Citrus Sinensis ID: 036523

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------

MHALSSSSSSAPHPHEQLAPCFSHFKESCSHPQTFNGVCLSCAQTVGEGYGLSFNYMLEGLEFGKDEVTRLKRMNSEIVFGQRKLQLVLDLDHTLLHATDLDMLAPDDRDYLMKRESSASDGGGLFMMDGGLLLVKLRPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKNLDLVLGQERGVVIVDDTAEVWKDHKENLILVGKYNYFKERIRKSKNNDQKSYSERKSDESELNGALVNVLRVLKRVHELFFENPENLVWGDVRSFLAKIRRQILAGCTLFFNMGDVGPQEFPLLRRRAEELGAACTDVHDSSVTHVVSTRQATEGRRLAEQHNNFLVHPRWIYAAYYLWSRQAENDYFPL

ccccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEccccccccHHHHHHHHHHcHHHHHccccEEEEEEccccEEEEEcccccccccccccccccccccccccEEEcccEEEEEEEcccHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHccccccccccEEEEEcccccccccccccccccccEEEEEEccHHHHHcccccEEEEccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHcccEEEcccccccEEEEEccccHHHHHHHHHccccEEcHHHHHHHHHHcccccccccccc

ccEEEEccccccccccEEcccEEEEEccccccEEEccEEEEccccccccccEEEEEcccccEEcHHHHHHHcHHHHHHHHHcccEEEEEEccHEEEEccccccccHHHcccccccccccccccccEccccccEEEEccccHHHHHHHHHHHHHEEEHHHcHHHHHHHHHHHHcccccEEcccEEEEccccccccccccccccccccEEEEEEccccccHcccccEEEEEEEEEEccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHcccEEEccccccEEEEEEccccHHHHHHHHHcccEEEcHHHHHHHHHHHHcccccccccc

mhalssssssaphpheqlapcfshfkescshpqtfngvCLSCAQtvgegyglSFNYMLEGLEFGKDEVTRLKRMNSEIVFGQRKLQLVLDLDHtllhatdldmlapddrdylmkressasdggglfmmdgglllVKLRPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKNLDLVLGQERGVVIVDDTAEVWKDHKENLILVGKYNYFKERIRKSknndqksyserksdeseLNGALVNVLRVLKRVHELffenpenlvwgDVRSFLAKIRRQILAGCTlffnmgdvgpqefPLLRRRAEELGAActdvhdssvthvVSTRQATEGRRLAEQHNNFLVHPRWIYAAYYLWSrqaendyfpl

mhalssssssaphphEQLAPCFSHFKESCSHPQTFNGVCLSCAQTVGEGYGLSFNYMLEGLEFGKDEVTRLKRMNSEIVFGQRKLQLVLDLDHTLLhatdldmlapddrDYLMKREssasdggglFMMDGGLLLVKLRPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKNLdlvlgqergvvivddtaevwkdhkenlilvgkynyfkerirksknndqksyserksdeselngALVNVLRVLKRVHElffenpenlvwgDVRSFLAKIRRQILAGCTLFFNMGDVGPQEFPLLRRRAEELGAActdvhdssvthvvstrqategrrlAEQHNNFLVHPRWIYAAYYLWSRQAENDYFPL

MHALssssssAPHPHEQLAPCFSHFKESCSHPQTFNGVCLSCAQTVGEGYGLSFNYMLEGLEFGKDEVTRLKRMNSEIVFGQRKlqlvldldhtllhatdldmlaPDDRDYLMKRESSASdggglfmmdgglllVKLRPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKNLDLVLGQERGVVIVDDTAEVWKDHKENLILVGKYNYFKERIRKSKNNDQKSYSERKSDESELNGALVNVLRVLKRVHELFFENPENLVWGDVRSFLAKIRRQILAGCTLFFNMGDVGPQEFPLLRRRAEELGAACtdvhdssvthvvstRQATEGRRLAEQHNNFLVHPRWIYAAYYLWSRQAENDYFPL

********************CFSHFKESCSHPQTFNGVCLSCAQTVGEGYGLSFNYMLEGLEFGKDEVTRLKRMNSEIVFGQRKLQLVLDLDHTLLHATDLDMLAPD***Y***********GGLFMMDGGLLLVKLRPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKNLDLVLGQERGVVIVDDTAEVWKDHKENLILVGKYNYFKER***********************GALVNVLRVLKRVHELFFENPENLVWGDVRSFLAKIRRQILAGCTLFFNMGDVGPQEFPLLRRRAEELGAACTDVHDSSVTHVVSTR*****RRLAEQHNNFLVHPRWIYAAYYLWSRQ********

**********************SHFKESCSHPQTFNGVCLSCAQTVGEGYGLSFNYML***************************QLVLDLDHTLLHATDLDMLAPDDRDYLMKRESSASDGGGLFMMDGGLLLVKLRPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKNLDLVLGQERGVVIVDDTAEVWKDHKENLILVGKYNYFKERIRKSKNNDQK*YSERKSDESELNGALVNVLRVLKRVHELFFENPENLVWGDVRSFLAKIRRQILAGCTLFFNMGDVGPQEFPLLRRRAEELGAACTDVHDSSVTHVVSTRQATEGRRLAEQHNNFLVHPRWIYAAYYLWSRQAENDYFPL

***************EQLAPCFSHFKESCSHPQTFNGVCLSCAQTVGEGYGLSFNYMLEGLEFGKDEVTRLKRMNSEIVFGQRKLQLVLDLDHTLLHATDLDMLAPDDRDYLMKRESSASDGGGLFMMDGGLLLVKLRPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKNLDLVLGQERGVVIVDDTAEVWKDHKENLILVGKYNYFKERIRKS*****************LNGALVNVLRVLKRVHELFFENPENLVWGDVRSFLAKIRRQILAGCTLFFNMGDVGPQEFPLLRRRAEELGAACTDVHDSSVTHVVSTRQATEGRRLAEQHNNFLVHPRWIYAAYYLWSRQAENDYFPL

*HALSSSSSSAPHPHEQLAPCFSHFKESCSHPQTFNGVCLSCAQTVGEGYGLSFNYMLEGLEFGKDEVTRLKRMNSEIVFGQRKLQLVLDLDHTLLHATDLDMLAPDDRDYL****SSASDGGGLFMMDGGLLLVKLRPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKNLDLVLGQERGVVIVDDTAEVWKDHKENLILVGKYNYFKERIRKSK**************SELNGALVNVLRVLKRVHELFFENPENLVWGDVRSFLAKIRRQILAGCTLFFNMGDVGPQEFPLLRRRAEELGAACTDVHDSSVTHVVSTRQATEGRRLAEQHNNFLVHPRWIYAAYYLWSRQAENDYFPL

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		387	2.2.26 [Sep-21-2011]
Q00IB6		440	RNA polymerase II C-termi	yes	no	0.922	0.811	0.444	2e-78
Q8LL04		1241	RNA polymerase II C-termi	no	no	0.829	0.258	0.357	8e-44
Q8SV03		411	RNA polymerase II subunit	yes	no	0.596	0.562	0.292	3e-20
Q7TSG2		960	RNA polymerase II subunit	yes	no	0.493	0.198	0.301	6e-18
Q9Y5B0		961	RNA polymerase II subunit	yes	no	0.496	0.199	0.3	1e-17
Q9P376		723	RNA polymerase II subunit	yes	no	0.550	0.294	0.263	1e-17
Q03254		732	RNA polymerase II subunit	yes	no	0.542	0.286	0.266	4e-14
Q05D32		466	CTD small phosphatase-lik	no	no	0.315	0.261	0.277	2e-05
Q5XIK8		465	CTD small phosphatase-lik	no	no	0.341	0.283	0.272	2e-05
Q8BG15		465	CTD small phosphatase-lik	no	no	0.341	0.283	0.272	2e-05

>sp\|Q00IB6\|CPL4_ARATH RNA polymerase II C-terminal domain phosphatase-like 4 OS=Arabidopsis thaliana GN=CPL4 PE=1 SV=1	Back alignment and function desciption

 Score =  293 bits (749), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 234/371 (63%), Gaps = 14/371 (3%)

Query: 23  SHFKESCSHPQTFNGVCLSCAQTVGEGYGLSFNYMLEGLEFGKDEVTRLKRMNSEIVFGQ 82
           S  K  C HP +F  +C  C Q + E  G+SF Y+ + +   +DE++RL+  +S  +  Q
Sbjct: 62  SSSKGECEHPGSFGNMCFVCGQKLEET-GVSFRYIHKEMRLNEDEISRLRDSDSRFLQRQ 120

Query: 83  RKLQLVLDLDHTLLHATDLDMLAPDDRDYLMKRESSASDG-----GGLFMMDGGLLLVKL 137
           RKL LVLDLDHTLL+ T L  L P++ +YL     S  DG     G LF+++   ++ KL
Sbjct: 121 RKLYLVLDLDHTLLNTTILRDLKPEE-EYLKSHTHSLQDGCNVSGGSLFLLEFMQMMTKL 179

Query: 138 RPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKN 197
           RP++ SFLKEA +M+ +YI TMG+R+YA  +AKLLDPK EY+   R+I+ +D     +K+
Sbjct: 180 RPFVHSFLKEASEMFVMYIYTMGDRNYARQMAKLLDPKGEYF-GDRVISRDDGTVRHEKS 238

Query: 198 LDLVLGQERGVVIVDDTAEVWKDHKENLILVGKYNYFKERIRKSKNNDQKSYSERKSDES 257
           LD+VLGQE  V+I+DDT   W  HK+NLI++ +Y++F    R+  ++  KS SE KSDES
Sbjct: 239 LDVVLGQESAVLILDDTENAWPKHKDNLIVIERYHFFSSSCRQF-DHRYKSLSELKSDES 297

Query: 258 ELNGALVNVLRVLKRVHELFFEN-PENLVWGDVRSFLAKIRRQILAGCTLFFNM---GDV 313
           E +GAL  VL+VLK+ H LFFEN  E +   DVR  L ++R++IL GC + F+       
Sbjct: 298 EPDGALATVLKVLKQAHALFFENVDEGISNRDVRLMLKQVRKEILKGCKIVFSRVFPTKA 357

Query: 314 GPQEFPLLRRRAEELGAACTDVHDSSVTHVVSTRQATEGRRLAEQHNNFLVHPRWIYAAY 373
            P++ PL  + AEELGA C    D+SVTHVV+    TE  R A +   ++VH  WI AA 
Sbjct: 358 KPEDHPLW-KMAEELGATCATEVDASVTHVVAMDVGTEKARWAVREKKYVVHRGWIDAAN 416

Query: 374 YLWSRQAENDY 384
           YLW +Q E ++
Sbjct: 417 YLWMKQPEENF 427

Processively dephosphorylates 'Ser-2' and/or 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1). This promotes the activity of RNA polymerase II (By similarity). Required for normal plant growth.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6

>sp\|Q8LL04\|CPL3_ARATH RNA polymerase II C-terminal domain phosphatase-like 3 OS=Arabidopsis thaliana GN=CPL3 PE=1 SV=2	Back alignment and function description

>sp\|Q8SV03\|FCP1_ENCCU RNA polymerase II subunit A C-terminal domain phosphatase OS=Encephalitozoon cuniculi (strain GB-M1) GN=FCP1 PE=1 SV=1	Back alignment and function description

>sp\|Q7TSG2\|CTDP1_MOUSE RNA polymerase II subunit A C-terminal domain phosphatase OS=Mus musculus GN=Ctdp1 PE=1 SV=1	Back alignment and function description

>sp\|Q9Y5B0\|CTDP1_HUMAN RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens GN=CTDP1 PE=1 SV=3	Back alignment and function description

>sp\|Q9P376\|FCP1_SCHPO RNA polymerase II subunit A C-terminal domain phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fcp1 PE=1 SV=1	Back alignment and function description

>sp\|Q03254\|FCP1_YEAST RNA polymerase II subunit A C-terminal domain phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FCP1 PE=1 SV=1	Back alignment and function description

>sp\|Q05D32\|CTSL2_HUMAN CTD small phosphatase-like protein 2 OS=Homo sapiens GN=CTDSPL2 PE=1 SV=2	Back alignment and function description

>sp\|Q5XIK8\|CTSL2_RAT CTD small phosphatase-like protein 2 OS=Rattus norvegicus GN=Ctdspl2 PE=2 SV=1	Back alignment and function description

>sp\|Q8BG15\|CTSL2_MOUSE CTD small phosphatase-like protein 2 OS=Mus musculus GN=Ctdspl2 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		387
255570505		478	RNA polymerase II ctd phosphatase, putat	0.922	0.746	0.439	2e-79
356564913		442	PREDICTED: RNA polymerase II C-terminal	0.909	0.796	0.425	1e-77
9758369		1065	unnamed protein product [Arabidopsis tha	0.922	0.335	0.444	6e-77
449447765		452	PREDICTED: RNA polymerase II C-terminal	0.906	0.776	0.440	7e-77
145334837		440	RNA polymerase II C-terminal domain phos	0.922	0.811	0.444	1e-76
356498756		428	PREDICTED: RNA polymerase II C-terminal	0.909	0.822	0.423	5e-76
242093742		558	hypothetical protein SORBIDRAFT_10g02558	0.922	0.639	0.420	9e-72
297793317		1006	hypothetical protein ARALYDRAFT_332090 [	0.888	0.341	0.412	6e-70
326518250		488	predicted protein [Hordeum vulgare subsp	0.966	0.766	0.4	1e-69
413945235		533	CPL3 [Zea mays]	0.922	0.669	0.411	3e-69

>gi\|255570505\|ref\|XP_002526210.1\| RNA polymerase II ctd phosphatase, putative [Ricinus communis] gi\|223534449\|gb\|EEF36151.1\| RNA polymerase II ctd phosphatase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  302 bits (773), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 162/369 (43%), Positives = 239/369 (64%), Gaps = 12/369 (3%)

Query: 23  SHFKESCSHPQTFNGVCLSCAQTVGEGYGLSFNYMLEGLEFGKDEVTRLKRMNSEIVFGQ 82
           S  K +C+HP +F  +C+ C + + E  G++F Y+ +GL    DE+ RL+  + + +   
Sbjct: 105 SSSKVACTHPGSFGDMCILCGERLIEETGVTFGYIHKGLRLANDEIVRLRNTDMKNLLRH 164

Query: 83  RKLQLVLDLDHTLLHATDLDMLAPDDRDYLMKRESSASD--GGGLFMMDGGLLLVKLRPY 140
           RKL LVLDLDHTLL++T L  L  ++ +YL  +  S  D   G LFM+D   ++ KLRP+
Sbjct: 165 RKLYLVLDLDHTLLNSTQLMHLTAEE-EYLKSQIDSMQDVSNGSLFMVDFMHMMTKLRPF 223

Query: 141 IRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKNLDL 200
           IR+FLKEA +M+++YI TMG+R YA  +AK LDP  EY+ ++R+I+ +D     +K LD+
Sbjct: 224 IRTFLKEASQMFEMYIYTMGDRAYALEMAKFLDPGREYF-NARVISRDDGTQRHQKGLDI 282

Query: 201 VLGQERGVVIVDDTAEVWKDHKENLILVGKYNYFKERIRKSKNNDQKSYSERKSDESELN 260
           VLGQE  V+I+DDT   W  HK+NLIL+ +Y++F    R+    + KS S+ KSDE+E +
Sbjct: 283 VLGQESAVLILDDTENAWTKHKDNLILMERYHFFASSCRQF-GFECKSLSQLKSDENESD 341

Query: 261 GALVNVLRVLKRVHELFFENPENLVWG-DVRSFLAKIRRQILAGCTLFFNMGDVGPQEFP 319
           GAL +VL+VL+R+H +FF+  E+ + G DVR  L+ +R+ +L GC + F+   V P +F 
Sbjct: 342 GALASVLKVLRRIHHIFFDELEDAIDGRDVRQVLSTVRKDVLKGCKIVFSR--VFPTQFQ 399

Query: 320 L----LRRRAEELGAACTDVHDSSVTHVVSTRQATEGRRLAEQHNNFLVHPRWIYAAYYL 375
                L + AE+LGA C+   D SVTHVVS    TE  R A +++ FLVHPRWI A  Y+
Sbjct: 400 ADNHHLWKMAEQLGATCSREVDPSVTHVVSAEAGTEKSRWALKNDKFLVHPRWIEATNYM 459

Query: 376 WSRQAENDY 384
           W RQ E ++
Sbjct: 460 WQRQPEENF 468

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356564913\|ref\|XP_003550691.1\| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Glycine max]	Back alignment and taxonomy information

>gi\|9758369\|dbj\|BAB08870.1\| unnamed protein product [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|449447765\|ref\|XP_004141638.1\| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|145334837|ref|NP_001078764.1| RNA polymerase II C-terminal domain phosphatase-like 4 [Arabidopsis thaliana] gi|122154038|sp|Q00IB6.1|CPL4_ARATH RecName: Full=RNA polymerase II C-terminal domain phosphatase-like 4; Short=FCP-like 4; AltName: Full=Carboxyl-terminal phosphatase-like 4; Short=AtCPL4; Short=CTD phosphatase-like 4 gi|95115186|gb|ABF55959.1| carboxyl-terminal phosphatase-like 4 [Arabidopsis thaliana] gi|332009601|gb|AED96984.1| RNA polymerase II C-terminal domain phosphatase-like 4 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|356498756\|ref\|XP_003518215.1\| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 4-like [Glycine max]	Back alignment and taxonomy information

>gi\|242093742\|ref\|XP_002437361.1\| hypothetical protein SORBIDRAFT_10g025580 [Sorghum bicolor] gi\|241915584\|gb\|EER88728.1\| hypothetical protein SORBIDRAFT_10g025580 [Sorghum bicolor]	Back alignment and taxonomy information

>gi\|297793317\|ref\|XP_002864543.1\| hypothetical protein ARALYDRAFT_332090 [Arabidopsis lyrata subsp. lyrata] gi\|297310378\|gb\|EFH40802.1\| hypothetical protein ARALYDRAFT_332090 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|326518250\|dbj\|BAK07377.1\| predicted protein [Hordeum vulgare subsp. vulgare]	Back alignment and taxonomy information

>gi\|413945235\|gb\|AFW77884.1\| CPL3 [Zea mays]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		387
TAIR\|locus:4010714056		440	CPL4 "C-terminal domain phosph	0.922	0.811	0.374	1.2e-58
TAIR\|locus:4515103095		307	AT3G19595 [Arabidopsis thalian	0.674	0.850	0.363	1.6e-40
TAIR\|locus:2090467		296	AT3G17550 [Arabidopsis thalian	0.697	0.912	0.354	2.6e-40
TAIR\|locus:2162565		306	AT5G54210 [Arabidopsis thalian	0.687	0.869	0.369	3.3e-40
TAIR\|locus:2012943		342	AT1G20320 [Arabidopsis thalian	0.653	0.739	0.365	9.9e-39
TAIR\|locus:2045044		277	AT2G04930 [Arabidopsis thalian	0.661	0.924	0.361	7e-38
TAIR\|locus:2051164		1241	CPL3 "C-terminal domain phosph	0.633	0.197	0.367	7.2e-32
TAIR\|locus:2154458		302	AT5G23470 [Arabidopsis thalian	0.671	0.860	0.309	7.7e-32
TAIR\|locus:2056256		302	AT2G02290 [Arabidopsis thalian	0.669	0.857	0.305	2.7e-29
TAIR\|locus:2194656		221	AT1G43600 [Arabidopsis thalian	0.374	0.656	0.435	3.2e-26

TAIR\|locus:4010714056 CPL4 "C-terminal domain phosphatase-like 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 602 (217.0 bits), Expect = 1.2e-58, P = 1.2e-58
 Identities = 139/371 (37%), Positives = 199/371 (53%)

Query:    23 SHFKESCSHPQTFNGVCLSCAQTVGEGYGLSFNYMLEGLEFGKDEVTRLKRMNSEIVFGQ 82
             S  K  C HP +F  +C  C Q + E  G+SF Y+ + +   +DE++RL+  +S  +  Q
Sbjct:    62 SSSKGECEHPGSFGNMCFVCGQKLEET-GVSFRYIHKEMRLNEDEISRLRDSDSRFLQRQ 120

Query:    83 RKXXXXXXXXXXXXXXXXXXXXXPDDRDYLMKRESSAS-----XXXXXXXXXXXXXXVKL 137
             RK                     P++ +YL     S                      KL
Sbjct:   121 RKLYLVLDLDHTLLNTTILRDLKPEE-EYLKSHTHSLQDGCNVSGGSLFLLEFMQMMTKL 179

Query:   138 RPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKN 197
             RP++ SFLKEA +M+ +YI TMG+R+YA  +AKLLDPK EY+   R+I+ +D     +K+
Sbjct:   180 RPFVHSFLKEASEMFVMYIYTMGDRNYARQMAKLLDPKGEYF-GDRVISRDDGTVRHEKS 238

Query:   198 LDLVLGQERGVVIVDDTAEVWKDHKENLILVGKYNYFKERIRKSKNNDQKSYSERKSDES 257
             LD+VLGQE  V+I+DDT   W  HK+NLI++ +Y++F    R+  +   KS SE KSDES
Sbjct:   239 LDVVLGQESAVLILDDTENAWPKHKDNLIVIERYHFFSSSCRQFDHR-YKSLSELKSDES 297

Query:   258 ELNGALVNVLRVLKRVHELFFEN-PENLVWGDVRSFLAKIRRQILAGCTLFFNM---GDV 313
             E +GAL  VL+VLK+ H LFFEN  E +   DVR  L ++R++IL GC + F+       
Sbjct:   298 EPDGALATVLKVLKQAHALFFENVDEGISNRDVRLMLKQVRKEILKGCKIVFSRVFPTKA 357

Query:   314 GPQEFPLLRRRAEELGAACXXXXXXXXXXXXXXRQATEGRRLAEQHNNFLVHPRWIYAAY 373
              P++ PL +  AEELGA C                 TE  R A +   ++VH  WI AA 
Sbjct:   358 KPEDHPLWKM-AEELGATCATEVDASVTHVVAMDVGTEKARWAVREKKYVVHRGWIDAAN 416

Query:   374 YLWSRQAENDY 384
             YLW +Q E ++
Sbjct:   417 YLWMKQPEENF 427

GO:0004721 "phosphoprotein phosphatase activity" evidence=IEA

GO:0005622 "intracellular" evidence=IEA

GO:0005634 "nucleus" evidence=ISM;IEA;IDA

GO:0008022 "protein C-terminus binding" evidence=IPI

GO:0009651 "response to salt stress" evidence=IEP

TAIR\|locus:4515103095 AT3G19595 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2090467 AT3G17550 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2162565 AT5G54210 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2012943 AT1G20320 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2045044 AT2G04930 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2051164 CPL3 "C-terminal domain phosphatase-like 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2154458 AT5G23470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2056256 AT2G02290 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2194656 AT1G43600 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q00IB6	CPL4_ARATH	3, ., 1, ., 3, ., 1, 6	0.4447	0.9224	0.8113	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.1.3.16	0.824
3rd Layer	3.1.3	0.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	CPL4	CPL4 (C-TERMINAL DOMAIN PHOSPHATASE-LIKE 4); phosphoprotein phosphatase; Encodes a polypeptide that contains FCPH and BRCT domains. RNAi suppression mutant lines were generated, which displayed a range of phenotypic abnormalities, including- incomplete to no cotyledon expansion, slow growth, epinastic leaves or small inflorescences. ; Processively dephosphorylates 'Ser-2' and/or 'Ser-5' of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1). This promotes the activity of RNA polymerase II (By similarity). Required for normal plant growth (440 aa)
		(Arabidopsis thaliana)
Predicted Functional Partners:
	RAP74	transcription initiation factor IIF alpha subunit (TFIIF-alpha) family protein; RAP74; FUNCTION [...] (649 aa)	•	•	•		0.999
	AT5G58000	unknown protein; LOCATED IN- endoplasmic reticulum, chloroplast; CONTAINS InterPro DOMAIN/s- Re [...] (487 aa)			•		0.919
	AT2G33540.1-P	CPL3 (C-TERMINAL DOMAIN PHOSPHATASE-LIKE 3); CTD phosphatase/ phosphoprotein phosphatase; C-TER [...] (1241 aa)		•	•	•	0.911
	AT2G02290	NLI interacting factor (NIF) family protein; NLI interacting factor (NIF) family protein; FUNCT [...] (302 aa)		•	•	•	0.907
	AT5G23470	NLI interacting factor (NIF) family protein; NLI interacting factor (NIF) family protein; FUNCT [...] (302 aa)		•	•	•	0.907
	SPT42	SPT42 (SPT4 HOMOLOG 2); positive transcription elongation factor/ zinc ion binding; SPT4 HOMOLO [...] (116 aa)		•			0.899
	NRPB7	NRPB7; DNA-directed RNA polymerase/ RNA binding; Non-catalytic subunit specific to DNA-directed [...] (176 aa)		•			0.899
	RPB5C	RPB5C (RNA POLYMERASE II FIFTH LARGEST SUBUNIT, C); DNA binding / DNA-directed RNA polymerase; [...] (210 aa)		•			0.899
	AT5G54210	NLI interacting factor (NIF) family protein; NLI interacting factor (NIF) family protein; FUNCT [...] (306 aa)		•		•	0.899
	CBP20	CBP20 (CAP-BINDING PROTEIN 20); RNA binding / RNA cap binding; Encodes a nuclear cap-binding pr [...] (257 aa)		•			0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		387
TIGR02250		156	TIGR02250, FCP1_euk, FCP1-like phosphatase, phosph	2e-53
smart00577		148	smart00577, CPDc, catalytic domain of ctd-like pho	5e-40
pfam03031		153	pfam03031, NIF, NLI interacting factor-like phosph	2e-25
TIGR02251		162	TIGR02251, HIF-SF_euk, Dullard-like phosphatase do	1e-12
pfam00533		77	pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain	8e-06
cd00027		72	cd00027, BRCT, Breast Cancer Suppressor Protein (B	7e-05
smart00292		78	smart00292, BRCT, breast cancer carboxy-terminal d	5e-04
COG5190		390	COG5190, FCP1, TFIIF-interacting CTD phosphatases,	6e-04

>gnl\|CDD\|131304 TIGR02250, FCP1_euk, FCP1-like phosphatase, phosphatase domain	Back alignment and domain information

 Score =  174 bits (443), Expect = 2e-53
 Identities = 62/157 (39%), Positives = 91/157 (57%), Gaps = 2/157 (1%)

Query: 79  VFGQRKLQLVLDLDHTLLHATDLDMLAPDDRDYLMKRESSASDGGGLFMMDGGLLLVKLR 138
           +  ++KL LVLDLD TL+H T    L+  ++  + +  S        F +     L KLR
Sbjct: 1   LLREKKLHLVLDLDQTLIHTTKDPTLSEWEKYDIEEPNSETRRDLRKFNLGTMWYLTKLR 60

Query: 139 PYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKNL 198
           P++  FLKEA K+Y++++ TMG R YA+ IAKL+DP  +Y+   R+I+ ++      K+L
Sbjct: 61  PFLHEFLKEASKLYEMHVYTMGTRAYAQAIAKLIDPDGKYF-GDRIISRDESGSPHTKSL 119

Query: 199 -DLVLGQERGVVIVDDTAEVWKDHKENLILVGKYNYF 234
             L    E  VVI+DD  +VW  HK NLI +  YNYF
Sbjct: 120 LRLFPADESMVVIIDDREDVWPWHKRNLIQIEPYNYF 156

This model represents the phosphatase domain of the humanRNA polymerase II subunit A C-terminal domain phosphatase (FCP1, ) and closely related phosphatases from eukaryotes including plants, fungi and slime mold. This domain is a member of the haloacid dehalogenase (HAD) superfamily by virtue of a conserved set of three catalytic motifs and a conserved fold as predicted by PSIPRED. The third motif in this family is distinctive (hhhhDDppphW). This domain is classified as a "Class III" HAD, since there is no large "cap" domain found between motifs 1 and 2 or motifs 2 and 3.This domain is related to domains found in the human NLI interacting factor-like phosphatases, and together both are detected by the pfam03031. Length = 156

>gnl\|CDD\|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases	Back alignment and domain information

>gnl\|CDD\|217328 pfam03031, NIF, NLI interacting factor-like phosphatase	Back alignment and domain information

>gnl\|CDD\|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain	Back alignment and domain information

>gnl\|CDD\|215978 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain	Back alignment and domain information

>gnl\|CDD\|237994 cd00027, BRCT, Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain	Back alignment and domain information

>gnl\|CDD\|214602 smart00292, BRCT, breast cancer carboxy-terminal domain	Back alignment and domain information

>gnl\|CDD\|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		387
KOG0323		635	consensus TFIIF-interacting CTD phosphatases, incl	100.0
TIGR02250		156	FCP1_euk FCP1-like phosphatase, phosphatase domain	100.0
KOG1605		262	consensus TFIIF-interacting CTD phosphatase, inclu	100.0
TIGR02251		162	HIF-SF_euk Dullard-like phosphatase domain. This d	100.0
PF03031		159	NIF: NLI interacting factor-like phosphatase; Inte	100.0
TIGR02245		195	HAD_IIID1 HAD-superfamily subfamily IIID hydrolase	99.96
smart00577		148	CPDc catalytic domain of ctd-like phosphatases.	99.91
KOG2832		393	consensus TFIIF-interacting CTD phosphatase, inclu	99.91
COG5190		390	FCP1 TFIIF-interacting CTD phosphatases, including	99.82
COG5190		390	FCP1 TFIIF-interacting CTD phosphatases, including	99.81
PF12738		63	PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2W	99.53
PF00533		78	BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP	99.51
smart00292		80	BRCT breast cancer carboxy-terminal domain.	99.35
cd00027		72	BRCT Breast Cancer Suppressor Protein (BRCA1), car	99.34
KOG3226		508	consensus DNA repair protein [Replication, recombi	99.32
PLN03122		815	Poly [ADP-ribose] polymerase; Provisional	98.82
PLN03123		981	poly [ADP-ribose] polymerase; Provisional	98.74
PRK14350		669	ligA NAD-dependent DNA ligase LigA; Provisional	98.42
PRK07956		665	ligA NAD-dependent DNA ligase LigA; Validated	98.31
COG0272		667	Lig NAD-dependent DNA ligase (contains BRCT domain	98.29
PRK14351		689	ligA NAD-dependent DNA ligase LigA; Provisional	98.28
TIGR01993		184	Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These	98.26
TIGR01685		174	MDP-1 magnesium-dependent phosphatase-1. This mode	98.22
TIGR01681		128	HAD-SF-IIIC HAD-superfamily phosphatase, subfamily	98.2
PRK06063		313	DNA polymerase III subunit epsilon; Provisional	98.15
PRK13288		214	pyrophosphatase PpaX; Provisional	98.15
PLN03243		260	haloacid dehalogenase-like hydrolase; Provisional	98.14
TIGR01684		301	viral_ppase viral phosphatase. These proteins also	98.11
PHA03398		303	viral phosphatase superfamily protein; Provisional	98.11
PRK06195		309	DNA polymerase III subunit epsilon; Validated	98.05
PRK13226		229	phosphoglycolate phosphatase; Provisional	98.0
PLN02575		381	haloacid dehalogenase-like hydrolase	97.99
TIGR00575		652	dnlj DNA ligase, NAD-dependent. The member of this	97.99
cd01427		139	HAD_like Haloacid dehalogenase-like hydrolases. Th	97.98
COG5275		276	BRCT domain type II [General function prediction o	97.93
PRK13225		273	phosphoglycolate phosphatase; Provisional	97.9
KOG3524		850	consensus Predicted guanine nucleotide exchange fa	97.87
TIGR01662		132	HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I	97.87
TIGR01656		147	Histidinol-ppas histidinol-phosphate phosphatase f	97.86
KOG1929		811	consensus Nucleotide excision repair factor NEF2,	97.85
KOG1929		811	consensus Nucleotide excision repair factor NEF2,	97.84
PHA02530		300	pseT polynucleotide kinase; Provisional	97.82
TIGR01672		237	AphA HAD superfamily (subfamily IIIB) phosphatase,	97.82
PHA02597		197	30.2 hypothetical protein; Provisional	97.76
TIGR01686		320	FkbH FkbH-like domain. The C-terminal portion of t	97.76
TIGR01261		161	hisB_Nterm histidinol-phosphatase. This model desc	97.73
TIGR01664		166	DNA-3'-Pase DNA 3'-phosphatase. The central phosph	97.69
KOG0966		881	consensus ATP-dependent DNA ligase IV [Replication	97.62
PRK08942		181	D,D-heptose 1,7-bisphosphate phosphatase; Validate	97.61
PF05152		297	DUF705: Protein of unknown function (DUF705); Inte	97.59
KOG4362		684	consensus Transcriptional regulator BRCA1 [Replica	97.58
COG0637		221	Predicted phosphatase/phosphohexomutase [General f	97.57
TIGR00213		176	GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	97.57
TIGR00338		219	serB phosphoserine phosphatase SerB. Phosphoserine	97.53
KOG2043		896	consensus Signaling protein SWIFT and related BRCT	97.49
KOG2481		570	consensus Protein required for normal rRNA process	97.47
COG4996		164	Predicted phosphatase [General function prediction	97.46
TIGR01489		188	DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent	97.45
PRK11009		237	aphA acid phosphatase/phosphotransferase; Provisio	97.4
PRK08238		479	hypothetical protein; Validated	97.35
PF13419		176	HAD_2: Haloacid dehalogenase-like hydrolase; PDB:	97.34
PRK09552		219	mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp	97.29
TIGR02253		221	CTE7 HAD superfamily (subfamily IA) hydrolase, TIG	97.18
PF12689		169	Acid_PPase: Acid Phosphatase; InterPro: IPR010036	97.15
KOG3109		244	consensus Haloacid dehalogenase-like hydrolase [Ge	97.12
PLN02770		248	haloacid dehalogenase-like hydrolase family protei	97.07
TIGR01449		213	PGP_bact 2-phosphoglycolate phosphatase, prokaryot	97.05
TIGR01454		205	AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes	97.03
COG0546		220	Gph Predicted phosphatases [General function predi	97.03
TIGR01533		266	lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil	96.99
TIGR01428		198	HAD_type_II 2-haloalkanoic acid dehalogenase, type	96.98
TIGR01509		183	HAD-SF-IA-v3 haloacid dehalogenase superfamily, su	96.98
TIGR02254		224	YjjG/YfnB HAD superfamily (subfamily IA) hydrolase	96.98
PRK06769		173	hypothetical protein; Validated	96.94
KOG3548		1176	consensus DNA damage checkpoint protein RHP9/CRB2/	96.82
PRK09449		224	dUMP phosphatase; Provisional	96.8
COG5163		591	NOP7 Protein required for biogenesis of the 60S ri	96.8
TIGR01668		170	YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph	96.74
PRK14988		224	GMP/IMP nucleotidase; Provisional	96.74
PRK10826		222	2-deoxyglucose-6-phosphatase; Provisional	96.66
PRK10563		221	6-phosphogluconate phosphatase; Provisional	96.65
TIGR01422		253	phosphonatase phosphonoacetaldehyde hydrolase. Thi	96.61
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	96.6
PRK10725		188	fructose-1-P/6-phosphogluconate phosphatase; Provi	96.57
PLN02954		224	phosphoserine phosphatase	96.55
PRK05446		354	imidazole glycerol-phosphate dehydratase/histidino	96.45
PRK13222		226	phosphoglycolate phosphatase; Provisional	96.36
PRK09456		199	?-D-glucose-1-phosphatase; Provisional	96.36
COG2179		175	Predicted hydrolase of the HAD superfamily [Genera	96.3
PRK11587		218	putative phosphatase; Provisional	96.28
TIGR01459		242	HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas	96.24
TIGR03351		220	PhnX-like phosphonatase-like hydrolase. This clade	96.23
TIGR02009		185	PGMB-YQAB-SF beta-phosphoglucomutase family hydrol	96.23
PRK13223		272	phosphoglycolate phosphatase; Provisional	96.16
COG1011		229	Predicted hydrolase (HAD superfamily) [General fun	96.12
TIGR01670		154	YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho	96.03
TIGR01691		220	enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen	95.97
PRK13478		267	phosphonoacetaldehyde hydrolase; Provisional	95.87
PLN02779		286	haloacid dehalogenase-like hydrolase family protei	95.83
TIGR01548		197	HAD-SF-IA-hyp1 haloacid dehalogenase superfamily,	95.81
TIGR01990		185	bPGM beta-phosphoglucomutase. The enzyme from L. l	95.79
PLN02940		382	riboflavin kinase	95.76
COG0560		212	SerB Phosphoserine phosphatase [Amino acid transpo	95.69
TIGR01549		154	HAD-SF-IA-v1 haloacid dehalogenase superfamily, su	95.68
PF08645		159	PNK3P: Polynucleotide kinase 3 phosphatase; InterP	95.66
TIGR01491		201	HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa	95.54
TIGR02252		203	DREG-2 REG-2-like, HAD superfamily (subfamily IA)	95.53
TIGR02247		211	HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li	95.5
PRK06698		459	bifunctional 5'-methylthioadenosine/S-adenosylhomo	95.37
PLN02811		220	hydrolase	95.24
TIGR01689		126	EcbF-BcbF capsule biosynthesis phosphatase. Due to	95.14
TIGR01493		175	HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su	95.09
PRK11133		322	serB phosphoserine phosphatase; Provisional	95.04
PF13344		101	Hydrolase_6: Haloacid dehalogenase-like hydrolase;	95.0
PRK09484		183	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	94.88
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	94.87
PF06941		191	NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol	94.83
KOG3524		850	consensus Predicted guanine nucleotide exchange fa	94.59
TIGR03333		214	salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl	94.43
PRK13582		205	thrH phosphoserine phosphatase; Provisional	94.25
PRK00192		273	mannosyl-3-phosphoglycerate phosphatase; Reviewed	94.08
COG0561		264	Cof Predicted hydrolases of the HAD superfamily [G	93.58
TIGR01544		277	HAD-SF-IE haloacid dehalogenase superfamily, subfa	93.39
TIGR02463		221	MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r	93.26
PF06888		234	Put_Phosphatase: Putative Phosphatase; InterPro: I	93.24
TIGR01456		321	CECR5 HAD-superfamily class IIA hydrolase, TIGR014	93.22
PTZ00445		219	p36-lilke protein; Provisional	93.16
PF08282		254	Hydrolase_3: haloacid dehalogenase-like hydrolase;	92.97
COG4502		180	5'(3')-deoxyribonucleotidase [Nucleotide transport	92.89
PLN02645		311	phosphoglycolate phosphatase	92.46
TIGR02461		225	osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat	92.1
PRK03669		271	mannosyl-3-phosphoglycerate phosphatase; Reviewed	92.02
TIGR00099		256	Cof-subfamily Cof subfamily of IIB subfamily of ha	91.94
TIGR01487		215	SPP-like sucrose-phosphate phosphatase-like hydrol	91.92
COG2503		274	Predicted secreted acid phosphatase [General funct	91.88
PF09419		168	PGP_phosphatase: Mitochondrial PGP phosphatase; In	91.67
PRK10530		272	pyridoxal phosphate (PLP) phosphatase; Provisional	91.65
PRK10748		238	flavin mononucleotide phosphatase; Provisional	91.07
PRK10513		270	sugar phosphate phosphatase; Provisional	90.58
KOG0966		881	consensus ATP-dependent DNA ligase IV [Replication	90.52
PRK10444		248	UMP phosphatase; Provisional	90.39
PRK15126		272	thiamin pyrimidine pyrophosphate hydrolase; Provis	90.18
smart00775		157	LNS2 LNS2 domain. This domain is found in Saccharo	90.17
TIGR01486		256	HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph	90.03
TIGR02137		203	HSK-PSP phosphoserine phosphatase/homoserine phosp	89.97
PRK05601		377	DNA polymerase III subunit epsilon; Validated	89.88
PF11019		252	DUF2608: Protein of unknown function (DUF2608); In	89.86
TIGR01488		177	HAD-SF-IB Haloacid Dehalogenase superfamily, subfa	89.84
TIGR01452		279	PGP_euk phosphoglycolate/pyridoxal phosphate phosp	89.74
PRK01158		230	phosphoglycolate phosphatase; Provisional	89.67
TIGR01675		229	plant-AP plant acid phosphatase. This model explic	89.65
TIGR01484		204	HAD-SF-IIB HAD-superfamily hydrolase, subfamily II	89.3
TIGR01482		225	SPP-subfamily Sucrose-phosphate phosphatase subfam	88.61
TIGR01458		257	HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr	88.36
PRK10976		266	putative hydrolase; Provisional	88.34
TIGR02726		169	phenyl_P_delta phenylphosphate carboxylase, delta	88.3
PLN02887		580	hydrolase family protein	87.69
PRK10187		266	trehalose-6-phosphate phosphatase; Provisional	87.66
COG0647		269	NagD Predicted sugar phosphatases of the HAD super	86.43
COG0241		181	HisB Histidinol phosphatase and related phosphatas	86.34
TIGR01457		249	HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr	86.26
TIGR02244		343	HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd	85.28
PRK12702		302	mannosyl-3-phosphoglycerate phosphatase; Reviewed	84.68
PLN03017		366	trehalose-phosphatase	84.55
TIGR01485		249	SPP_plant-cyano sucrose-6F-phosphate phosphohydrol	84.34
TIGR00685		244	T6PP trehalose-phosphatase. At least 18 distinct s	84.08
TIGR01490		202	HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol	83.55
PLN02423		245	phosphomannomutase	83.54
PF03767		229	Acid_phosphat_B: HAD superfamily, subfamily IIIB (	83.15
COG1877		266	OtsB Trehalose-6-phosphatase [Carbohydrate transpo	82.71
PLN02151		354	trehalose-phosphatase	82.42
PRK14502		694	bifunctional mannosyl-3-phosphoglycerate synthase/	82.1
PTZ00174		247	phosphomannomutase; Provisional	82.05
TIGR01460		236	HAD-SF-IIA Haloacid Dehalogenase Superfamily Class	81.94
TIGR01548		197	HAD-SF-IA-hyp1 haloacid dehalogenase superfamily,	81.0
PLN02580		384	trehalose-phosphatase	80.66

>KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription]	Back alignment and domain information

Probab=100.00  E-value=1.1e-64  Score=523.14  Aligned_cols=357  Identities=34%  Similarity=0.561  Sum_probs=308.4

Q ss_pred             ccCCCceeecccccccccccccCCccceeeecCCcccCHHHHHHHhhccch-hhhcCCceEEEEeCCCceeeeecCCCCC
Q 036523           27 ESCSHPQTFNGVCLSCAQTVGEGYGLSFNYMLEGLEFGKDEVTRLKRMNSE-IVFGQRKLQLVLDLDHTLLHATDLDMLA  105 (387)
Q Consensus        27 e~C~H~~~~~~~C~~Cg~~~~~~~~~~~~~~~~~l~vs~~~a~~~~~~~~~-~l~~~~kl~LVLDLD~TLihs~~~~~~~  105 (387)
                      +.|.|+++++|||+.||++++...+..+.|...++.++..++..+...+.. ..+.+++|.||+|||+||+|++....+.
T Consensus        88 ~~C~H~~v~~GlC~~Cg~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~L~lv~Dld~tllh~~~~~~l~  167 (635)
T KOG0323|consen   88 SCCEHFTVFGGLCASCGKDLESLQGRSFDYLVKGLQLSNEMVAFTKTLTTQFSSLNRKKLHLVLDLDHTLLHTILKSDLS  167 (635)
T ss_pred             CCccceeecccHHHHHHHHHHHhhccchhcccchhhhhhhhhhhhhHHHHHHHHHhhhcceeehhhhhHHHHhhccchhh
Confidence            789999999999999999999988888899999999999999888877644 5566777899999999999999877666


Q ss_pred             ccchhhhcccccCCCCCCceeeec----CceEEEeeCccHHHHHHHHhhcccEEEEcCCcHHHHHHHHHHcCCCCceeec
Q 036523          106 PDDRDYLMKRESSASDGGGLFMMD----GGLLLVKLRPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYIS  181 (387)
Q Consensus       106 ~~~~~~~~~~~~~~~d~~~~f~l~----~~~~~v~lRPgl~eFL~~ls~~yel~IyT~g~~~YA~~i~~~LDP~~~~F~~  181 (387)
                      .++ .++..+..++.....+|.++    ..+||||+|||+.+||++++++|||||||||+|.||..|+++|||+|.|| +
T Consensus       168 e~~-~~l~~~~~~~~sn~dl~~~~~~~~~~~~~vKlRP~~~efL~~~sklfemhVyTmg~R~YA~~i~~liDP~~~lF-~  245 (635)
T KOG0323|consen  168 ETE-KYLKEEAESVESNKDLFRFNPLGHDTEYLVKLRPFVHEFLKEANKLFEMHVYTMGTRDYALEIAKLIDPEGKYF-G  245 (635)
T ss_pred             hhh-hhcccccccccccccceeecccCCCceEEEEeCccHHHHHHHHHhhceeEEEeccchHHHHHHHHHhCCCCccc-c
Confidence            655 55655544311223345544    36899999999999999999999999999999999999999999999999 9


Q ss_pred             ccEEeccCCCCCceecccccc-CCCCCeEEEeCChhhhhcCCCCeeEeccccchhhhhhhccC-----------------
Q 036523          182 SRLITCEDFKDTGKKNLDLVL-GQERGVVIVDDTAEVWKDHKENLILVGKYNYFKERIRKSKN-----------------  243 (387)
Q Consensus       182 ~Ri~srd~~~~~~~KdL~~l~-~~~~~vvIiDD~~~~w~~~~~N~I~I~~y~ff~~~~~~~~~-----------------  243 (387)
                      +||+||++......+||..++ ++.+||||||||.+||+.++.|+|+|.||.||.+.++....                 
T Consensus       246 dRIisrde~~~~kt~dL~~~~p~g~smvvIIDDr~dVW~~~~~nLI~i~~y~yF~~~gd~nap~~~~~~~~~~~~~~~~~  325 (635)
T KOG0323|consen  246 DRIISRDESPFFKTLDLVLLFPCGDSMVVIIDDRSDVWPDHKRNLIQIAPYPYFSGQGDINAPPPLHVLRNVACSVRGAF  325 (635)
T ss_pred             ceEEEecCCCcccccccccCCCCCCccEEEEeCccccccCCCcceEEeeeeecccCcccccCCcccccccchhccccccc
Confidence            999999998877788888887 58999999999999999887799999999999997742210                 


Q ss_pred             -------------------------------------------------------CCCccccccccCchhhhHHHHHHHH
Q 036523          244 -------------------------------------------------------NDQKSYSERKSDESELNGALVNVLR  268 (387)
Q Consensus       244 -------------------------------------------------------~~~~s~~~~~~d~~~~D~~L~~l~~  268 (387)
                                                                             +..+++.+.+.|+.+.|.+|.++++
T Consensus       326 ~k~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~s~~~~~~de~~~D~~L~~~~k  405 (635)
T KOG0323|consen  326 FKEFDPSLKSRISEVRYEDDDESNPTSYSVELSANPGPLKQDGMDEFVPEENAPEARSGSYREKKSDESDEDGELANLLK  405 (635)
T ss_pred             ccccCcccccccccccccccccccCcccccccccccCcccccccccccccccchhhcccccccccccccccchhHHHHhh
Confidence                                                                   1233445555677888999999999


Q ss_pred             HHHHHHhhhhcC----CCccccCchhhhHHHHhhhcccceeeeeccCCCCC--CchHHHHHHHHHhCCeeecccCCCceE
Q 036523          269 VLKRVHELFFEN----PENLVWGDVRSFLAKIRRQILAGCTLFFNMGDVGP--QEFPLLRRRAEELGAACTDVHDSSVTH  342 (387)
Q Consensus       269 ~L~~ih~~ff~~----~~~~~~~DVr~il~~~R~~vl~G~~i~fSg~~~~~--~~~~~l~~la~~lGa~v~~~v~~~vTH  342 (387)
                      +|+.||..||..    .+....+|||.+|+++|.++++||.++|||.+|..  ..++.+..++..+||..+.+++..+||
T Consensus       406 vl~~vH~~ff~~~~~~~e~~~~~Dvr~~i~~~~~~v~~~~~~vfSg~~P~~~~~~~s~~~~~~~~~g~vs~~~~~~~~th  485 (635)
T KOG0323|consen  406 VLKPVHKGFFAKYDEVEETLESPDVRLLIPELRTKVLKGSQIVFSGLHPTGSTDESADILGVAQQLGAVSAPDVSDKTTH  485 (635)
T ss_pred             hhcccchhhhhccccccccccCCChhhhhhhhhhHHhhccceeecccccCcCCcchhhhhhhhhcccceecccccchhhh
Confidence            999999999996    34567899999999999999999999999999922  235677788999999999999999999


Q ss_pred             EEEcCCCchHHHHHHhCC-CeeeCHHHHHHHHHhcccCCCCCCC
Q 036523          343 VVSTRQATEGRRLAEQHN-NFLVHPRWIYAAYYLWSRQAENDYF  385 (387)
Q Consensus       343 lVa~~~~t~K~~~A~~~g-i~IV~~~Wl~~c~~~~~r~dE~~Y~  385 (387)
                      +|+.+.+|.|+.+|...+ ++||++.|||.|+.+|.+++|..|.
T Consensus       486 ~i~~~~gt~k~~~a~~~~~~~Vv~~~wl~~~~e~w~~v~ek~~~  529 (635)
T KOG0323|consen  486 LIAANAGTKKVYKAVVSGSAKVVNAAWLWRSLEKWGKVEEKLEP  529 (635)
T ss_pred             HHhhccCcceeeccccccceeEechhHHHHHHHHhcchhccccc
Confidence            999999999999999876 9999999999999999999999885

>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain	Back alignment and domain information

>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription]	Back alignment and domain information

>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain	Back alignment and domain information

>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear	Back alignment and domain information

>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245	Back alignment and domain information

>smart00577 CPDc catalytic domain of ctd-like phosphatases	Back alignment and domain information

>KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription]	Back alignment and domain information

>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription]	Back alignment and domain information

>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription]	Back alignment and domain information

>PF12738 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2WT8_C 3EF1_A 3EF0_A	Back alignment and domain information

>PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1	Back alignment and domain information

>smart00292 BRCT breast cancer carboxy-terminal domain	Back alignment and domain information

>cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain	Back alignment and domain information

>KOG3226 consensus DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>PLN03122 Poly [ADP-ribose] polymerase; Provisional	Back alignment and domain information

>PLN03123 poly [ADP-ribose] polymerase; Provisional	Back alignment and domain information

>PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional	Back alignment and domain information

>PRK07956 ligA NAD-dependent DNA ligase LigA; Validated	Back alignment and domain information

>COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional	Back alignment and domain information

>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase	Back alignment and domain information

>TIGR01685 MDP-1 magnesium-dependent phosphatase-1	Back alignment and domain information

>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC	Back alignment and domain information

>PRK06063 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>PRK13288 pyrophosphatase PpaX; Provisional	Back alignment and domain information

>PLN03243 haloacid dehalogenase-like hydrolase; Provisional	Back alignment and domain information

>TIGR01684 viral_ppase viral phosphatase	Back alignment and domain information

>PHA03398 viral phosphatase superfamily protein; Provisional	Back alignment and domain information

>PRK06195 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK13226 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PLN02575 haloacid dehalogenase-like hydrolase	Back alignment and domain information

>TIGR00575 dnlj DNA ligase, NAD-dependent	Back alignment and domain information

>cd01427 HAD_like Haloacid dehalogenase-like hydrolases	Back alignment and domain information

>COG5275 BRCT domain type II [General function prediction only]	Back alignment and domain information

>PRK13225 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms]	Back alignment and domain information

>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA	Back alignment and domain information

>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain	Back alignment and domain information

>KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair]	Back alignment and domain information

>KOG1929 consensus Nucleotide excision repair factor NEF2, RAD4/CUT5 component [Replication, recombination and repair]	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672	Back alignment and domain information

>PHA02597 30	Back alignment and domain information

>TIGR01686 FkbH FkbH-like domain	Back alignment and domain information

>TIGR01261 hisB_Nterm histidinol-phosphatase	Back alignment and domain information

>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase	Back alignment and domain information

>KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair]	Back alignment and domain information

>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated	Back alignment and domain information

>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins	Back alignment and domain information

>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription]	Back alignment and domain information

>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only]	Back alignment and domain information

>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	Back alignment and domain information

>TIGR00338 serB phosphoserine phosphatase SerB	Back alignment and domain information

>KOG2043 consensus Signaling protein SWIFT and related BRCT domain proteins [Transcription; Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>KOG2481 consensus Protein required for normal rRNA processing [RNA processing and modification]	Back alignment and domain information

>COG4996 Predicted phosphatase [General function prediction only]	Back alignment and domain information

>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional	Back alignment and domain information

>PRK08238 hypothetical protein; Validated	Back alignment and domain information

>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A	Back alignment and domain information

>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed	Back alignment and domain information

>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253	Back alignment and domain information

>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea	Back alignment and domain information

>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only]	Back alignment and domain information

>PLN02770 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic	Back alignment and domain information

>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein	Back alignment and domain information

>COG0546 Gph Predicted phosphatases [General function prediction only]	Back alignment and domain information

>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family	Back alignment and domain information

>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II	Back alignment and domain information

>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED	Back alignment and domain information

>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254	Back alignment and domain information

>PRK06769 hypothetical protein; Validated	Back alignment and domain information

>KOG3548 consensus DNA damage checkpoint protein RHP9/CRB2/53BP1 [Replication, recombination and repair]	Back alignment and domain information

>PRK09449 dUMP phosphatase; Provisional	Back alignment and domain information

>COG5163 NOP7 Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668	Back alignment and domain information

>PRK14988 GMP/IMP nucleotidase; Provisional	Back alignment and domain information

>PRK10826 2-deoxyglucose-6-phosphatase; Provisional	Back alignment and domain information

>PRK10563 6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>PLN02954 phosphoserine phosphatase	Back alignment and domain information

>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional	Back alignment and domain information

>PRK13222 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK09456 ?-D-glucose-1-phosphatase; Provisional	Back alignment and domain information

>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only]	Back alignment and domain information

>PRK11587 putative phosphatase; Provisional	Back alignment and domain information

>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459	Back alignment and domain information

>TIGR03351 PhnX-like phosphonatase-like hydrolase	Back alignment and domain information

>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase	Back alignment and domain information

>PRK13223 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family	Back alignment and domain information

>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>PRK13478 phosphonoacetaldehyde hydrolase; Provisional	Back alignment and domain information

>PLN02779 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548	Back alignment and domain information

>TIGR01990 bPGM beta-phosphoglucomutase	Back alignment and domain information

>PLN02940 riboflavin kinase	Back alignment and domain information

>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E	Back alignment and domain information

>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin []	Back alignment and domain information

>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal	Back alignment and domain information

>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase	Back alignment and domain information

>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase	Back alignment and domain information

>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated	Back alignment and domain information

>PLN02811 hydrolase	Back alignment and domain information

>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase	Back alignment and domain information

>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase	Back alignment and domain information

>PRK11133 serB phosphoserine phosphatase; Provisional	Back alignment and domain information

>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A	Back alignment and domain information

>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins	Back alignment and domain information

>KOG3524 consensus Predicted guanine nucleotide exchange factor (PEBBLE) [Signal transduction mechanisms]	Back alignment and domain information

>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase	Back alignment and domain information

>PRK13582 thrH phosphoserine phosphatase; Provisional	Back alignment and domain information

>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only]	Back alignment and domain information

>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544	Back alignment and domain information

>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein	Back alignment and domain information

>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 []	Back alignment and domain information

>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5	Back alignment and domain information

>PTZ00445 p36-lilke protein; Provisional	Back alignment and domain information

>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification []	Back alignment and domain information

>COG4502 5'(3')-deoxyribonucleotidase [Nucleotide transport and metabolism]	Back alignment and domain information

>PLN02645 phosphoglycolate phosphatase	Back alignment and domain information

>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase	Back alignment and domain information

>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily	Back alignment and domain information

>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal	Back alignment and domain information

>COG2503 Predicted secreted acid phosphatase [General function prediction only]	Back alignment and domain information

>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases	Back alignment and domain information

>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional	Back alignment and domain information

>PRK10748 flavin mononucleotide phosphatase; Provisional	Back alignment and domain information

>PRK10513 sugar phosphate phosphatase; Provisional	Back alignment and domain information

>KOG0966 consensus ATP-dependent DNA ligase IV [Replication, recombination and repair]	Back alignment and domain information

>PRK10444 UMP phosphatase; Provisional	Back alignment and domain information

>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional	Back alignment and domain information

>smart00775 LNS2 LNS2 domain	Back alignment and domain information

>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family	Back alignment and domain information

>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein	Back alignment and domain information

>PRK05601 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria	Back alignment and domain information

>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like	Back alignment and domain information

>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family	Back alignment and domain information

>PRK01158 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>TIGR01675 plant-AP plant acid phosphatase	Back alignment and domain information

>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB	Back alignment and domain information

>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily	Back alignment and domain information

>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458	Back alignment and domain information

>PRK10976 putative hydrolase; Provisional	Back alignment and domain information

>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit	Back alignment and domain information

>PLN02887 hydrolase family protein	Back alignment and domain information

>PRK10187 trehalose-6-phosphate phosphatase; Provisional	Back alignment and domain information

>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457	Back alignment and domain information

>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase	Back alignment and domain information

>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>PLN03017 trehalose-phosphatase	Back alignment and domain information

>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase	Back alignment and domain information

>TIGR00685 T6PP trehalose-phosphatase	Back alignment and domain information

>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490	Back alignment and domain information

>PLN02423 phosphomannomutase	Back alignment and domain information

>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25)	Back alignment and domain information

>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN02151 trehalose-phosphatase	Back alignment and domain information

>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional	Back alignment and domain information

>PTZ00174 phosphomannomutase; Provisional	Back alignment and domain information

>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA	Back alignment and domain information

>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548	Back alignment and domain information

>PLN02580 trehalose-phosphatase	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		387
3ef0_A		372	The Structure Of Fcp1, An Essential Rna Polymerase		5e-13
3ef1_A		442	The Structure Of Fcp1, An Essential Rna Polymerase		2e-10

>pdb|3EF0|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 372

Back alignment and structure

Iteration: 1

Score = 72.0 bits (175), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 71/301 (23%), Positives = 129/301 (42%), Gaps = 54/301 (17%) Query: 135 VKLRPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTG 194 +K RP + FL++ ++Y+++I TMG + YA+ +AK++DP + + R+++ +D Sbjct: 74 IKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTGKLF-QDRVLSRDDSGSLA 132 Query: 195 KKNLDLVLGQERG-VVIVDDTAEVWKDHKENLILVGKYNYF------------------- 234 +K+L + + VV++DD +VW D NLI V Y +F Sbjct: 133 QKSLRRLFPCDTSMVVVIDDRGDVW-DWNPNLIKVVPYEFFVGIGDINSNFLSGNREALE 191 Query: 235 ---KERI-----RKSKNNDQKSYSERKSDESELNGA----------LVNVLRVLKRVHEL 276 KER+ +KS+ K + DE + + L + +VLK +H + Sbjct: 192 EQNKERVTALELQKSERPLAKQQNALLEDEGKPTPSHTLLHNRDHELERLEKVLKDIHAV 251 Query: 277 FFENPENLV-------WGDVRSFLAKIRRQILAGCTLFFNMGDVGPQEFPLLR----RRA 325 ++E ++ +V + K+++++L GC L F+ V P +L + A Sbjct: 252 YYEEENDISSRSGNHKHANVGLIIPKMKQKVLKGCRLLFS--GVIPLGVDVLSSDIAKWA 309 Query: 326 EELGAACXXXXXXXXXXXXXXRQATEGRRLAEQHNNF-LVHPRWIYAAYYLWSRQAENDY 384 GA + TE + A N +V W+ + W R E+DY Sbjct: 310 MSFGAEVVLDFSVPPTHLIAAKIRTEKVKKAVSMGNIKVVKLNWLTESLSQWKRLPESDY 369 Query: 385 F 385 Sbjct: 370 L 370

PyMOL of 3ef0

>pdb|3EF1|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 442

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		387
3ef0_A		372	RNA polymerase II subunit A C-terminal domain phos	3e-63
3ef1_A		442	RNA polymerase II subunit A C-terminal domain phos	4e-33
3ef1_A		442	RNA polymerase II subunit A C-terminal domain phos	3e-20
2ght_A		181	Carboxy-terminal domain RNA polymerase II polypept	9e-18
3qle_A		204	TIM50P; chaperone, mitochondrion, preprotein trans	9e-17
2hhl_A		195	CTD small phosphatase-like protein; CTD phosphatas	2e-16
3l3e_A		107	DNA topoisomerase 2-binding protein 1; BRCT domain	7e-13
2d8m_A		129	DNA-repair protein XRCC1; parallel beta-sheet, DNA	3e-12
2cou_A		109	ECT2 protein; BRCT domain, RHO GTPase, structural	2e-10
3pa6_A		107	Microcephalin; BRCT domain, cell cycle; HET: MSE;	2e-10
1wf6_A		132	Similar to S.pombe -RAD4+/CUT5+product (A40727); B	5e-10
3l46_A		112	Protein ECT2; alternative splicing, guanine-nucleo	6e-09
3pc6_A		104	DNA repair protein XRCC1; BRCT domain, protein:pro	1e-08
3shq_A		320	UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila	2e-08
2ebw_A		97	DNA repair protein REV1; A/B/A 3 layers, parallel	4e-07
3olc_X		298	DNA topoisomerase 2-binding protein 1; BRCT domain	5e-07
3olc_X		298	DNA topoisomerase 2-binding protein 1; BRCT domain	4e-06
2jw5_A		106	DNA polymerase lambda; BRCT domain, family X polym	1e-06
2nte_A		210	BARD-1, BRCA1-associated ring domain protein 1; BR	4e-05
1t15_A		214	Breast cancer type 1 susceptibility protein; prote	9e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-04
1l0b_A		229	BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu	5e-04

>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372	Back alignment and structure

 Score =  206 bits (524), Expect = 3e-63
 Identities = 80/372 (21%), Positives = 160/372 (43%), Gaps = 59/372 (15%)

Query: 68  VTRLKRMNSEIVFGQRKLQLVLDLDHTLLHATDL-----DMLAPDDRDYLMKRESSASDG 122
           ++RL+  N + +  +++L L++DLD T++HAT        M  P + +Y + R+  + + 
Sbjct: 2   LSRLESENVKRLRQEKRLSLIVDLDQTIIHATVDPTVGEWMSDPGNVNYDVLRDVRSFNL 61

Query: 123 GGLFMMDGGLLLVKLRPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISS 182
                       +K RP +  FL++  ++Y+++I TMG + YA+ +AK++DP  +     
Sbjct: 62  QEGPSGYTSCYYIKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTGKL-FQD 120

Query: 183 RLITCEDFKDTGKKNLDLVLGQE-RGVVIVDDTAEVWKDHKENLILVGKYNYFK------ 235
           R+++ +D     +K+L  +   +   VV++DD  +VW  +  NLI V  Y +F       
Sbjct: 121 RVLSRDDSGSLAQKSLRRLFPCDTSMVVVIDDRGDVWDWN-PNLIKVVPYEFFVGIGDIN 179

Query: 236 -------------------------------ERIRKSKNNDQKSYSERKSDESELNGALV 264
                                           + + +   D+   +   +     +  L 
Sbjct: 180 SNFLSGNREALEEQNKERVTALELQKSERPLAKQQNALLEDEGKPTPSHTLLHNRDHELE 239

Query: 265 NVLRVLKRVHELFFENPENLVWG-------DVRSFLAKIRRQILAGCTLFFNMGDVGPQE 317
            + +VLK +H +++E   ++          +V   + K+++++L GC L F    V P  
Sbjct: 240 RLEKVLKDIHAVYYEEENDISSRSGNHKHANVGLIIPKMKQKVLKGCRLLF--SGVIPLG 297

Query: 318 FPL----LRRRAEELGAACTDVHDSSVTHVVSTRQATEGRRLAEQHNNF-LVHPRWIYAA 372
             +    + + A   GA          TH+++ +  TE  + A    N  +V   W+  +
Sbjct: 298 VDVLSSDIAKWAMSFGAEVVLDFSVPPTHLIAAKIRTEKVKKAVSMGNIKVVKLNWLTES 357

Query: 373 YYLWSRQAENDY 384
              W R  E+DY
Sbjct: 358 LSQWKRLPESDY 369

PyMOL of 3ef0

>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442	Back alignment and structure

>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442	Back alignment and structure

>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181	Back alignment and structure

>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204	Back alignment and structure

>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195	Back alignment and structure

>2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129	Back alignment and structure

>2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 109	Back alignment and structure

>3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Length = 107	Back alignment and structure

>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132	Back alignment and structure

>3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Length = 112	Back alignment and structure

>3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} PDB: 3pc8_A* 3qvg_B* 1cdz_A Length = 104	Back alignment and structure

>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320	Back alignment and structure

>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Length = 97	Back alignment and structure

>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298	Back alignment and structure

>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298	Back alignment and structure

>2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Length = 106	Back alignment and structure

>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Length = 210	Back alignment and structure

>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Length = 214	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Length = 229	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		387
3ef1_A		442	RNA polymerase II subunit A C-terminal domain phos	100.0
3ef0_A		372	RNA polymerase II subunit A C-terminal domain phos	100.0
3qle_A		204	TIM50P; chaperone, mitochondrion, preprotein trans	100.0
2ght_A		181	Carboxy-terminal domain RNA polymerase II polypept	100.0
3shq_A		320	UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila	99.97
2hhl_A		195	CTD small phosphatase-like protein; CTD phosphatas	99.97
3l3e_A		107	DNA topoisomerase 2-binding protein 1; BRCT domain	99.83
3l46_A		112	Protein ECT2; alternative splicing, guanine-nucleo	99.8
2cou_A		109	ECT2 protein; BRCT domain, RHO GTPase, structural	99.79
2d8m_A		129	DNA-repair protein XRCC1; parallel beta-sheet, DNA	99.77
3pa6_A		107	Microcephalin; BRCT domain, cell cycle; HET: MSE;	99.76
4id3_A		92	DNA repair protein REV1; BRCT domain, protein bind	99.72
2ebw_A		97	DNA repair protein REV1; A/B/A 3 layers, parallel	99.68
3olc_X		298	DNA topoisomerase 2-binding protein 1; BRCT domain	99.65
3pc6_A		104	DNA repair protein XRCC1; BRCT domain, protein:pro	99.65
1wf6_A		132	Similar to S.pombe -RAD4+/CUT5+product (A40727); B	99.64
1l0b_A		229	BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu	99.58
2nte_A		210	BARD-1, BRCA1-associated ring domain protein 1; BR	99.54
3sqd_A		219	PAX-interacting protein 1; tandem BRCT domains, ce	99.52
1t15_A		214	Breast cancer type 1 susceptibility protein; prote	99.52
2etx_A		209	Mediator of DNA damage checkpoint protein 1; tande	99.48
3al2_A		235	DNA topoisomerase 2-binding protein 1; BRCT domain	99.42
3olc_X		298	DNA topoisomerase 2-binding protein 1; BRCT domain	99.42
3u3z_A		199	Microcephalin; DNA repair, cell cycle regulation,	99.36
3l41_A		220	BRCT-containing protein 1; BRC1, BRCT domain, tand	99.3
2jw5_A		106	DNA polymerase lambda; BRCT domain, family X polym	99.29
1l7b_A		92	DNA ligase; BRCT, autostructure, structural genomi	99.29
2k6g_A		109	Replication factor C subunit 1; protein, BRCT, DNA	99.2
1kzy_C		259	Tumor suppressor P53-binding protein 1; tandem-BRC	99.19
3ii6_X		263	DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter	99.18
2ep8_A		100	Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r	99.17
2vxb_A		241	DNA repair protein RHP9; BRCT, nucleus, cell cycle	99.16
2ebu_A		112	Replication factor C subunit 1; A/B/A 3 layers, pa	99.15
2cok_A		113	Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r	99.08
3ii6_X		263	DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter	99.08
1z56_C		264	DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA	99.05
3pc7_A		88	DNA ligase 3; DNA repair, BRCT domain, protein:pro	99.01
2coe_A		120	Deoxynucleotidyltransferase, terminal variant; BRC	98.91
1t15_A		214	Breast cancer type 1 susceptibility protein; prote	98.78
1z56_C		264	DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA	98.77
1l0b_A		229	BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu	98.76
3u3z_A		199	Microcephalin; DNA repair, cell cycle regulation,	98.66
2dun_A		133	POL MU, DNA polymerase MU; layers A/B/A, parallel	98.55
1kzy_C		259	Tumor suppressor P53-binding protein 1; tandem-BRC	98.42
2nte_A		210	BARD-1, BRCA1-associated ring domain protein 1; BR	98.41
2etx_A		209	Mediator of DNA damage checkpoint protein 1; tande	98.3
1dgs_A		667	DNA ligase; AMP complex, NAD+-dependent; HET: DNA	98.29
2wm8_A		187	MDP-1, magnesium-dependent phosphatase 1; haloacid	98.28
2fpr_A		176	Histidine biosynthesis bifunctional protein HISB;	98.18
3ib6_A		189	Uncharacterized protein; structural genomics, unkn	98.16
3kbb_A		216	Phosphorylated carbohydrates phosphatase TM_1254;	98.13
2owo_A		671	DNA ligase; protein-DNA complex, ligase-DNA comple	98.12
2pr7_A		137	Haloacid dehalogenase/epoxide hydrolase family; NP	98.03
3l8h_A		179	Putative haloacid dehalogenase-like hydrolase; HAD	98.02
3m9l_A		205	Hydrolase, haloacid dehalogenase-like family; HAD	97.98
2gmw_A		211	D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi	97.88
3kzx_A		231	HAD-superfamily hydrolase, subfamily IA, variant;	97.85
2vxb_A		241	DNA repair protein RHP9; BRCT, nucleus, cell cycle	97.84
3m1y_A		217	Phosphoserine phosphatase (SERB); NYSGXRC, PSI II,	97.81
2p9j_A		162	Hypothetical protein AQ2171; secsg, riken, PSI, st	97.78
3um9_A		230	Haloacid dehalogenase, type II; haloacid dehalogen	97.75
3sqd_A		219	PAX-interacting protein 1; tandem BRCT domains, ce	97.73
2i6x_A		211	Hydrolase, haloacid dehalogenase-like family; HAD	97.68
2oda_A		196	Hypothetical protein pspto_2114; haloacid dehaloge	97.63
3nuq_A		282	Protein SSM1, putative nucleotide phosphatase; sup	97.61
4dcc_A		229	Putative haloacid dehalogenase-like hydrolase; mag	97.61
3zvl_A		416	Bifunctional polynucleotide phosphatase/kinase; hy	97.56
4eze_A		317	Haloacid dehalogenase-like hydrolase; magnesium bi	97.55
3nvb_A		387	Uncharacterized protein; protein FKBH, protein fkb	97.49
2i7d_A		193	5'(3')-deoxyribonucleotidase, cytosolic type; hydr	97.46
3al2_A		235	DNA topoisomerase 2-binding protein 1; BRCT domain	97.42
3huf_A		325	DNA repair and telomere maintenance protein NBS1;	97.36
3t7k_A		256	RTT107, regulator of TY1 transposition protein 107	97.34
4gib_A		250	Beta-phosphoglucomutase; rossmann fold, HAD-like,	97.29
2o2x_A		218	Hypothetical protein; structural genomics, joint c	97.29
3bwv_A		180	Putative 5'(3')-deoxyribonucleotidase; NP_764060.1	97.28
3e8m_A		164	Acylneuraminate cytidylyltransferase; 2-keto-3-deo	97.28
2b0c_A		206	Putative phosphatase; alpha-D-glucose-1-phosphate,	97.25
1k1e_A		180	Deoxy-D-mannose-octulosonate 8-phosphate phosphat;	97.11
3mn1_A		189	Probable YRBI family phosphatase; structural genom	97.04
3p96_A		415	Phosphoserine phosphatase SERB; ssgcid, structural	97.04
3skx_A		280	Copper-exporting P-type ATPase B; P1B-ATPase, ATP	97.02
3ij5_A		211	3-deoxy-D-manno-octulosonate 8-phosphate phosphat;	96.97
3mmz_A		176	Putative HAD family hydrolase; structural genomics	96.96
3n07_A		195	3-deoxy-D-manno-octulosonate 8-phosphate phosphat;	96.84
2r8e_A		188	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	96.83
4ap9_A		201	Phosphoserine phosphatase; hydrolase, haloacid deh	96.82
3n1u_A		191	Hydrolase, HAD superfamily, subfamily III A; struc	96.68
2ah5_A		210	COG0546: predicted phosphatases; MCSG, structural	96.54
2gfh_A		260	Haloacid dehalogenase-like hydrolase domain conta;	96.45
2pib_A		216	Phosphorylated carbohydrates phosphatase TM_1254;	96.41
1rku_A		206	Homoserine kinase; phosphoserine phosphatase, phos	96.38
2i33_A		258	Acid phosphatase; HAD superfamily, hydrolase; 1.57	96.37
4gns_A		290	Chitin biosynthesis protein CHS5; FN3, BRCT, tetra	96.35
2nyv_A		222	Pgpase, PGP, phosphoglycolate phosphatase; structu	96.28
3e58_A		214	Putative beta-phosphoglucomutase; structu genomics	96.26
3qnm_A		240	Haloacid dehalogenase-like hydrolase; structural g	96.26
2hdo_A		209	Phosphoglycolate phosphatase; NP_784602.1, structu	96.21
2hsz_A		243	Novel predicted phosphatase; structural genomics,	96.2
3umb_A		233	Dehalogenase-like hydrolase; 2.20A {Ralstonia sola	96.19
3sd7_A		240	Putative phosphatase; structural genomics, haloaci	96.19
2obb_A		142	Hypothetical protein; structural genomics, PSI-2,	96.11
3s6j_A		233	Hydrolase, haloacid dehalogenase-like family; stru	96.08
3l41_A		220	BRCT-containing protein 1; BRC1, BRCT domain, tand	96.04
3ed5_A		238	YFNB; APC60080, bacillus subtilis subsp. subtilis	96.04
2hi0_A		240	Putative phosphoglycolate phosphatase; YP_619066.1	96.03
2hoq_A		241	Putative HAD-hydrolase PH1655; haloacid dehalogena	96.02
2b82_A		211	APHA, class B acid phosphatase; DDDD acid phosphat	95.96
1yns_A		261	E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo	95.96
3pct_A		260	Class C acid phosphatase; hydrolase, outer membran	95.94
3mc1_A		226	Predicted phosphatase, HAD family; PSI2, NYSGXRC,	95.92
1zrn_A		232	L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud	95.92
4ex6_A		237	ALNB; modified rossman fold, phosphatase, magnesiu	95.89
3oq0_A		151	DBF4, protein DNA52; DDK, BRCT, RAD53, replication	95.85
2no4_A		240	(S)-2-haloacid dehalogenase IVA; HAD superfamily,	95.84
2zg6_A		220	Putative uncharacterized protein ST2620, probable	95.81
3qbz_A		160	DDK kinase regulatory subunit DBF4; FHA domain,RAD	95.71
2hcf_A		234	Hydrolase, haloacid dehalogenase-like family; NP_6	95.68
1qq5_A		253	Protein (L-2-haloacid dehalogenase); hydrolase; 1.	95.64
2w43_A		201	Hypothetical 2-haloalkanoic acid dehalogenase; hyd	95.54
1qyi_A		384	ZR25, hypothetical protein; structural genomics, P	95.54
3u26_A		234	PF00702 domain protein; structural genomics, PSI-b	95.39
4eek_A		259	Beta-phosphoglucomutase-related protein; hydrolase	95.38
3ocu_A		262	Lipoprotein E; hydrolase, outer membrane; HET: NMN	95.33
2fea_A		236	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	95.25
3cnh_A		200	Hydrolase family protein; NP_295428.1, predicted h	95.15
3smv_A		240	S-(-)-azetidine-2-carboxylate hydrolase; haloacid	95.05
2l42_A		106	DNA-binding protein RAP1; BRCT domain, protein bin	95.0
3ddh_A		234	Putative haloacid dehalogenase-like family hydrol;	94.99
3a1c_A		287	Probable copper-exporting P-type ATPase A; ATP-bin	94.95
3iru_A		277	Phoshonoacetaldehyde hydrolase like protein; phosp	94.81
2pke_A		251	Haloacid delahogenase-like family hydrolase; NP_63	94.79
1nnl_A		225	L-3-phosphoserine phosphatase; PSP, HPSP, phospho-	94.76
3k1z_A		263	Haloacid dehalogenase-like hydrolase domain-conta	94.74
4g9b_A		243	Beta-PGM, beta-phosphoglucomutase; HAD, putative p	94.66
3nas_A		233	Beta-PGM, beta-phosphoglucomutase; PSI, structural	94.6
3umc_A		254	Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru	94.47
1te2_A		226	Putative phosphatase; structural genomics, phospha	94.44
3oq4_A		134	DBF4, protein DNA52; DDK, BRCT, RAD53, replication	94.41
2go7_A		207	Hydrolase, haloacid dehalogenase-like family; stru	94.38
2g80_A		253	Protein UTR4; YEL038W, UTR4 protein (unknown trans	94.31
3dv9_A		247	Beta-phosphoglucomutase; structural genomics, APC6	94.24
2om6_A		235	Probable phosphoserine phosphatase; rossmann fold,	94.2
3qxg_A		243	Inorganic pyrophosphatase; hydrolase, magnesium bi	94.16
2p11_A		231	Hypothetical protein; putative haloacid dehalogena	94.14
3umg_A		254	Haloacid dehalogenase; defluorinase, hydrolase; 2.	94.03
1ltq_A		301	Polynucleotide kinase; phosphatase, alpha/beta, P-	94.01
3d6j_A		225	Putative haloacid dehalogenase-like hydrolase; str	93.99
3fvv_A		232	Uncharacterized protein; unknown function, structu	93.86
2qlt_A		275	(DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac	93.75
1wr8_A		231	Phosphoglycolate phosphatase; alpha / beta core do	93.73
1xpj_A		126	Hypothetical protein; structural genomics, MCSG, p	93.6
3kc2_A		352	Uncharacterized protein YKR070W; HAD-like, mitocho	93.54
1l6r_A		227	Hypothetical protein TA0175; structural genomics,	93.37
3l5k_A		250	Protein GS1, haloacid dehalogenase-like hydrolase	92.84
2fi1_A		190	Hydrolase, haloacid dehalogenase-like family; stru	92.69
3mpo_A		279	Predicted hydrolase of the HAD superfamily; SGX, P	92.66
2fdr_A		229	Conserved hypothetical protein; SAD, structural ge	92.45
3ewi_A		168	N-acylneuraminate cytidylyltransferase; beta barre	92.2
1xvi_A		275	MPGP, YEDP, putative mannosyl-3-phosphoglycerate p	92.1
4dw8_A		279	Haloacid dehalogenase-like hydrolase; HAD, putativ	92.09
2hx1_A		284	Predicted sugar phosphatases of the HAD superfamil	92.07
3dnp_A		290	Stress response protein YHAX; structural PSI-2, pr	92.07
3pgv_A		285	Haloacid dehalogenase-like hydrolase; structural g	91.89
3kd3_A		219	Phosphoserine phosphohydrolase-like protein; csgid	91.79
3qgm_A		268	P-nitrophenyl phosphatase (PHO2); structural genom	91.6
1nrw_A		288	Hypothetical protein, haloacid dehalogenase-like h	91.55
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	91.54
2yj3_A		263	Copper-transporting ATPase; hydrolase, P-type ATPa	90.52
3epr_A		264	Hydrolase, haloacid dehalogenase-like family; stru	90.91
2wf7_A		221	Beta-PGM, beta-phosphoglucomutase; transition stat	90.79
3dao_A		283	Putative phosphatse; structural genomics, joint ce	90.75
1nf2_A		268	Phosphatase; structural proteomics, HAD NEW fold,	90.49
2pq0_A		258	Hypothetical conserved protein GK1056; hyopthetica	90.44
3vay_A		230	HAD-superfamily hydrolase; rossmann fold, haloacid	90.16
1swv_A		267	Phosphonoacetaldehyde hydrolase; HAD enzyme superf	89.98
3pdw_A		266	Uncharacterized hydrolase YUTF; structural genomic	89.89
1q92_A		197	5(3)-deoxyribonucleotidase; alpha-beta rossman fol	89.88
1vjr_A		271	4-nitrophenylphosphatase; TM1742, structural genom	89.48
2zos_A		249	MPGP, mannosyl-3-phosphoglycerate phosphatase; hal	88.9
1rkq_A		282	Hypothetical protein YIDA; two domain structure wi	88.88
1zjj_A		263	Hypothetical protein PH1952; alpha/beta hydrolase	88.49
3fzq_A		274	Putative hydrolase; YP_001086940.1, putative haloa	88.0
1s2o_A		244	SPP, sucrose-phosphatase; phosphohydrolase, HAD su	87.99
3gyg_A		289	NTD biosynthesis operon putative hydrolase NTDB; P	87.71
3n28_A		335	Phosphoserine phosphatase; HAD family hydrolase, s	87.54
2b30_A		301	Pvivax hypothetical protein; SGPP, structural geno	87.16
2fue_A		262	PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ	87.07
2oyc_A		306	PLP phosphatase, pyridoxal phosphate phosphatase;	87.04
2amy_A		246	PMM 2, phosphomannomutase 2; HS.459855, HS.313504,	85.43
1rlm_A		271	Phosphatase; HAD family, rossman fold, hydrolase;	85.28
3l7y_A		304	Putative uncharacterized protein SMU.1108C; hydrol	85.25
2ho4_A		259	Haloacid dehalogenase-like hydrolase domain contai	84.93
1yv9_A		264	Hydrolase, haloacid dehalogenase family; hypotheti	84.74
3f9r_A		246	Phosphomannomutase; trypanosome glycobiology struc	84.44
1l7m_A		211	Phosphoserine phosphatase; rossmann fold, four-hel	84.25
1u02_A		239	Trehalose-6-phosphate phosphatase related protein;	83.79
2x4d_A		271	HLHPP, phospholysine phosphohistidine inorganic py	82.68
1q92_A		197	5(3)-deoxyribonucleotidase; alpha-beta rossman fol	82.56
3r4c_A		268	Hydrolase, haloacid dehalogenase-like hydrolase; h	82.29
2rbk_A		261	Putative uncharacterized protein; HAD-like phospha	82.27
2c4n_A		250	Protein NAGD; nucleotide phosphatase, HAD superfam	81.81
3zx4_A		259	MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd	81.0
1l7m_A		211	Phosphoserine phosphatase; rossmann fold, four-hel	80.24

>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe}	Back alignment and structure

Probab=100.00  E-value=8.6e-72  Score=562.23  Aligned_cols=325  Identities=24%  Similarity=0.364  Sum_probs=267.9

Q ss_pred             CCcccCHHHHHHHhhccchhhhcCCceEEEEeCCCceeeeecCCCCCccchhhhcccccCCCCCCceeeec------Cce
Q 036523           59 EGLEFGKDEVTRLKRMNSEIVFGQRKLQLVLDLDHTLLHATDLDMLAPDDRDYLMKRESSASDGGGLFMMD------GGL  132 (387)
Q Consensus        59 ~~l~vs~~~a~~~~~~~~~~l~~~~kl~LVLDLD~TLihs~~~~~~~~~~~~~~~~~~~~~~d~~~~f~l~------~~~  132 (387)
                      +||+||.+||+++++++.+||+..+|++||||||+|||||+..+....+.+..-..+.++++| ...|.+.      +++
T Consensus         1 ~~l~vs~~~a~~~~~~~~~rll~~~Kl~LVLDLDeTLiHs~~~~~~~~~~~~~~~~~~~~~~d-v~~F~l~~~~~~~~~~   79 (442)
T 3ef1_A            1 SDLTVSLEEASRLESENVKRLRQEKRLSLIVXLDQTIIHATVDPTVGEWMSDPGNVNYDVLRD-VRSFNLQEGPSGYTSC   79 (442)
T ss_dssp             CTTHHHHHHHHHHHHHHHHHHHHTTCEEEEECCBTTTEEEECCTHHHHHHTCTTSTTTGGGTT-CEEEEEEETTTTEEEE
T ss_pred             CCceecHHHHHHHHHHHHHHHHhcCCeEEEEeeccceeccccccccchhccCCCCcchhhhcc-ccceeeeeccCCceeE
Confidence            489999999999999999999999999999999999999986431110000000011122333 2235553      468


Q ss_pred             EEEeeCccHHHHHHHHhhcccEEEEcCCcHHHHHHHHHHcCCCCceeecccEEeccCCCCCceeccccc-cCCCCCeEEE
Q 036523          133 LLVKLRPYIRSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKNLDLV-LGQERGVVIV  211 (387)
Q Consensus       133 ~~v~lRPgl~eFL~~ls~~yel~IyT~g~~~YA~~i~~~LDP~~~~F~~~Ri~srd~~~~~~~KdL~~l-~~~~~~vvIi  211 (387)
                      |||++|||+++||++++++|||+|||+|.+.||++|++.|||++.|| ++|+|||++|+..++|||++| ++++++||||
T Consensus        80 ~~V~~RPgl~eFL~~ls~~yEivIfTas~~~YA~~Vl~~LDp~~~~f-~~Rl~sRd~cg~~~~KdL~~ll~rdl~~vvII  158 (442)
T 3ef1_A           80 YYIKFRPGLAQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTGKLF-QDRVLSRDDSGSLAQKSLRRLFPCDTSMVVVI  158 (442)
T ss_dssp             EEEEECTTHHHHHHHHTTTEEEEEECSSCHHHHHHHHHHHCTTSTTT-TTCEECTTTSSCSSCCCGGGTCSSCCTTEEEE
T ss_pred             EEEEeCCCHHHHHHHHhCCcEEEEEcCCCHHHHHHHHHHhccCCccc-cceEEEecCCCCceeeehHHhcCCCcceEEEE
Confidence            99999999999999999999999999999999999999999999999 999999999988899999977 6799999999


Q ss_pred             eCChhhhhcCCCCeeEeccccchhhhhh---------h-----ccCCC--Ccc---------------------------
Q 036523          212 DDTAEVWKDHKENLILVGKYNYFKERIR---------K-----SKNND--QKS---------------------------  248 (387)
Q Consensus       212 DD~~~~w~~~~~N~I~I~~y~ff~~~~~---------~-----~~~~~--~~s---------------------------  248 (387)
                      ||++.+|..|+ |+|+|.||+||++.++         |     .+...  .++                           
T Consensus       159 Dd~p~~~~~~p-N~I~I~~~~fF~~~gD~n~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  237 (442)
T 3ef1_A          159 DDRGDVWDWNP-NLIKVVPYEFFVGIGDINSNFLAKSTPLPEQEQLIPLEIPKDEPDSVDEINEENEETPEYDSSNSSYA  237 (442)
T ss_dssp             ESCSGGGTTCT-TEEECCCCCCSTTCCCSCC-------------------------------------------------
T ss_pred             ECCHHHhCCCC-CEEEcCCccccCCCCcccccccccccccccccccccccccccccccccccccccccCccccccccccc
Confidence            99999999986 9999999999998532         1     11100  000                           


Q ss_pred             -------cc---------------------------------------ccccC----------chhhhHHHHHHHHHHHH
Q 036523          249 -------YS---------------------------------------ERKSD----------ESELNGALVNVLRVLKR  272 (387)
Q Consensus       249 -------~~---------------------------------------~~~~d----------~~~~D~~L~~l~~~L~~  272 (387)
                             ..                                       ++..|          ..++|++|..|.++|.+
T Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~rpl~~~q~~l~~~~~~~~~~~~~l~d~D~~L~~l~~~L~~  317 (442)
T 3ef1_A          238 QDSSTIPEKTLLKDTFLQNREALEEQNKERVTALELQKSERPLAKQQNALLEDEGKPTPSHTLLHNRDHELERLEKVLKD  317 (442)
T ss_dssp             ---------------------CHHHHHHHHHHHHHHHHHHCHHHHHHHHHHTSCCSCHHHHCSCCCCCCHHHHHHHHHHH
T ss_pred             ccccccchhhhhccccCccchhhHHHHHHhhhhhhhhhccCchhhHHHHhhhhhhccccccccccCCcHHHHHHHHHHHH
Confidence                   00                                       00001          02468999999999999


Q ss_pred             HHhhhhcCCC-------ccccCchhhhHHHHhhhcccceeeeeccCCCCCC--chHHHHHHHHHhCCeeecccCCCceEE
Q 036523          273 VHELFFENPE-------NLVWGDVRSFLAKIRRQILAGCTLFFNMGDVGPQ--EFPLLRRRAEELGAACTDVHDSSVTHV  343 (387)
Q Consensus       273 ih~~ff~~~~-------~~~~~DVr~il~~~R~~vl~G~~i~fSg~~~~~~--~~~~l~~la~~lGa~v~~~v~~~vTHl  343 (387)
                      ||++||+..+       ....+||+.||+++|+++|+||+|||||++|...  .+..++++|+++||+|+.+++++||||
T Consensus       318 iH~~fy~~~d~~~~~~~~~~~~Dv~~il~~~k~~~L~G~~IvfSG~~p~~~~~~r~~l~~~~~~lGa~~~~~vs~~vTHL  397 (442)
T 3ef1_A          318 IHAVYYEEENDISSRSGNHKHANVGLIIPKMKQKVLKGCRLLFSGVIPLGVDVLSSDIAKWAMSFGAEVVLDFSVPPTHL  397 (442)
T ss_dssp             HHHHHHHHHHTCCSCCSSSCCCCHHHHHHHHHHTTSTTCEEEEESSSCTTSCSTTSHHHHHHHTTTCEECSSSSSCCSEE
T ss_pred             HHHHHHHHhhhcccccccCCCCcHHHHHHHHhhcccCCcEEEEecccCCCCCccHHHHHHHHHHcCCEEeCCCCCCceEE
Confidence            9999998732       2246899999999999999999999999998321  278999999999999999999999999


Q ss_pred             EEcCCCchHHHHHHhC-CCeeeCHHHHHHHHHhcccCCCCCCCC
Q 036523          344 VSTRQATEGRRLAEQH-NNFLVHPRWIYAAYYLWSRQAENDYFP  386 (387)
Q Consensus       344 Va~~~~t~K~~~A~~~-gi~IV~~~Wl~~c~~~~~r~dE~~Y~~  386 (387)
                      ||++.+|.|+++|.++ ||+||+++||++|+.+|+|+||++|+.
T Consensus       398 Va~~~~t~K~~~A~~~g~IkIVs~~WL~dcl~~~krldE~~YlL  441 (442)
T 3ef1_A          398 IAAKIRTEKVKKAVSMGNIKVVKLNWLTESLSQWKRLPESDYLL  441 (442)
T ss_dssp             EECSCCCHHHHHHHHHSSSEEEEHHHHHHHHHHTSCCCGGGTBC
T ss_pred             EeCCCCCHHHHHHHhcCCCEEEeHHHHHHHHHcCCcCChhcccc
Confidence            9999999999999998 599999999999999999999999974

PyMOL of 3ef1

>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe}	Back alignment and structure

>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118}	Back alignment and structure

>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A	Back alignment and structure

>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster}	Back alignment and structure

>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens}	Back alignment and structure

>3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens}	Back alignment and structure

>2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A*	Back alignment and structure

>4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens}	Back alignment and structure

>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A*	Back alignment and structure

>3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A	Back alignment and structure

>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5	Back alignment and structure

>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3	Back alignment and structure

>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A	Back alignment and structure

>3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens}	Back alignment and structure

>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A	Back alignment and structure

>2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A	Back alignment and structure

>3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A*	Back alignment and structure

>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A*	Back alignment and structure

>3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A*	Back alignment and structure

>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A*	Back alignment and structure

>2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens}	Back alignment and structure

>1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2	Back alignment and structure

>2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A	Back alignment and structure

>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B	Back alignment and structure

>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A*	Back alignment and structure

>2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A*	Back alignment and structure

>2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A	Back alignment and structure

>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A*	Back alignment and structure

>1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae}	Back alignment and structure

>3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A*	Back alignment and structure

>2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A	Back alignment and structure

>1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae}	Back alignment and structure

>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3	Back alignment and structure

>3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A*	Back alignment and structure

>2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A*	Back alignment and structure

>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B	Back alignment and structure

>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A	Back alignment and structure

>2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A	Back alignment and structure

>1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A*	Back alignment and structure

>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A	Back alignment and structure

>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A*	Back alignment and structure

>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes}	Back alignment and structure

>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8}	Back alignment and structure

>2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli}	Back alignment and structure

>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica}	Back alignment and structure

>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A*	Back alignment and structure

>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A*	Back alignment and structure

>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis}	Back alignment and structure

>2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A*	Back alignment and structure

>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0	Back alignment and structure

>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus}	Back alignment and structure

>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP}	Back alignment and structure

>3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens}	Back alignment and structure

>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis}	Back alignment and structure

>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV}	Back alignment and structure

>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A*	Back alignment and structure

>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A	Back alignment and structure

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*	Back alignment and structure

>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp}	Back alignment and structure

>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A*	Back alignment and structure

>3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A*	Back alignment and structure

>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A*	Back alignment and structure

>3t7k_A RTT107, regulator of TY1 transposition protein 107; BRCT, DNA repair, phospho-peptide, protein binding; HET: SEP; 2.03A {Saccharomyces cerevisiae} PDB: 3t7j_A* 3t7i_A	Back alignment and structure

>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile}	Back alignment and structure

>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19	Back alignment and structure

>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis}	Back alignment and structure

>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A*	Back alignment and structure

>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2	Back alignment and structure

>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A*	Back alignment and structure

>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A	Back alignment and structure

>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}	Back alignment and structure

>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A*	Back alignment and structure

>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis}	Back alignment and structure

>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis}	Back alignment and structure

>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae}	Back alignment and structure

>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A*	Back alignment and structure

>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A	Back alignment and structure

>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0	Back alignment and structure

>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6	Back alignment and structure

>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A	Back alignment and structure

>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A	Back alignment and structure

>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A	Back alignment and structure

>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae}	Back alignment and structure

>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A	Back alignment and structure

>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311}	Back alignment and structure

>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6	Back alignment and structure

>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6	Back alignment and structure

>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum}	Back alignment and structure

>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile}	Back alignment and structure

>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25	Back alignment and structure

>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV}	Back alignment and structure

>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A*	Back alignment and structure

>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A	Back alignment and structure

>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii}	Back alignment and structure

>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii}	Back alignment and structure

>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A	Back alignment and structure

>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A	Back alignment and structure

>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida}	Back alignment and structure

>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0	Back alignment and structure

>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A	Back alignment and structure

>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A	Back alignment and structure

>3oq0_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A*	Back alignment and structure

>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii}	Back alignment and structure

>3qbz_A DDK kinase regulatory subunit DBF4; FHA domain,RAD53, replication checkpoint, cell cycle; 2.69A {Saccharomyces cerevisiae}	Back alignment and structure

>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6	Back alignment and structure

>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A	Back alignment and structure

>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A	Back alignment and structure

>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13	Back alignment and structure

>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A	Back alignment and structure

>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A	Back alignment and structure

>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A	Back alignment and structure

>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20	Back alignment and structure

>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1}	Back alignment and structure

>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas}	Back alignment and structure

>2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I	Back alignment and structure

>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0	Back alignment and structure

>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV}	Back alignment and structure

>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A	Back alignment and structure

>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens}	Back alignment and structure

>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli}	Back alignment and structure

>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis}	Back alignment and structure

>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa}	Back alignment and structure

>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6	Back alignment and structure

>3oq4_A DBF4, protein DNA52; DDK, BRCT, RAD53, replication checkpoint, FHA domain, regula subunit of DDK, CDC7, phosphorylation, nuclear; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6	Back alignment and structure

>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22	Back alignment and structure

>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus}	Back alignment and structure

>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii}	Back alignment and structure

>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A	Back alignment and structure

>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans}	Back alignment and structure

>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii}	Back alignment and structure

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A	Back alignment and structure

>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343}	Back alignment and structure

>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis}	Back alignment and structure

>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10	Back alignment and structure

>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18	Back alignment and structure

>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A*	Back alignment and structure

>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A	Back alignment and structure

>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens}	Back alignment and structure

>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3	Back alignment and structure

>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0	Back alignment and structure

>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6	Back alignment and structure

>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus}	Back alignment and structure

>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10	Back alignment and structure

>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A	Back alignment and structure

>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii}	Back alignment and structure

>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0	Back alignment and structure

>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp}	Back alignment and structure

>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0	Back alignment and structure

>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A*	Back alignment and structure

>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A	Back alignment and structure

>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A	Back alignment and structure

>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale}	Back alignment and structure

>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10	Back alignment and structure

>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A	Back alignment and structure

>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV}	Back alignment and structure

>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A	Back alignment and structure

>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0	Back alignment and structure

>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A	Back alignment and structure

>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A*	Back alignment and structure

>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A	Back alignment and structure

>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10	Back alignment and structure

>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii}	Back alignment and structure

>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0	Back alignment and structure

>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A*	Back alignment and structure

>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp}	Back alignment and structure

>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae}	Back alignment and structure

>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10	Back alignment and structure

>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A*	Back alignment and structure

>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A*	Back alignment and structure

>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A	Back alignment and structure

>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A	Back alignment and structure

>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A	Back alignment and structure

>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14	Back alignment and structure

>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A*	Back alignment and structure

>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A*	Back alignment and structure

>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15	Back alignment and structure

>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens}	Back alignment and structure

>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A	Back alignment and structure

>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0	Back alignment and structure

>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A	Back alignment and structure

>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14	Back alignment and structure

>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A*	Back alignment and structure

>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		387
d1ta0a_		181	c.108.1.16 (A:) Carboxy-terminal domain RNA polyme	6e-27
d1wf6a_		132	c.15.1.5 (A:) DNA topoisomerase II binding protein	1e-08
d1cdza_		96	c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Hom	2e-07
d1t15a2		102	c.15.1.3 (A:1758-1859) Breast cancer associated pr	1e-05
d1t15a1		109	c.15.1.3 (A:1649-1757) Breast cancer associated pr	3e-04

>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  103 bits (258), Expect = 6e-27
 Identities = 40/214 (18%), Positives = 80/214 (37%), Gaps = 45/214 (21%)

Query: 82  QRKLQLVLDLDHTLLHATDLDMLAPDDRDYLMKRESSASDGGGLFMMDGGLLLVKLRPYI 141
             K+ +V+DLD TL+H++   +   D    +                    + V  RP++
Sbjct: 13  SDKICVVIDLDETLVHSSFKPVNNADFIIPVE------------IDGVVHQVYVLKRPHV 60

Query: 142 RSFLKEACKMYDIYICTMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFKDTGKKNLDLV 201
             FL+   ++++  + T     YA+ +A LLD    +       +C   +    K+L  +
Sbjct: 61  DEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRL 120

Query: 202 LGQERGVVIVDDTAEVWKDHKENLILVGKYNYFKERIRKSKNNDQKSYSERKSDESELNG 261
               R V+I+D++   +  H +N + V                   S+ +  SD      
Sbjct: 121 GRDLRRVLILDNSPASYVFHPDNAVPV------------------ASWFDNMSDT----- 157

Query: 262 ALVNVLRVLKRVHELFFENPENLVWGDVRSFLAK 295
            L ++L   +++  +           DV S L +
Sbjct: 158 ELHDLLPFFEQLSRV----------DDVYSVLRQ 181

PyMOL of d1ta0a_

>d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 132	Back information, alignment and structure

>d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 96	Back information, alignment and structure

>d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102	Back information, alignment and structure

>d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		387
d1ta0a_		181	Carboxy-terminal domain RNA polymerase II polypept	100.0
d1cdza_		96	DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta	99.68
d1wf6a_		132	DNA topoisomerase II binding protein 1, TopBP1 {Hu	99.67
d1t15a1		109	Breast cancer associated protein, BRCA1 {Human (Ho	99.65
d1t15a2		102	Breast cancer associated protein, BRCA1 {Human (Ho	99.63
d1l7ba_		92	NAD+-dependent DNA ligase, domain 4 {Thermus therm	99.31
d1in1a_		88	DNA ligase III alpha {Human (Homo sapiens) [TaxId:	99.3
d1kzyc1		153	53BP1 {Human (Homo sapiens) [TaxId: 9606]}	98.99
d1u7pa_		164	Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu	98.69
d1ltqa1		149	Polynucleotide kinase, phosphatase domain {Bacteri	98.24
d2hdoa1		207	Phosphoglycolate phosphatase {Lactobacillus planta	98.16
d2ah5a1		210	predicted phosphatase SP0104 {Streptococcus pneumo	98.12
d2go7a1		204	Hypothetical protein SP2064 {Streptococcus pneumon	98.1
d2hsza1		224	Phosphoglycolate phosphatase Gph {Haemophilus somn	98.08
d2feaa1		226	2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate	97.83
d2obba1		122	Hypothetical protein BT0820 {Bacteroides thetaiota	97.81
d2hcfa1		228	Hypothetical protein CT1708 {Chlorobium tepidum [T	97.79
d1l0ba2		97	Breast cancer associated protein, BRCA1 {Rat (Ratt	97.67
d2fi1a1		187	Putative hydrolase SP0805 {Streptococcus pneumonia	97.6
d1te2a_		218	Phosphatase YniC {Escherichia coli [TaxId: 562]}	97.24
d2fpwa1		161	Histidine biosynthesis bifunctional protein HisB,	97.2
d1kzyc2		106	53BP1 {Human (Homo sapiens) [TaxId: 9606]}	97.11
d1x42a1		230	Hypothetical protein PH0459 {Archaeon Pyrococcus h	97.08
d2o2xa1		209	Hypothetical protein Mll2559 {Mesorhizobium loti [	97.08
d2b0ca1		197	Putative phosphatase YihX {Escherichia coli [TaxId	96.96
d1cr6a1		222	Epoxide hydrolase, N-terminal domain {Mouse (Mus m	96.85
d1nnla_		217	Phosphoserine phosphatase {Human (Homo sapiens) [T	96.67
d1xpja_		124	Hypothetical protein VC0232 {Vibrio cholerae [TaxI	96.48
d2gfha1		247	N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m	96.43
d1swva_		257	Phosphonoacetaldehyde hydrolase {Bacillus cereus [	96.28
d1zs9a1		253	E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	95.83
d2gmwa1		182	D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc	95.67
d1yj5a1		195	5' polynucleotide kinase-3' phosphatase, middle do	95.61
d2amya1		243	Phosphomannomutase 2 {Human (Homo sapiens) [TaxId:	95.09
d1zrna_		220	L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s	95.07
d1xvia_		232	Putative mannosyl-3-phosphoglycerate phosphatase M	94.7
d2fdra1		222	Hypothetical protein Atu0790 {Agrobacterium tumefa	94.56
d1o08a_		221	beta-Phosphoglucomutase {Lactococcus lactis [TaxId	94.25
d1vjra_		261	Hypothetical protein TM1742 {Thermotoga maritima [	93.71
d2c4na1		250	NagD {Escherichia coli [TaxId: 562]}	93.44
d2fuea1		244	Phosphomannomutase 1 {Human (Homo sapiens) [TaxId:	93.41
d1rkqa_		271	Hypothetical protein YidA {Escherichia coli [TaxId	93.4
d1wr8a_		230	Phosphoglycolate phosphatase, PGPase {Pyrococcus h	93.37
d1nf2a_		267	Hypothetical protein TM0651 {Thermotoga maritima [	92.92
d1qq5a_		245	L-2-Haloacid dehalogenase, HAD {Xanthobacter autot	92.89
d1l6ra_		225	Phosphoglycolate phosphatase, PGPase {Archaeon The	92.81
d1wzca1		243	Putative mannosyl-3-phosphoglycerate phosphatase M	92.38
d1wvia_		253	Putative phosphatase SMU.1415c {Streptococcus muta	92.11
d1nrwa_		285	Hypothetical protein YwpJ {Bacillus subtilis [TaxI	91.67
d1s2oa1		244	Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc	91.29
d2b30a1		283	PFL1270w orthologue {Plasmodium vivax [TaxId: 5855	91.2
d1yv9a1		253	Putative hydrolase EF1188 {Enterococcus faecalis [	90.99
d1j97a_		210	Phosphoserine phosphatase {Archaeon Methanococcus	90.23
d2b82a1		209	Class B acid phosphatase, AphA {Escherichia coli [	90.14
d1u02a_		229	Trehalose-6-phosphate phosphatase related protein	90.06
d1zd3a1		225	Epoxide hydrolase, N-terminal domain {Human (Homo	88.24
d1rlma_		269	Sugar phosphatase SupH (YbiV) {Escherichia coli [T	88.04
d2bdua1		291	Cytosolic 5'-nucleotidase III {Mouse (Mus musculus	85.43

>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.3e-39  Score=292.08  Aligned_cols=170  Identities=22%  Similarity=0.273  Sum_probs=140.0

Q ss_pred             hhhcCCceEEEEeCCCceeeeecCCCCCccchhhhcccccCCCCCCceeeecCceEEEeeCccHHHHHHHHhhcccEEEE
Q 036523           78 IVFGQRKLQLVLDLDHTLLHATDLDMLAPDDRDYLMKRESSASDGGGLFMMDGGLLLVKLRPYIRSFLKEACKMYDIYIC  157 (387)
Q Consensus        78 ~l~~~~kl~LVLDLD~TLihs~~~~~~~~~~~~~~~~~~~~~~d~~~~f~l~~~~~~v~lRPgl~eFL~~ls~~yel~Iy  157 (387)
                      +....+|++||||||||||||+..+...+    +....        ..+......+||++|||+++||+.++++|||+||
T Consensus         9 ~~~~~~k~~LVLDLDeTLihs~~~~~~~~----~~~~~--------~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~   76 (181)
T d1ta0a_           9 KAQDSDKICVVIDLDETLVHSSFKPVNNA----DFIIP--------VEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLF   76 (181)
T ss_dssp             CGGGTTSCEEEECCBTTTEEEESSCCTTC----SEEEE--------EEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEE
T ss_pred             CcccCCCeEEEEeCCCCEEccccCCCCCc----cceee--------ecccceeeeeEEecCCCHHHHHHHHHhceEEEEE
Confidence            34567899999999999999986432111    11100        0111224568999999999999999999999999


Q ss_pred             cCCcHHHHHHHHHHcCCCCceeecccEEeccCCC---CCceeccccccCCCCCeEEEeCChhhhhcCCCCeeEeccccch
Q 036523          158 TMGNRHYAEMIAKLLDPKCEYYISSRLITCEDFK---DTGKKNLDLVLGQERGVVIVDDTAEVWKDHKENLILVGKYNYF  234 (387)
Q Consensus       158 T~g~~~YA~~i~~~LDP~~~~F~~~Ri~srd~~~---~~~~KdL~~l~~~~~~vvIiDD~~~~w~~~~~N~I~I~~y~ff  234 (387)
                      |+|+++||++|++.|||++. | ..++ +|++|.   ..+.|||+.+++++++||||||++.+|..|++|+|+|+||   
T Consensus        77 Ta~~~~YA~~il~~ldp~~~-~-~~~~-~r~~c~~~~~~~~KdL~~l~~~l~~vvivDd~~~~~~~~~~N~I~I~~f---  150 (181)
T d1ta0a_          77 TASLAKYADPVADLLDKWGA-F-RARL-FRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASW---  150 (181)
T ss_dssp             CSSCHHHHHHHHHHHCSSCC-E-EEEE-CGGGSEEETTEEECCGGGSCSCGGGEEEECSCGGGGTTCGGGBCCCCCC---
T ss_pred             cCCcHHHHHHHHHHhccCCc-e-eEEE-EeeeeeecCCcccccHhhcCCCHHHeEEEcCChhhhhcCccCeeEecCc---
Confidence            99999999999999999985 4 3555 488885   4578999999999999999999999999999999999999   


Q ss_pred             hhhhhhccCCCCccccccccCchhhhHHHHHHHHHHHHHHhhhhcCCCccccCchhhhHHH
Q 036523          235 KERIRKSKNNDQKSYSERKSDESELNGALVNVLRVLKRVHELFFENPENLVWGDVRSFLAK  295 (387)
Q Consensus       235 ~~~~~~~~~~~~~s~~~~~~d~~~~D~~L~~l~~~L~~ih~~ff~~~~~~~~~DVr~il~~  295 (387)
                              .            .+.+|++|..|+++|++++.          .+|||++|++
T Consensus       151 --------~------------~~~~D~eL~~l~~~L~~l~~----------~~DVR~~l~~  181 (181)
T d1ta0a_         151 --------F------------DNMSDTELHDLLPFFEQLSR----------VDDVYSVLRQ  181 (181)
T ss_dssp             --------S------------SCTTCCHHHHHHHHHHHHTT----------CSCHHHHHCC
T ss_pred             --------C------------CCCCcHHHHHHHHHHHHHcc----------CCcHHHHhcC
Confidence                    2            13579999999999999987          8999999864

PyMOL of d1ta0a_

>d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]}	Back information, alignment and structure

>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]}	Back information, alignment and structure

>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure

>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]}	Back information, alignment and structure

>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]}	Back information, alignment and structure

>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]}	Back information, alignment and structure

>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure