEMWKVEEIGQGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNTEEDEEMEMIGEEYFNILAARSFFQEFKKDDDDDIMSCKMHDIVHDFAQFVSRKECLWVEINGTKDSVINSFGDKVRHLGlnfqrgtsfpmsirGLDRLRTLLIYDRSDFNLSLSSILSSFSSSKECIERLPKTLCELYNLQKLDIRRCRNLKelpagigklknmrSLLNGETDSLKYMPVGISKLTSLRTLDKFVvgggvdgsntcRLESLKNLQLVRECGIEGLGNVLYLDEVERLQLYNQqnllrlrlefgrvvdgedeerrrkkekdeqllkalqlplsvEKLGIILYGGNIFPKWLTSLTNLRNLYLRSCVKCEHLPPLGKLPLEKLVIIHLKSVKRVGNEFLGIeessedgpsssssspsviAFPKLKSLIIGAMEELEEWNYRITRKENISIMPRLSSLEVRSCNKLKALPDYLLqtttlqdltIWKCALLENRYRegkgedwhkishiphikwsplp
MAFLRRSFEDRENLEPIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWKVEEIGQGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNTeedeememigeeYFNILAARSFFQEFkkdddddIMSCKMHDIVHDFAQFVSRKECLWVEINGTKDSVINSFGDKVRHLGLNFQRGTSFPMSIRGLDRLRTLLIYDRSDFNlslssilssfsssKECIERLPKTLCELYNLQKLDIRRCRNLKELPAGIGKLKNMRSLLNGETDSLKYMPVGISKLTSLRTLDKFVVGGGVDGSNTCRLESLKNLQLVRECGIEGLGNVLYLDEVErlqlynqqnllrlrlEFgrvvdgedeerrrkkekdeQLLKALQLPLSVEKLGIILYGGNIFPKWLTSLTNLRNLYLRSCVKCEHlpplgklpleklVIIHLKSVKRVGNEFLGIeessedgpsssssspsVIAFPKLKSLIIGAMEELEEWNYRITRKENISIMPRLSSLEVRSCNKLKALPDYllqtttlqdltIWKCALLENRYREGKGEDWHKISHIPHIKWSPLP
****************IGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWKVEEIGQGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNTEEDEEMEMIGEEYFNILAARSFFQEFKKDDDDDIMSCKMHDIVHDFAQFVSRKECLWVEINGTKDSVINSFGDKVRHLGLNFQRGTSFPMSIRGLDRLRTLLIYDRSDFNLSLSSILSSFSSSKECIERLPKTLCELYNLQKLDIRRCRNLKELPAGIGKLKNMRSLLNGETDSLKYMPVGISKLTSLRTLDKFVVGGGVDGSNTCRLESLKNLQLVRECGIEGLGNVLYLDEVERLQLYNQQNLLRLRLEFGRVV****************LLKALQLPLSVEKLGIILYGGNIFPKWLTSLTNLRNLYLRSCVKCEHLPPLGKLPLEKLVIIHLKSVKRVGNEFLGI****************VIAFPKLKSLIIGAMEELEEWNYRITRKENISIMPRLSSLEVRSCNKLKALPDYLLQTTTLQDLTIWKCALLENRYREGKGEDWHKISHIPHIKW****
MAFL****ED***LEPIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWKVEEIGQGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNTEE**EMEMIGEEYFNILAARSFFQEFKKDDDDDIMSCKMHDIVHDFAQFVSRKECLWVEINGT******SFGDKVRHLGLNFQRGTSFPMSIRGLDRLRTLLIYDRSDFNLSLSSILSSFSSSKECIERLPKTLCELYNLQKLDIRRCRNLKELPAGIGKLKNMRSLLNGETDSLKYMPVGISKLTSLRTLDKFVVGGGVDGSNTCRLESLKNLQLVRECGIEGLGNVLYLDEVERLQLYNQQNLLRLRLEFGRVVD**********EKDEQLLKALQLPLSVEKLGIILYGGNIFPKWLTSLTNLRNLYLRSCVKCEHLPPLGKLPLEKLVIIHLKSVKRVGNEFLGIEESSED***********IAFPKLKSLIIGAMEELEEWNYRITRKENISIMPRLSSLEVRSCNKLKALPDYLLQTTTLQDLTIWKCALLENRYREGKGEDWHKISHIPHIKWSPLP
MAFLRRSFEDRENLEPIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWKVEEIGQGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNTEEDEEMEMIGEEYFNILAARSFFQEFKKDDDDDIMSCKMHDIVHDFAQFVSRKECLWVEINGTKDSVINSFGDKVRHLGLNFQRGTSFPMSIRGLDRLRTLLIYDRSDFNLSLSSILSSFSSSKECIERLPKTLCELYNLQKLDIRRCRNLKELPAGIGKLKNMRSLLNGETDSLKYMPVGISKLTSLRTLDKFVVGGGVDGSNTCRLESLKNLQLVRECGIEGLGNVLYLDEVERLQLYNQQNLLRLRLEFGRVVD**************QLLKALQLPLSVEKLGIILYGGNIFPKWLTSLTNLRNLYLRSCVKCEHLPPLGKLPLEKLVIIHLKSVKRVGNEFLGI***************SVIAFPKLKSLIIGAMEELEEWNYRITRKENISIMPRLSSLEVRSCNKLKALPDYLLQTTTLQDLTIWKCALLENRYREGKGEDWHKISHIPHIKWSPLP
M*F*RRSFEDRENLEPIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWKVEEIGQGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNTEEDEEMEMIGEEYFNILAARSFFQEFKKDDDDDIMSCKMHDIVHDFAQFVSRKECLWVEINGTKDSVINSFGDKVRHLGLNFQRGTSFPMSIRGLDRLRTLLIYDRSDFNLSLSSILSSFSSSKECIERLPKTLCELYNLQKLDIRRCRNLKELPAGIGKLKNMRSLLNGETDSLKYMPVGISKLTSLRTLDKFVVGGGVDGSNTCRLESLKNLQLVRECGIEGLGNVLYLDEVERLQLYNQQNLLRLRLEFGRVVDGEDEERRRKKEKDEQLLKALQLPLSVEKLGIILYGGNIFPKWLTSLTNLRNLYLRSCVKCEHLPPLGKLPLEKLVIIHLKSVKRVGNEFLGIEESSEDGPSSSSSSPSVIAFPKLKSLIIGAMEELEEWNYRITRKENISIMPRLSSLEVRSCNKLKALPDYLLQTTTLQDLTIWKCALLENRYREGKGEDWHKISHIPHIKWSPL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFLRRSFEDRENLEPIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWKVEEIGQGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNTEEDEEMEMIGEEYFNILAARSFFQEFKKDDDDDIMSCKMHDIVHDFAQFVSRKECLWVEINGTKDSVINSFGDKVRHLGLNFQRGTSFPMSIRGLDRLRTLLIYDRSDFNLSLSSILSSFSSSKECIERLPKTLCELYNLQKLDIRRCRNLKELPAGIGKLKNMRSLLNGETDSLKYMPVGISKLTSLRTLDKFVVGGGVDGSNTCRLESLKNLQLVRECGIEGLGNVLYLDEVERLQLYNQQNLLRLRLEFGRVVDGEDEERRRKKEKDEQLLKALQLPLSVEKLGIILYGGNIFPKWLTSLTNLRNLYLRSCVKCEHLPPLGKLPLEKLVIIHLKSVKRVGNEFLGIEESSEDGPSSSSSSPSVIAFPKLKSLIIGAMEELEEWNYRITRKENISIMPRLSSLEVRSCNKLKALPDYLLQTTTLQDLTIWKCALLENRYREGKGEDWHKISHIPHIKWSPLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query580 2.2.26 [Sep-21-2011]
Q7XA39 988 Putative disease resistan N/A no 0.813 0.477 0.323 1e-54
Q7XA40992 Putative disease resistan N/A no 0.956 0.559 0.298 5e-54
Q7XBQ9970 Disease resistance protei N/A no 0.932 0.557 0.290 1e-53
Q7XA42979 Putative disease resistan N/A no 0.718 0.425 0.334 1e-52
Q9LRR4 1054 Putative disease resistan yes no 0.863 0.475 0.303 4e-51
Q9LRR5 1424 Putative disease resistan no no 0.884 0.360 0.303 1e-46
Q39214926 Disease resistance protei no no 0.881 0.551 0.268 9e-36
Q38834852 Disease resistance RPP13- no no 0.656 0.447 0.272 5e-30
Q8W3K3910 Putative disease resistan no no 0.875 0.558 0.271 7e-29
Q9FJB5901 Disease resistance RPP8-l no no 0.865 0.557 0.270 5e-27
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function desciption
 Score =  214 bits (546), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 180/556 (32%), Positives = 272/556 (48%), Gaps = 84/556 (15%)

Query: 1   MAFLRRSF----EDRENLEPIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEM 56
           + F++R+F    E   NL  IG++I  KC G+PLAAK +G LLR K    EW+ + ++E+
Sbjct: 320 LLFMQRAFGQQKEANPNLVAIGKEIVKKCGGVPLAAKTLGGLLRFKREESEWEHVRDNEI 379

Query: 57  WKVEEIGQGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNT 116
           W + +    +L  L LSY+ LP +  ++QCF+YCAVFPK+  M KE LI+LWMA G+L +
Sbjct: 380 WSLPQDESSILPALRLSYHHLPLD--LRQCFAYCAVFPKDTKMIKENLITLWMAHGFLLS 437

Query: 117 EEDEEMEMIGEEYFNILAARSFFQEFKKDDDDDIMSCKMHDIVHDFAQ--FVSRKECLWV 174
           + + E+E +G E +N L  RSFFQE +    +     K+HD++HD A   F +   C  +
Sbjct: 438 KGNLELEDVGNEVWNELYLRSFFQEIEAKSGNTYF--KIHDLIHDLATSLFSASASCGNI 495

Query: 175 EINGTKD----------SVINSFGD-------KVRHLGLNFQRGTSFPMSIRGLDRLRTL 217
                KD          +V++S+          +R L L++ +    P SI  L  LR L
Sbjct: 496 REINVKDYKHTVSIGFAAVVSSYSPSLLKKFVSLRVLNLSYSKLEQLPSSIGDLLHLRYL 555

Query: 218 LIYDRSDFNLSLSSILSSFSSSKECIERLPKTLCELYNLQKLDIRRCRNLKELPAGIGKL 277
                   +LS ++  S           LP+ LC+L NLQ LD+  C +L  LP    KL
Sbjct: 556 --------DLSCNNFRS-----------LPERLCKLQNLQTLDVHNCYSLNCLPKQTSKL 596

Query: 278 KNMRSLLNGETDSLKYMPVGISKLTSLRTLDKFVVGGGVDGSNTCRLESLKNLQLVRECG 337
            ++R L+  +   L   P  I  LT L+TL  F+VG         +L  LKNL L     
Sbjct: 597 SSLRHLV-VDGCPLTSTPPRIGLLTCLKTLGFFIVG----SKKGYQLGELKNLNLCGSIS 651

Query: 338 IEGLGNVLYLDEVERLQLYNQQNLLRLRLEFGRVVDGEDEERRRKKEKDEQLLKALQLPL 397
           I  L  V    + E   L  + NL  L + +    DG +    R + K+ ++L+AL+   
Sbjct: 652 ITHLERVKNDTDAEA-NLSAKANLQSLSMSWDN--DGPN----RYESKEVKVLEALKPHP 704

Query: 398 SVEKLGIILYGGNIFPKWL--TSLTNLRNLYLRSCVKCEHLPPLGKLP-LEKLVIIHLKS 454
           +++ L II +GG  FP W+  + L  + ++ ++SC  C  LPP G+LP LE L       
Sbjct: 705 NLKYLEIIAFGGFRFPSWINHSVLEKVISVRIKSCKNCLCLPPFGELPCLENL------- 757

Query: 455 VKRVGNEFLGIEESSEDGPSSSSSSPSVIAFPKLKSLIIGAMEELEEWNYR----ITRKE 510
              + N    +E   ED   S  S+    +FP LK L I        W +R    + ++E
Sbjct: 758 --ELQNGSAEVEYVEEDDVHSRFSTRR--SFPSLKKLRI--------WFFRSLKGLMKEE 805

Query: 511 NISIMPRLSSLEVRSC 526
                P L  + +  C
Sbjct: 806 GEEKFPMLEEMAILYC 821
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query580
359482790 923 PREDICTED: putative disease resistance p 0.937 0.589 0.428 1e-119
359482769 904 PREDICTED: putative disease resistance p 0.929 0.596 0.427 1e-116
147825450 927 hypothetical protein VITISV_000086 [Viti 0.934 0.584 0.426 1e-116
359482792 922 PREDICTED: putative disease resistance p 0.934 0.587 0.426 1e-115
359482784 919 PREDICTED: putative disease resistance p 0.931 0.587 0.425 1e-114
224110248 888 cc-nbs-lrr resistance protein [Populus t 0.955 0.623 0.426 1e-113
224122712 945 cc-nbs-lrr resistance protein [Populus t 0.944 0.579 0.427 1e-112
224114824 941 cc-nbs-lrr resistance protein [Populus t 0.934 0.575 0.413 1e-111
255549784 786 leucine-rich repeat containing protein, 0.956 0.706 0.411 1e-108
224134406 987 cc-nbs-lrr resistance protein [Populus t 0.958 0.563 0.415 1e-108
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  437 bits (1123), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 262/611 (42%), Positives = 368/611 (60%), Gaps = 67/611 (10%)

Query: 1   MAFLRRS-FEDRENLEPIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWKV 59
           +AF  RS +E  E L+ IG KIA KCKGLPLA K +GNLLR K++ +EW+ +L SE+W++
Sbjct: 344 IAFYERSTWEKEEELKEIGEKIADKCKGLPLAIKTLGNLLRIKNSEEEWKNVLNSEVWQL 403

Query: 60  EEIGQGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNTEED 119
           +E  + +   LLLSY DLP    +++CFS+CAVFPK+  + ++ELI LWMAQ YL ++  
Sbjct: 404 DEFERDISPALLLSYYDLPP--AIQRCFSFCAVFPKDSVIERDELIKLWMAQSYLKSDGS 461

Query: 120 EEMEMIGEEYFNILAARSFFQEFKKDDDDDIMSCKMHDIVHDFAQFVSRKECLWVEINGT 179
           +EMEM+G  YF  LAARSFFQ+F+KDDD +I+ CKMHDIVHDFAQF++  EC  VE++  
Sbjct: 462 KEMEMVGRTYFEYLAARSFFQDFEKDDDGNIIHCKMHDIVHDFAQFLTLNECFIVEVDNQ 521

Query: 180 KDSVINSFGDKVRHLGLNFQRGTSFPMSIRGLDRLRTLLIYDRSDFNL-----SLSSILS 234
           K   ++ F  K+RH  L  +  T    S   +  L TLL     D  +      L+ + +
Sbjct: 522 KKGSMDLFFQKIRHATLVVRESTPNFASTCNMKNLHTLLAKRAFDSRVLEALGHLTCLRA 581

Query: 235 SFSSSKECIERLPK------------------------TLCELYNLQKLDIRRCRNLKEL 270
               S + IE LPK                        T+C+LYNLQ L+I+ C  L++L
Sbjct: 582 LDLRSNQLIEELPKEVGKLIHLRYLNLSYCDSLRELPETICDLYNLQTLNIQACSRLQKL 641

Query: 271 PAGIGKLKNMRSLLNGETDSLKYMPVGISKLTSLRTLDKFVVGGGVDGSNTCRLESLKNL 330
           P  +GKL N+R L N + D L+ +P GI +L+SL+TLD F+V     G++ C++E L+NL
Sbjct: 642 PQAMGKLINLRHLENYDADDLQGLPKGIGRLSSLQTLDVFIVSS--HGNDECQIEDLRNL 699

Query: 331 QLVR-ECGIEGLGNVLYLDEVERLQLYNQQNLLRLRLEFGRVVDGEDEERRRKKEKDEQL 389
             +R    I+GL  V    E E+ +L N+ +L RL LEFG    GE        E  + +
Sbjct: 700 NNLRGRLSIQGLDEVKDAGEAEKAELQNRVHLQRLTLEFG----GE--------EGTKGV 747

Query: 390 LKALQLPLSVEKLGIILYGGNIFPKWL--TSLTNLRNLYLRSCVKCEHLPPLGKLP-LEK 446
            +ALQ   +++ L II YG   +P W+  +SL  L+ L+LR C++C  LPPLG+LP LE+
Sbjct: 748 AEALQPHPNLKFLCIIRYGDREWPNWMMGSSLAQLKILHLRFCIRCPCLPPLGQLPVLEE 807

Query: 447 LVIIHLKSVKRVGNEFLGIEESSEDGPSSSSSSPSVIAFPKLKSLIIGAMEELEEWNYRI 506
           L I  +  +K +G+EFLG         SSS+       FPKLK L I  ++EL++W   I
Sbjct: 808 LGICFMYGLKYIGSEFLG---------SSST------VFPKLKGLYIYGLDELKQWE--I 850

Query: 507 TRKENISIMPRLSSLEVRSCNKLKALPDYLLQTTTLQDLTIWKCALLENRYREGKGEDWH 566
             KE  SIMP L++L  + C KL+ LPD++LQ   LQ L I    +LE RYR+  GED H
Sbjct: 851 KEKEERSIMPCLNALRAQHCPKLEGLPDHVLQRAPLQKLNIKYSPVLERRYRKDIGEDGH 910

Query: 567 KISHIPHIKWS 577
           KISHIP +++S
Sbjct: 911 KISHIPEVEYS 921

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147825450|emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482792|ref|XP_002268589.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224110248|ref|XP_002333128.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834939|gb|EEE73388.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224122712|ref|XP_002318907.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859580|gb|EEE97127.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114824|ref|XP_002332291.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222832453|gb|EEE70930.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255549784|ref|XP_002515943.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223544848|gb|EEF46363.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224134406|ref|XP_002321815.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222868811|gb|EEF05942.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query580
TAIR|locus:2077572926 RPM1 "RESISTANCE TO P. SYRINGA 0.513 0.321 0.292 1.3e-31
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.320 0.103 0.338 1.7e-29
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.484 0.197 0.309 9.4e-25
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.501 0.276 0.292 1.9e-24
TAIR|locus:2078012852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.325 0.221 0.296 8.4e-23
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.546 0.372 0.266 5.8e-22
TAIR|locus:2011982857 AT1G50180 [Arabidopsis thalian 0.503 0.340 0.285 1.5e-21
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.505 0.325 0.260 2.9e-20
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.525 0.343 0.282 2.8e-18
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.351 0.224 0.257 7.3e-18
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 342 (125.4 bits), Expect = 1.3e-31, Sum P(3) = 1.3e-31
 Identities = 93/318 (29%), Positives = 155/318 (48%)

Query:    12 ENLEPIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWKVEEIGQGLLAP-- 69
             +NLEPI RK+  +C+GLPLA   +G+++ +K    EW+++  +  W++    +  +    
Sbjct:   360 QNLEPIARKLVERCQGLPLAIASLGSMMSTKKFESEWKKVYSTLNWELNNNHELKIVRSI 419

Query:    70 LLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNTXXXXXXXXXXXXY 129
             + LS+NDLP    +K+CF YC++FP NY M ++ LI +WMAQ ++              Y
Sbjct:   420 MFLSFNDLPYP--LKRCFLYCSLFPVNYRMKRKRLIRMWMAQRFVEPIRGVKAEEVADSY 477

Query:   130 FNILAARSFFQEFXXXXXXXIMSCKMHDIVHDFAQFVSRKECLWVEINGTKDS-----VI 184
              N L  R+  Q           + KMHD++ + A  VS+ E      N   D       +
Sbjct:   478 LNELVYRNMLQVILWNPFGRPKAFKMHDVIWEIALSVSKLERFCDVYNDDSDGDDAAETM 537

Query:   185 NSFGDKVRHLGLNFQRGTSFPMSIRGLDRLRTLLIYDRSDFNXX---XXXXXXXXXXXKE 241
              ++G   RHL +  Q+  + P SIR  + L +LL+   +                     
Sbjct:   538 ENYGS--RHLCI--QKEMT-PDSIRATN-LHSLLVCSSAKHKMELLPSLNLLRALDLEDS 591

Query:   242 CIERLPKTLCELYNLQKLDIRRCRNLKELPAGIGKLKNMRSLLNGETDSLKYMPVGISKL 301
              I +LP  L  ++NL+ L++ + + +KELP    KL N+ +L N +   ++ +P+G+ KL
Sbjct:   592 SISKLPDCLVTMFNLKYLNLSKTQ-VKELPKNFHKLVNLETL-NTKHSKIEELPLGMWKL 649

Query:   302 TSLRTLDKFVVGGGVDGS 319
               LR L  F    G D +
Sbjct:   650 KKLRYLITFRRNEGHDSN 667
GO:0006952 "defense response" evidence=IEA;ISS;TAS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0005886 "plasma membrane" evidence=IDA
GO:0000166 "nucleotide binding" evidence=ISS
GO:0009626 "plant-type hypersensitive response" evidence=IDA
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011982 AT1G50180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query580
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-26
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.002
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  109 bits (274), Expect = 2e-26
 Identities = 47/112 (41%), Positives = 73/112 (65%), Gaps = 4/112 (3%)

Query: 5   RRSFEDRENLEPIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWKVEEIGQ 64
            +       LE + ++I  KCKGLPLA KV+G LL  KST +EW+ +LE    ++     
Sbjct: 171 EKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDG 230

Query: 65  --GLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYL 114
              +L+ L LSY++LP +  +K+CF Y A+FP++YN+ KE+LI LW+A+G++
Sbjct: 231 LNEVLSILSLSYDNLPMH--LKRCFLYLALFPEDYNIRKEQLIKLWIAEGFV 280

Length = 285
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 580
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.82
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.78
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.77
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.74
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.68
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.65
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.61
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.53
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.51
KOG0617264 consensus Ras suppressor protein (contains leucine 99.44
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.41
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.38
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.36
KOG0617264 consensus Ras suppressor protein (contains leucine 99.3
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.29
KOG4237498 consensus Extracellular matrix protein slit, conta 99.24
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.06
KOG4237498 consensus Extracellular matrix protein slit, conta 99.0
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.96
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.89
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.66
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.61
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.59
KOG4341483 consensus F-box protein containing LRR [General fu 98.48
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.48
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.46
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.32
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.32
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.29
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.25
PRK15386426 type III secretion protein GogB; Provisional 98.25
PLN03150623 hypothetical protein; Provisional 98.23
KOG4341483 consensus F-box protein containing LRR [General fu 98.13
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.06
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.01
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.94
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.89
PLN03150623 hypothetical protein; Provisional 97.84
PRK15386 426 type III secretion protein GogB; Provisional 97.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.76
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.75
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.67
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.55
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.49
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.3
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.22
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.12
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.75
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.74
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.71
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.61
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.27
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.21
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.06
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.03
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.02
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.98
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.85
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.77
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.51
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.3
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.96
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.82
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.68
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.66
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.31
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.43
smart0037026 LRR Leucine-rich repeats, outliers. 91.35
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.35
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.72
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.33
PRK04841 903 transcriptional regulator MalT; Provisional 86.16
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 81.75
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-54  Score=461.57  Aligned_cols=498  Identities=27%  Similarity=0.409  Sum_probs=351.7

Q ss_pred             ccCCCCCCCCCCHHHHHHHHHHhcCCchHHHHHHHHHhcCCCCHHHHHHHHhhhhcc----cccccccchhHHHhhhcCC
Q 036448            2 AFLRRSFEDRENLEPIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWK----VEEIGQGLLAPLLLSYNDL   77 (580)
Q Consensus         2 aF~~~~~~~~~~~~~~~~~i~~~c~GlPLai~~ig~~L~~~~~~~~W~~~~~~~~~~----~~~~~~~~~~~l~~sy~~L   77 (580)
                      ||.... ...+.++++|++||++|+|||||+++||++|+.|+++++|+++.+...+.    ..++.+.+++++++|||.|
T Consensus       330 v~~~~~-~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L  408 (889)
T KOG4658|consen  330 VGPNTL-GSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNL  408 (889)
T ss_pred             hccccc-cccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhh
Confidence            455422 24456999999999999999999999999999999999999999865443    2233467899999999999


Q ss_pred             CCcchhhhhhhhccccCCCcccCHHHHHHHHHHcCCccCC-CchhHHHHHHHHHHHHHHcCCccccccCCCCCcceEEec
Q 036448           78 PSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNTE-EDEEMEMIGEEYFNILAARSFFQEFKKDDDDDIMSCKMH  156 (580)
Q Consensus        78 ~~~~~~k~~fl~~~~f~~~~~i~~~~Li~~w~a~g~~~~~-~~~~~~~~~~~~~~~L~~~~ll~~~~~~~~~~~~~~~mh  156 (580)
                      |.  ++|.||+|||+|||||.|++++|+.+|+||||+.+. .++.+++.|+.|+.+|++++|++.....  ++..+|+||
T Consensus       409 ~~--~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~--~~~~~~kmH  484 (889)
T KOG4658|consen  409 PE--ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE--GRKETVKMH  484 (889)
T ss_pred             hH--HHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc--cceeEEEee
Confidence            96  999999999999999999999999999999999884 4678999999999999999999987654  667789999


Q ss_pred             HHHHHHHHHhhh-----cceEEEEec-CccccccccCCCceEEEEEEecCCCcCcccccCCCcccEEEeccCC--ccccc
Q 036448          157 DIVHDFAQFVSR-----KECLWVEIN-GTKDSVINSFGDKVRHLGLNFQRGTSFPMSIRGLDRLRTLLIYDRS--DFNLS  228 (580)
Q Consensus       157 dl~~~~~~~i~~-----~e~~~~~~~-~~~~~~~~~~~~~~~~L~l~~~~~~~~~~~~~~l~~Lr~L~l~~~~--~l~l~  228 (580)
                      |+||+||.+++.     +++.++..+ +....+....+..+|++++.++.+..++.... +++|++|.+.+|+  ...++
T Consensus       485 DvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~-~~~L~tLll~~n~~~l~~is  563 (889)
T KOG4658|consen  485 DVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSE-NPKLRTLLLQRNSDWLLEIS  563 (889)
T ss_pred             HHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCC-CCccceEEEeecchhhhhcC
Confidence            999999999999     677555543 33334445557899999999999987776654 4589999999986  44444


Q ss_pred             cccee-------eecccccccccccchhhccCCCccEEeccCCccccccchhhhcccCCCeEEcCCCCCCccCcccCCCC
Q 036448          229 LSSIL-------SSFSSSKECIERLPKTLCELYNLQKLDIRRCRNLKELPAGIGKLKNMRSLLNGETDSLKYMPVGISKL  301 (580)
Q Consensus       229 ~~~~~-------L~l~~~~~~i~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~i~~l~~L~~L~l~~~~~~~~lp~~i~~L  301 (580)
                      ...+.       |||++|.. +.++|++|++|.+||+|+++++. +.++|.++++|.+|.+|++..+..+..+|..+..|
T Consensus       564 ~~ff~~m~~LrVLDLs~~~~-l~~LP~~I~~Li~LryL~L~~t~-I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L  641 (889)
T KOG4658|consen  564 GEFFRSLPLLRVLDLSGNSS-LSKLPSSIGELVHLRYLDLSDTG-ISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLEL  641 (889)
T ss_pred             HHHHhhCcceEEEECCCCCc-cCcCChHHhhhhhhhcccccCCC-ccccchHHHHHHhhheeccccccccccccchhhhc
Confidence            32222       89997765 89999999999999999999988 88999999999999999999887777776666679


Q ss_pred             CCCCcCCceeecCccCCCCccChhhhhcCCcCCceeEeCCCCCCChhHHHhcccccccccceeEEEeecccCCchhHHhh
Q 036448          302 TSLRTLDKFVVGGGVDGSNTCRLESLKNLQLVRECGIEGLGNVLYLDEVERLQLYNQQNLLRLRLEFGRVVDGEDEERRR  381 (580)
Q Consensus       302 ~~L~~L~~~~~~~~~~~~~~~~l~~L~~L~~L~~l~i~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~  381 (580)
                      ++|++|.++...   .......++++.+|++|+.+.+..... ..     ...+..+..|.++...-..           
T Consensus       642 ~~Lr~L~l~~s~---~~~~~~~l~el~~Le~L~~ls~~~~s~-~~-----~e~l~~~~~L~~~~~~l~~-----------  701 (889)
T KOG4658|consen  642 QSLRVLRLPRSA---LSNDKLLLKELENLEHLENLSITISSV-LL-----LEDLLGMTRLRSLLQSLSI-----------  701 (889)
T ss_pred             ccccEEEeeccc---cccchhhHHhhhcccchhhheeecchh-Hh-----HhhhhhhHHHHHHhHhhhh-----------
Confidence            999999876554   112244567777777777766643221 00     0111222223222111100           


Q ss_pred             hhhhHHHHhhcCCCCCCCcEEEEeecCCCCCC-cchh-----c-ccCCcEEEEcCCCCCCCCCCCCCcc-ccceeccccc
Q 036448          382 KKEKDEQLLKALQLPLSVEKLGIILYGGNIFP-KWLT-----S-LTNLRNLYLRSCVKCEHLPPLGKLP-LEKLVIIHLK  453 (580)
Q Consensus       382 ~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~lp-~~l~-----~-l~~L~~L~L~~~~~l~~l~~l~~l~-L~~L~l~~~~  453 (580)
                      ...........+..+.+|+.|.+.+|.+.... .|..     . ++++..+.+.+|.....+.+....| |+.|.+..|.
T Consensus       702 ~~~~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~  781 (889)
T KOG4658|consen  702 EGCSKRTLISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCR  781 (889)
T ss_pred             cccccceeecccccccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccccccccchhhccCcccEEEEeccc
Confidence            00122445566677788888888888775432 1211     2 5566677777777666666655666 8888888877


Q ss_pred             CceEeCccccCCCCCCCCCCCCCCCCCccccCcccccc-cccccccccccccccccccccCCCCccceeeeccCCCCCCC
Q 036448          454 SVKRVGNEFLGIEESSEDGPSSSSSSPSVIAFPKLKSL-IIGAMEELEEWNYRITRKENISIMPRLSSLEVRSCNKLKAL  532 (580)
Q Consensus       454 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L-~l~~~~~L~~~~~~~~~~~~~~~l~~L~~L~l~~c~~L~~l  532 (580)
                      .++.+...........          ..+..|+++..+ .+.+.+.++++..      .--.++.|+.+.+..|++++.+
T Consensus       782 ~~e~~i~~~k~~~~l~----------~~i~~f~~~~~l~~~~~l~~l~~i~~------~~l~~~~l~~~~ve~~p~l~~~  845 (889)
T KOG4658|consen  782 LLEDIIPKLKALLELK----------ELILPFNKLEGLRMLCSLGGLPQLYW------LPLSFLKLEELIVEECPKLGKL  845 (889)
T ss_pred             ccccCCCHHHHhhhcc----------cEEecccccccceeeecCCCCceeEe------cccCccchhheehhcCcccccC
Confidence            6665533221111100          012344455555 2444444433322      0114556888888888877776


Q ss_pred             CcCCCCCCCcceEEEecC
Q 036448          533 PDYLLQTTTLQDLTIWKC  550 (580)
Q Consensus       533 p~~~~~l~~L~~L~i~~c  550 (580)
                      |       .+.++.+.+|
T Consensus       846 P-------~~~~~~i~~~  856 (889)
T KOG4658|consen  846 P-------LLSTLTIVGC  856 (889)
T ss_pred             c-------cccccceecc
Confidence            5       4455566665

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query580
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-49
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-41
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  180 bits (458), Expect = 1e-49
 Identities = 29/181 (16%), Positives = 62/181 (34%), Gaps = 22/181 (12%)

Query: 3   FLRRSFEDRENLEPIGRKIAHKCKGLPLAAKVIGNLLRSK-STGKEWQRILESEMWKVEE 61
                   + +L      I  +CKG PL   +IG LLR   +  + + + L+++ +K   
Sbjct: 295 LSLFVNMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIR 354

Query: 62  IG-----QGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKNYNMNKEELISLWMAQGYLNT 116
                  + L   + +S   L  +  +K  ++  ++  K+  +  + L  LW  +     
Sbjct: 355 KSSSYDYEALDEAMSISVEMLRED--IKDYYTDLSILQKDVKVPTKVLCILWDMETE--- 409

Query: 117 EEDEEMEMIGEEYFNILAARSFFQEFKKDDDDDIMSCKMHDIVHDFAQFVSRKECLWVEI 176
                     E+       +S       D +       +HD+  DF    +  +   +  
Sbjct: 410 --------EVEDILQEFVNKSLLF---CDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHK 458

Query: 177 N 177
            
Sbjct: 459 K 459
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query580
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.9
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.89
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.88
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.88
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.88
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.88
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.88
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.87
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.87
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.86
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.85
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.85
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.84
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.84
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.84
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.83
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.83
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.8
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.8
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.8
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.77
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.76
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.75
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.74
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.72
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.71
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.71
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.69
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.68
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.67
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.67
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.67
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.66
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.66
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.65
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.65
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.65
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.65
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.64
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.64
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.63
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.62
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.62
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.6
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.59
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.59
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.59
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.58
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.58
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.58
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.57
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.56
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.54
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.52
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.52
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.52
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.51
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.51
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.5
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.49
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.48
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.47
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.46
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.46
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.43
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.42
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.41
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.4
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.39
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.38
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.37
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.37
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.35
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.35
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.35
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.34
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.34
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.33
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.3
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.25
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.25
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.21
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.21
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.2
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.19
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.19
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.17
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.12
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.08
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.02
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.01
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.0
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.97
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.94
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.94
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.91
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.9
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.9
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.88
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.85
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.83
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.74
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.68
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.67
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.63
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.44
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.26
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.03
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.99
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.92
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.87
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.74
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.72
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.51
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.13
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.99
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.95
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.2
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.19
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.8
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.74
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.35
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.11
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 83.21
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 81.96
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.92  E-value=1.6e-25  Score=245.28  Aligned_cols=357  Identities=18%  Similarity=0.152  Sum_probs=199.9

Q ss_pred             CCceEEEEEEecCCC-cCcccccCC-CcccEEEeccCCcccccccce-------eeeccccccccc-ccchh-hccCCCc
Q 036448          188 GDKVRHLGLNFQRGT-SFPMSIRGL-DRLRTLLIYDRSDFNLSLSSI-------LSSFSSSKECIE-RLPKT-LCELYNL  256 (580)
Q Consensus       188 ~~~~~~L~l~~~~~~-~~~~~~~~l-~~Lr~L~l~~~~~l~l~~~~~-------~L~l~~~~~~i~-~lp~~-i~~L~~L  256 (580)
                      ..++++|++.+|.+. .+|..+... ++|++|++++|+.-......+       .|+++++.  +. .+|.. ++++++|
T Consensus       268 l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~--l~~~ip~~~l~~l~~L  345 (768)
T 3rgz_A          268 LKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNN--FSGELPMDTLLKMRGL  345 (768)
T ss_dssp             CTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSE--EEEECCHHHHTTCTTC
T ss_pred             cCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCc--ccCcCCHHHHhcCCCC
Confidence            467778888877776 466666554 778888887775432211111       16777776  54 66655 6777777


Q ss_pred             cEEeccCCccccccchhhhccc-CCCeEEcCCCCCCc--------------------------cCcccCCCCCCCCcCCc
Q 036448          257 QKLDIRRCRNLKELPAGIGKLK-NMRSLLNGETDSLK--------------------------YMPVGISKLTSLRTLDK  309 (580)
Q Consensus       257 ~~L~L~~~~~l~~lp~~i~~l~-~L~~L~l~~~~~~~--------------------------~lp~~i~~L~~L~~L~~  309 (580)
                      ++|++++|.....+|..+++++ +|++|++++|....                          .+|..++++++|++|++
T Consensus       346 ~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L  425 (768)
T 3rgz_A          346 KVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHL  425 (768)
T ss_dssp             CEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEEC
T ss_pred             CEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEEC
Confidence            7777777763346666666665 66666666653333                          34444455555555543


Q ss_pred             eeecCccCCCCccChhhhhcCCcCCceeEeCCCCCCChhHHHhcccccccccceeEEEeecccCCchhHHhhhhhhHHHH
Q 036448          310 FVVGGGVDGSNTCRLESLKNLQLVRECGIEGLGNVLYLDEVERLQLYNQQNLLRLRLEFGRVVDGEDEERRRKKEKDEQL  389 (580)
Q Consensus       310 ~~~~~~~~~~~~~~l~~L~~L~~L~~l~i~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~  389 (580)
                      ..+  ...+..+   ..+..++.|+.+.+....-.    ...+..+..+++|+.|+++.|.+.              ...
T Consensus       426 s~N--~l~~~~p---~~l~~l~~L~~L~L~~n~l~----~~~p~~~~~l~~L~~L~L~~N~l~--------------~~~  482 (768)
T 3rgz_A          426 SFN--YLSGTIP---SSLGSLSKLRDLKLWLNMLE----GEIPQELMYVKTLETLILDFNDLT--------------GEI  482 (768)
T ss_dssp             CSS--EEESCCC---GGGGGCTTCCEEECCSSCCC----SCCCGGGGGCTTCCEEECCSSCCC--------------SCC
T ss_pred             cCC--cccCccc---HHHhcCCCCCEEECCCCccc----CcCCHHHcCCCCceEEEecCCccc--------------CcC
Confidence            221  1111111   22333444444444432211    112233555667777777766532              223


Q ss_pred             hhcCCCCCCCcEEEEeecCCC-CCCcchhcccCCcEEEEcCCCCCCCCC-CCCCcc-ccceecccccCceEeCccccCCC
Q 036448          390 LKALQLPLSVEKLGIILYGGN-IFPKWLTSLTNLRNLYLRSCVKCEHLP-PLGKLP-LEKLVIIHLKSVKRVGNEFLGIE  466 (580)
Q Consensus       390 ~~~l~~~~~L~~L~l~~~~~~-~lp~~l~~l~~L~~L~L~~~~~l~~l~-~l~~l~-L~~L~l~~~~~l~~~~~~~~~~~  466 (580)
                      +..+..+++|+.|++++|... .+|.++..+++|++|++++|...+.+| .++.++ |+.|+++++.-...++..+....
T Consensus       483 p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~  562 (768)
T 3rgz_A          483 PSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQS  562 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTT
T ss_pred             CHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhccc
Confidence            455667788889999888886 678888888999999999887665555 367788 88888887653323332221110


Q ss_pred             CCC-------------------------------------------------------------------------CCCC
Q 036448          467 ESS-------------------------------------------------------------------------EDGP  473 (580)
Q Consensus       467 ~~~-------------------------------------------------------------------------~~~~  473 (580)
                      ...                                                                         ..+.
T Consensus       563 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N  642 (768)
T 3rgz_A          563 GKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYN  642 (768)
T ss_dssp             TCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSS
T ss_pred             chhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCC
Confidence            000                                                                         0000


Q ss_pred             CCC-CCCCccccCcccccccccccccccccccccccccccCCCCccceeeeccCCCCCCCCcCCCCCCCcceEEEecCcc
Q 036448          474 SSS-SSSPSVIAFPKLKSLIIGAMEELEEWNYRITRKENISIMPRLSSLEVRSCNKLKALPDYLLQTTTLQDLTIWKCAL  552 (580)
Q Consensus       474 ~~~-~~~~~~~~~~~L~~L~l~~~~~L~~~~~~~~~~~~~~~l~~L~~L~l~~c~~L~~lp~~~~~l~~L~~L~i~~c~~  552 (580)
                      ... ..+..++.+++|+.|+++++.      ..+..|..++.+++|+.|++++|...+.+|..+.++++|++|++++|+.
T Consensus       643 ~l~g~ip~~l~~l~~L~~L~Ls~N~------l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l  716 (768)
T 3rgz_A          643 MLSGYIPKEIGSMPYLFILNLGHND------ISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNL  716 (768)
T ss_dssp             CCBSCCCGGGGGCTTCCEEECCSSC------CCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEE
T ss_pred             cccccCCHHHhccccCCEEeCcCCc------cCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcc
Confidence            000 111233444445555444431      1234456788899999999999886668899888999999999998732


Q ss_pred             hH---------------------------HHhcCCCCCCccccccCCccc
Q 036448          553 LE---------------------------NRYREGKGEDWHKISHIPHIK  575 (580)
Q Consensus       553 l~---------------------------~~~~~~~~~~~~~i~~ip~~~  575 (580)
                      -.                           ..|....+++|++|+|+|.+.
T Consensus       717 ~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          717 SGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             EEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC--------------
T ss_pred             cccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCccccC
Confidence            10                           134556778899999998764
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 580
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 5e-09
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 55.2 bits (132), Expect = 5e-09
 Identities = 9/89 (10%), Positives = 21/89 (23%), Gaps = 8/89 (8%)

Query: 3   FLRRSFEDRENLE--PIGRKIAHKCKGLPLAAKVIGNLLRSKSTGKEWQRILESEMWKVE 60
                       +   +  K      G P    +           K ++++ +       
Sbjct: 194 LEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCE----PKTFEKMAQLNNKLES 249

Query: 61  EIGQGLLAPLLLSYNDLPSNSMVKQCFSY 89
               G+      SY  L     +++C   
Sbjct: 250 RGLVGVECITPYSYKSLAMA--LQRCVEV 276

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query580
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.7
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.63
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.61
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.61
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.58
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.54
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.5
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.48
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.48
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.42
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.42
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.39
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.36
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.34
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.31
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.27
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.26
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.23
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.21
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.09
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.06
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.0
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.97
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.83
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.63
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.53
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.4
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.38
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.08
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.45
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.35
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.01
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 93.4
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 92.56
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 88.97
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.78  E-value=4.2e-18  Score=168.82  Aligned_cols=302  Identities=17%  Similarity=0.162  Sum_probs=174.8

Q ss_pred             CCceEEEEEEecCCCcCcccccCCCcccEEEeccCCcccccccceeeecccccccccccchhhccCCCccEEeccCCccc
Q 036448          188 GDKVRHLGLNFQRGTSFPMSIRGLDRLRTLLIYDRSDFNLSLSSILSSFSSSKECIERLPKTLCELYNLQKLDIRRCRNL  267 (580)
Q Consensus       188 ~~~~~~L~l~~~~~~~~~~~~~~l~~Lr~L~l~~~~~l~l~~~~~~L~l~~~~~~i~~lp~~i~~L~~L~~L~L~~~~~l  267 (580)
                      ..+++.|++.++.+..+ ..+..+++|++|++++|+                   ++.+|. ++++++|++|++++|. +
T Consensus        43 l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~-------------------l~~l~~-l~~L~~L~~L~L~~n~-i  100 (384)
T d2omza2          43 LDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQ-------------------LTDITP-LKNLTKLVDILMNNNQ-I  100 (384)
T ss_dssp             HTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSC-------------------CCCCGG-GTTCTTCCEEECCSSC-C
T ss_pred             hCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCc-------------------CCCCcc-ccCCcccccccccccc-c
Confidence            35789999999999876 468889999999999886                   788875 9999999999999998 7


Q ss_pred             cccchhhhcccCCCeEEcCCCCCCccCcccCCCCCCCCcCCceeecCccC--------------CCCccChhhhhcCCcC
Q 036448          268 KELPAGIGKLKNMRSLLNGETDSLKYMPVGISKLTSLRTLDKFVVGGGVD--------------GSNTCRLESLKNLQLV  333 (580)
Q Consensus       268 ~~lp~~i~~l~~L~~L~l~~~~~~~~lp~~i~~L~~L~~L~~~~~~~~~~--------------~~~~~~l~~L~~L~~L  333 (580)
                      ..+++ ++++++|+.|+++++. ...++.. .....+..+..........              .........+...+..
T Consensus       101 ~~i~~-l~~l~~L~~L~~~~~~-~~~~~~~-~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  177 (384)
T d2omza2         101 ADITP-LANLTNLTGLTLFNNQ-ITDIDPL-KNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTL  177 (384)
T ss_dssp             CCCGG-GTTCTTCCEEECCSSC-CCCCGGG-TTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTC
T ss_pred             ccccc-cccccccccccccccc-ccccccc-cccccccccccccccccccccccccccccccccccccchhhhhcccccc
Confidence            77776 8999999999998883 3333322 2222222222111000000              0000011111111111


Q ss_pred             CceeEeCCCCCCChhHHHhcccccccccceeEEEeecccCCchhHHhhhhhhHHHHhhcCCCCCCCcEEEEeecCCCCCC
Q 036448          334 RECGIEGLGNVLYLDEVERLQLYNQQNLLRLRLEFGRVVDGEDEERRRKKEKDEQLLKALQLPLSVEKLGIILYGGNIFP  413 (580)
Q Consensus       334 ~~l~i~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~lp  413 (580)
                      .........      .........+++++.+.++.+.+...                .....+++|+.|++.++....+|
T Consensus       178 ~~~~~~~~~------~~~~~~~~~l~~~~~l~l~~n~i~~~----------------~~~~~~~~L~~L~l~~n~l~~~~  235 (384)
T d2omza2         178 ERLDISSNK------VSDISVLAKLTNLESLIATNNQISDI----------------TPLGILTNLDELSLNGNQLKDIG  235 (384)
T ss_dssp             CEEECCSSC------CCCCGGGGGCTTCSEEECCSSCCCCC----------------GGGGGCTTCCEEECCSSCCCCCG
T ss_pred             ccccccccc------cccccccccccccceeeccCCccCCC----------------CcccccCCCCEEECCCCCCCCcc
Confidence            111111000      00112244556677777666652211                11234567777777777766654


Q ss_pred             cchhcccCCcEEEEcCCCCCCCCCCCCCcc-ccceecccccCceEeCccccCCCCCC---CCCCCCCCCCCccccCcccc
Q 036448          414 KWLTSLTNLRNLYLRSCVKCEHLPPLGKLP-LEKLVIIHLKSVKRVGNEFLGIEESS---EDGPSSSSSSPSVIAFPKLK  489 (580)
Q Consensus       414 ~~l~~l~~L~~L~L~~~~~l~~l~~l~~l~-L~~L~l~~~~~l~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~L~  489 (580)
                       .+..+++|+.|++++|. +..++.++.++ |++|+++++. +..+.. +.......   .... .......+..+++++
T Consensus       236 -~l~~l~~L~~L~l~~n~-l~~~~~~~~~~~L~~L~l~~~~-l~~~~~-~~~~~~l~~l~~~~n-~l~~~~~~~~~~~l~  310 (384)
T d2omza2         236 -TLASLTNLTDLDLANNQ-ISNLAPLSGLTKLTELKLGANQ-ISNISP-LAGLTALTNLELNEN-QLEDISPISNLKNLT  310 (384)
T ss_dssp             -GGGGCTTCSEEECCSSC-CCCCGGGTTCTTCSEEECCSSC-CCCCGG-GTTCTTCSEEECCSS-CCSCCGGGGGCTTCS
T ss_pred             -hhhcccccchhccccCc-cCCCCcccccccCCEeeccCcc-cCCCCc-ccccccccccccccc-ccccccccchhcccC
Confidence             56677777777777773 45555666777 7777776543 221110 10100000   0000 001122355677788


Q ss_pred             cccccccccccccccccccccccCCCCccceeeeccCCCCCCCCcCCCCCCCcceEEEecCc
Q 036448          490 SLIIGAMEELEEWNYRITRKENISIMPRLSSLEVRSCNKLKALPDYLLQTTTLQDLTIWKCA  551 (580)
Q Consensus       490 ~L~l~~~~~L~~~~~~~~~~~~~~~l~~L~~L~l~~c~~L~~lp~~~~~l~~L~~L~i~~c~  551 (580)
                      .|+++++ +++.+.       .+..+|+|++|++++|. ++.+| .+..+++|++|++++|.
T Consensus       311 ~L~ls~n-~l~~l~-------~l~~l~~L~~L~L~~n~-l~~l~-~l~~l~~L~~L~l~~N~  362 (384)
T d2omza2         311 YLTLYFN-NISDIS-------PVSSLTKLQRLFFANNK-VSDVS-SLANLTNINWLSAGHNQ  362 (384)
T ss_dssp             EEECCSS-CCSCCG-------GGGGCTTCCEEECCSSC-CCCCG-GGGGCTTCCEEECCSSC
T ss_pred             eEECCCC-CCCCCc-------ccccCCCCCEEECCCCC-CCCCh-hHcCCCCCCEEECCCCc
Confidence            8877765 344332       25578888888888875 77776 46678888888888774
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure