Citrus Sinensis ID: 036551

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450---
MPRLRLFMRATGRRRRRLMKTTTVVTPVWLGWCENLLETGDIESWEAVRQRSKLKKRRQRRHLLLLHRSRLPTTSTGAVNPDWSGFQAYSPMPPHGFLASSPQAHPYMWGVQHIMPPYGTPPHPYVAMYPHGGIYAHPSIPPGSYPFSPFAMPSPNGIVEASGNTPGSMEADGKPSDAKEKLPIKRSKGSLGSLNMITGKNNDLGKASGASANGAYSKSAESGSEGTSEGSDANSQNGSQLKSGGGHDSLEGETSQNGSSANDPQNGGASTPHAMVNQSMAIVPMSGPGAPVAVPGPTTNLNIGMDYWGASAANIPAMRGKVPSTPVAGGIVAGGSRDSVQSQLWLQDERELKRQRRKQSNRESARRSRLRKQAECDELAQRADALKEENASLRSEVTRIRNEYEQLLAENASLKERLGEIPVQEDERSVRNDQHLNNDTQQTGHSDLVQSGH
cccHHHHHHHHHHHHHHccccccEEccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccc
cccHHHHHHHccHHHHHHHccccEcccHHHHHHHHHHccccccHHHHHHHHccccccccccccccEccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccc
MPRLRLFMRATGRRRRRLMKTTTVVTPVWLGWCENLletgdiesWEAVRQRSKLKKRRQRRHLLLLHrsrlpttstgavnpdwsgfqayspmpphgflasspqahpymwgvqhimppygtpphpyvamyphggiyahpsippgsypfspfampspngiveasgntpgsmeadgkpsdakeklpikrskgslgslnmitgknndlgkasgasangaysksaesgsegtsegsdansqngsqlksggghdslegetsqngssandpqnggastphamvNQSMaivpmsgpgapvavpgpttnlnigmdywgasaanipamrgkvpstpvaggivaggsrdsvQSQLWLQDERELKRQRRKQSNRESARRSRLRKQAECDELAQRADALKEENASLRSEVTRIRNEYEQLLAENASLKerlgeipvqedersvrndqhlnndtqqtghsdlvqsgh
mprlrlfmratgrrrrrlmktttvvtpvwlgWCENLletgdiesweaVRQRSklkkrrqrrhllllhrsrlpttstgavnpDWSGFQAYSPMPPHGFLASSPQAHPYMWGVQHIMPPYGTPPHPYVAMYPHGGIYAHPSIPPGSYPFSPFAMPSPNGIVEASGNTPGSMEAdgkpsdakeklpikrskgslgslnMITGKNNDLGKASGASANGAYSKSAESGSEGTSEGSDANSQNGSQLKSGGGHDSLEGETSQNGSSANDPQNGGASTPHAMVNQSMAIVPMSGPGAPVAVPGPTTNLNIGMDYWGASAANIPAMRGKVPSTPVAGGIVAggsrdsvqsqlwlqderelkrqrrkqsnresarrsrlrkqaeCDELAQRadalkeenaslrsevTRIRNEYEQLLAenaslkerlgeipvqedersvrndqhlnndtqqtghsdlvqsgh
MPrlrlfmratgrrrrrlmktttvvtPVWLGWCENLLETGDIESWEAVrqrsklkkrrqrrhllllhrsrlPTTSTGAVNPDWSGFQAYSPMPPHGFLASSPQAHPYMWGVQHIMPPYGTPPHPYVAMYPHGGIYAHPSIPPGSYPFSPFAMPSPNGIVEASGNTPGSMEADGKPSDAKEKLPIKRSKGSLGSLNMITGKNNDLGKASGASANGAYsksaesgsegtsegsDANSQNGSQLKSGGGHDSLEGETSQNGSSANDPQNGGASTPHAMVNQSMAIVPMSgpgapvavpgpTTNLNIGMDYWGASAANIPAMRGKVPSTPVAGGIVAGGSRDSVQSQLWLQDERELKRQRRKQSNRESARRSRLRKQAECDELAQRADALKEENASLRSEVTRIRNEYEQLLAENASLKERLGEIPVQEDERSVRNDQHLNNDTQQTGHSDLVQSGH
**************RRRLMKTTTVVTPVWLGWCENLLETGDIESWEAVR************HLLLLHR**********VNPDWSGFQAY*******FLA***QAHPYMWGVQHIMPPYGTPPHPYVAMYPHGGIYAHPSI************************************************************************************************************************************************************PTTNLNIGMDYWGASAANIPAMR*********GGIV*************************************************************************************************************************
**RLRLFMRATGRRRRRLMKTTTVVTPVWLGWCENLLETGDI****************************************WSGFQAYSPMPPHGFLA****************************MY*****************************************************************************************************************************************************************************************************************************************************ECDELAQRADALKEENASLRSEVTRIRNEYEQLLAENAS****************************************
MPRLRLFMRATGRRRRRLMKTTTVVTPVWLGWCENLLETGDIESWE************QRRHLLLLHRSRLPTTSTGAVNPDWSGFQAYSPMPPHGFLASSPQAHPYMWGVQHIMPPYGTPPHPYVAMYPHGGIYAHPSIPPGSYPFSPFAMPSPNGIVEASGN****************KLPIKRSKGSLGSLNMITGKNNDLGKAS***************************************************************PHAMVNQSMAIVPMSGPGAPVAVPGPTTNLNIGMDYWGASAANIPAMRGKVPSTPVAGGIVAGGSRDSVQSQLWLQDE****************************ELAQRADALKEENASLRSEVTRIRNEYEQLLAENASLKERLGEIPVQEDERSVRNDQHLNNDTQQ***********
****RLFMRATGRRRRRLMKTTTVVTPVWLGWCENLLETGDIESWEAVRQR***********************STGAVNPDWSGFQAYSPMPPHGFLASSPQAHPYMWGVQHIMPPYGTPPHPYVAMYPHGGIYAHPSIPPGSYPFSPFAMPSPNGI*E********************************************************************************************************************************GAPVAVPGPT***NIGMDYWGASA***********************************D****KRQR**************RKQAECDELAQRADALKEENASLRSEVTRIRNEYEQLLAENASLKER************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRLRLFMRATGRRRRRLMKTTTVVTPVWLGWCENLLETGDIESWEAVRQRSKLKKRRQRRHLLLLHRSRLPTTSTGAVNPDWSGFQAYSPMPPHGFLASSPQAHPYMWGVQHIMPPYGTPPHPYVAMYPHGGIYAHPSIPPGSYPFSPFAMPSPNGIVEASGNTPGSMEADGKPSDAKEKLPIKRSKGSLGSLNMITGKNNDLGKASGASANGAYSKSAESGSEGTSEGSDANSQNGSQLKSGGGHDSLEGETSQNGSSANDPQNGGASTPHAMVNQSMAIVPMSGPGAPVAVPGPTTNLNIGMDYWGASAANIPAMRGKVPSTPVAGGIVAGGSRDSVQSQLWLQDERELKRQRRKQSNRESARRSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLGEIPVQEDERSVRNDQHLNNDTQQTGHSDLVQSGH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query453 2.2.26 [Sep-21-2011]
P23922349 Transcription factor HBP- N/A no 0.626 0.813 0.463 3e-55
P42774315 G-box-binding factor 1 OS no no 0.604 0.869 0.369 1e-38
Q99089411 Common plant regulatory f N/A no 0.662 0.729 0.347 9e-35
P42776382 G-box-binding factor 3 OS no no 0.637 0.756 0.332 3e-34
Q99142265 Transcriptional activator N/A no 0.569 0.973 0.351 1e-25
P42775360 G-box-binding factor 2 OS no no 0.611 0.769 0.319 2e-21
P25032354 DNA-binding protein EMBP- N/A no 0.357 0.457 0.406 4e-18
Q99091296 Light-inducible protein C N/A no 0.110 0.168 0.616 2e-16
P24068151 Ocs element-binding facto N/A no 0.152 0.456 0.434 3e-07
Q54Y73 834 Probable basic-leucine zi yes no 0.141 0.076 0.406 1e-06
>sp|P23922|HBP1A_WHEAT Transcription factor HBP-1a OS=Triticum aestivum PE=2 SV=1 Back     alignment and function desciption
 Score =  216 bits (550), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 163/352 (46%), Positives = 208/352 (59%), Gaps = 68/352 (19%)

Query: 75  STGAVNPDWSGFQAYSPMPPHGFL---ASSPQAHPYMWGVQHIMPPYGTPPHPYVAMYPH 131
           +T  V P+W GFQ Y  MPPHGF     ++ QAHPYMWG QH++PPYGTPP PY+     
Sbjct: 28  TTAPVYPEWPGFQGYPAMPPHGFFPPPVAAGQAHPYMWGPQHMVPPYGTPPPPYMMYP-P 86

Query: 132 GGIYAHPSIPPGSYPFSPFAMPSPNGIVEASGNTPGSM---EADGKPSDAKEKLPIKRSK 188
           G +YAHP+ P G +PF  + M + NG +E +G    +    E +GK              
Sbjct: 87  GTVYAHPTAP-GVHPFH-YPMQT-NGNLEPAGAQGAAPGAAETNGK-------------- 129

Query: 189 GSLGSLNMITGKNNDLGKASGASANGAYSKSAESGSEGTSEGSDANSQNGSQLKSGGGHD 248
                        N+ GK SG SANG  S S       +   SDANSQN S  K      
Sbjct: 130 -------------NEPGKTSGPSANGVTSNSESGSDSESEG-SDANSQNDSHSK------ 169

Query: 249 SLEGETSQNGSSANDPQNGGA-STPHAMVNQSMAIVPMSGPGAPVAVPGPTTNLNIGMDY 307
             E + ++NGS+    QNG + S+ H   N+ M +VP+   GA + V GP TNLNIGMDY
Sbjct: 170 --ENDVNENGSA----QNGVSHSSSHGTFNKPMPLVPVQS-GAVIGVAGPATNLNIGMDY 222

Query: 308 WGASAAN-IPAMRGKVPSTPVAGGIVAGGSRDSVQSQLWLQDERELKRQRRKQSNRESAR 366
           WGA+ ++ +PAMRGKVPS              S + + W  DERELK+Q+RK SNRESAR
Sbjct: 223 WGATGSSPVPAMRGKVPS-------------GSARGEQW--DERELKKQKRKLSNRESAR 267

Query: 367 RSRLRKQAECDELAQRADALKEENASLRSEVTRIRNEYEQLLAENASLKERL 418
           RSRLRKQAEC+EL QRA+ALK EN+SLR E+ RI+ EYE+LL++N SLK +L
Sbjct: 268 RSRLRKQAECEELGQRAEALKSENSSLRIELDRIKKEYEELLSKNTSLKAKL 319
Binds to the hexamer motif 5'-ACGTCA-3' of histone gene promoters.
Triticum aestivum (taxid: 4565)
>sp|P42774|GBF1_ARATH G-box-binding factor 1 OS=Arabidopsis thaliana GN=GBF1 PE=2 SV=2 Back     alignment and function description
>sp|Q99089|CPRF1_PETCR Common plant regulatory factor 1 OS=Petroselinum crispum GN=CPRF1 PE=2 SV=1 Back     alignment and function description
>sp|P42776|GBF3_ARATH G-box-binding factor 3 OS=Arabidopsis thaliana GN=GBF3 PE=1 SV=2 Back     alignment and function description
>sp|Q99142|TAF1_TOBAC Transcriptional activator TAF-1 (Fragment) OS=Nicotiana tabacum GN=TAF1 PE=2 SV=1 Back     alignment and function description
>sp|P42775|GBF2_ARATH G-box-binding factor 2 OS=Arabidopsis thaliana GN=GBF2 PE=1 SV=1 Back     alignment and function description
>sp|P25032|EMBP1_WHEAT DNA-binding protein EMBP-1 OS=Triticum aestivum PE=1 SV=1 Back     alignment and function description
>sp|Q99091|CPRF3_PETCR Light-inducible protein CPRF3 OS=Petroselinum crispum GN=CPRF3 PE=2 SV=1 Back     alignment and function description
>sp|P24068|OCS1_MAIZE Ocs element-binding factor 1 OS=Zea mays GN=OBF1 PE=2 SV=2 Back     alignment and function description
>sp|Q54Y73|BZPD_DICDI Probable basic-leucine zipper transcription factor D OS=Dictyostelium discoideum GN=bzpD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query453
255555917405 DNA-binding protein EMBP-1, putative [Ri 0.830 0.928 0.810 1e-178
302398619406 BZIP domain class transcription factor [ 0.830 0.926 0.801 1e-176
302398635407 BZIP domain class transcription factor [ 0.821 0.914 0.805 1e-175
356531457414 PREDICTED: transcription factor HBP-1a [ 0.841 0.920 0.790 1e-173
356496180414 PREDICTED: transcription factor HBP-1a [ 0.841 0.920 0.781 1e-170
224074359400 predicted protein [Populus trichocarpa] 0.814 0.922 0.801 1e-170
224139026401 predicted protein [Populus trichocarpa] 0.821 0.927 0.810 1e-168
225427091413 PREDICTED: transcription factor HBP-1a [ 0.832 0.912 0.825 1e-168
147845138413 hypothetical protein VITISV_014255 [Viti 0.832 0.912 0.823 1e-167
449456733405 PREDICTED: transcription factor HBP-1a-l 0.779 0.871 0.808 1e-164
>gi|255555917|ref|XP_002518994.1| DNA-binding protein EMBP-1, putative [Ricinus communis] gi|223541981|gb|EEF43527.1| DNA-binding protein EMBP-1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  631 bits (1628), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 308/380 (81%), Positives = 343/380 (90%), Gaps = 4/380 (1%)

Query: 74  TSTGAVNPDWSGFQAYSPMPPHGFLASSPQAHPYMWGVQHIMPPYGTPPHPYVAMYPHGG 133
           T+TG VNPDW+GFQAYSP+PPHGF+ASSPQAHPYMWGVQ IMPPYGTPPHPYVAMYPH G
Sbjct: 30  TTTGTVNPDWTGFQAYSPIPPHGFVASSPQAHPYMWGVQPIMPPYGTPPHPYVAMYPHSG 89

Query: 134 IYAHPSIPPGSYPFSPFAMPSPNGIVEASGNTPGSMEADGKPSDAKEKLPIKRSKGSLGS 193
           IYAHPSIPPGSYPFSPFAMPSPNGI EASG TPG+ E DGKPSD KEKLPIKRSKGSLGS
Sbjct: 90  IYAHPSIPPGSYPFSPFAMPSPNGIAEASGYTPGNTEPDGKPSDVKEKLPIKRSKGSLGS 149

Query: 194 LNMITGKNNDLGKASGASANGAYSKSAESGSEGTSEGSDANSQNGSQLKSGGGHDSLEGE 253
           LNMITGKNN+LGK SGASANGAYSKSAESGSEGTSEGSDANSQN SQ+KSGG  DS +  
Sbjct: 150 LNMITGKNNELGKTSGASANGAYSKSAESGSEGTSEGSDANSQNDSQMKSGGRQDSEDA- 208

Query: 254 TSQNGSSANDPQNGGASTPHAMVNQSMAIVPMSGPGAPVAVPGPTTNLNIGMDYWGASAA 313
            SQNG SA+  QNGG +  + ++NQ+M+IVP+S  GAP A+PGP TNLNIGMDYWGA+++
Sbjct: 209 -SQNGGSAHGLQNGGQA--NTVMNQTMSIVPISATGAPGALPGPATNLNIGMDYWGATSS 265

Query: 314 NIPAMRGKVPSTPVAGGIVAGGSRDSVQSQLWLQDERELKRQRRKQSNRESARRSRLRKQ 373
            IPA+RGKVPSTPVAGG+V  GSRD+VQSQLWLQDERELKRQRRKQSNRESARRSRLRKQ
Sbjct: 266 AIPAIRGKVPSTPVAGGVVTPGSRDAVQSQLWLQDERELKRQRRKQSNRESARRSRLRKQ 325

Query: 374 AECDELAQRADALKEENASLRSEVTRIRNEYEQLLAENASLKERLGEIPVQEDERSVRND 433
           AECDELAQRA+ALKEENA+LRSEV RI++EYEQLLAENASLKERLGEIP  +D R+ RND
Sbjct: 326 AECDELAQRAEALKEENANLRSEVNRIKSEYEQLLAENASLKERLGEIPGNDDLRASRND 385

Query: 434 QHLNNDTQQTGHSDLVQSGH 453
           QHL+NDTQ+T  +++VQ+GH
Sbjct: 386 QHLSNDTQKTEQTEIVQAGH 405

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302398619|gb|ADL36604.1| BZIP domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|302398635|gb|ADL36612.1| BZIP domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|356531457|ref|XP_003534294.1| PREDICTED: transcription factor HBP-1a [Glycine max] Back     alignment and taxonomy information
>gi|356496180|ref|XP_003516948.1| PREDICTED: transcription factor HBP-1a [Glycine max] Back     alignment and taxonomy information
>gi|224074359|ref|XP_002304358.1| predicted protein [Populus trichocarpa] gi|222841790|gb|EEE79337.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224139026|ref|XP_002326749.1| predicted protein [Populus trichocarpa] gi|222834071|gb|EEE72548.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225427091|ref|XP_002276625.1| PREDICTED: transcription factor HBP-1a [Vitis vinifera] gi|297742030|emb|CBI33817.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147845138|emb|CAN81625.1| hypothetical protein VITISV_014255 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449456733|ref|XP_004146103.1| PREDICTED: transcription factor HBP-1a-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query453
TAIR|locus:2062455409 bZIP16 "basic region/leucine z 0.796 0.882 0.630 2e-120
TAIR|locus:2031705389 bZIP68 "basic region/leucine z 0.743 0.866 0.502 1e-82
TAIR|locus:2115250315 GBF1 "G-box binding factor 1" 0.247 0.355 0.491 2.5e-41
TAIR|locus:2124938360 GBF2 "G-box binding factor 2" 0.205 0.258 0.479 6.9e-26
TAIR|locus:2063020382 GBF3 "G-box binding factor 3" 0.686 0.814 0.295 2.6e-20
TAIR|locus:2009932196 bZIP58 "AT1G13600" [Arabidopsi 0.247 0.571 0.366 1.8e-10
TAIR|locus:2166650165 bZIP43 "AT5G38800" [Arabidopsi 0.176 0.484 0.387 1.4e-09
TAIR|locus:2018411173 bZIP44 "AT1G75390" [Arabidopsi 0.194 0.508 0.391 1.7e-09
TAIR|locus:2143191186 bZIP3 "AT5G15830" [Arabidopsis 0.167 0.408 0.405 1.7e-09
TAIR|locus:2827461166 bZIP48 "AT2G04038" [Arabidopsi 0.176 0.481 0.440 3.7e-09
TAIR|locus:2062455 bZIP16 "basic region/leucine zipper transcription factor 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1185 (422.2 bits), Expect = 2.0e-120, P = 2.0e-120
 Identities = 237/376 (63%), Positives = 275/376 (73%)

Query:    75 STGAVNPDWSGFQAYSPMPP-HGFLASSPQAHPYMWGVQHIMPPYGTPPHPYVAMYPHGG 133
             S G   PDWSGFQAYSPMPP HG++ASSPQ HPYMWGVQH+MPPYGTPPHPYVAMYP GG
Sbjct:    36 SAGMATPDWSGFQAYSPMPPPHGYVASSPQPHPYMWGVQHMMPPYGTPPHPYVAMYPPGG 95

Query:   134 IYAHPSIPPGSYPFSPFAMPSPNGIVEASGNTPGSMEADGKPSDAKEKLPIKRSKGSLGS 193
             +YAHPS+PPGSYP+SP+AMPSPNG+ E SGNT G  + D K S+ KEKLPIKRS+GSLGS
Sbjct:    96 MYAHPSMPPGSYPYSPYAMPSPNGMTEVSGNTTGGTDGDAKQSEVKEKLPIKRSRGSLGS 155

Query:   194 LNMITGKNNDLGKASGASANGAYXXXXXXXXXXXXXXXDANSQNGSQLKSGGGHDSLEGE 253
             LNMITGKNN+ GK SGASANGAY               D NSQN S    G G D  + E
Sbjct:   156 LNMITGKNNEPGKNSGASANGAYSKSGESASDGSSEGSDGNSQNDS----GSGLDGKDAE 211

Query:   254 T-SQNGSSANDPQNGGASTPHAMVNQSMAIVPMSXXXXXXXXXXXTTNLNIGMDYWGA-S 311
               S+NG SAN PQNG A TP   V+Q++ I+PM+            TNLNIGMDYWGA +
Sbjct:   212 AASENGGSANGPQNGSAGTPILPVSQTVPIMPMTAAGVPGP----PTNLNIGMDYWGAPT 267

Query:   312 AANIPAMRGKVPSTPVAGGIVAGGSRDSVQSQLWLQDERELKRQRRKQSNRESARRSRLR 371
             +A IP M GKV STPV G +VA GSRD   SQ WLQD+RELKRQRRKQSNRESARRSRLR
Sbjct:   268 SAGIPGMHGKV-STPVPG-VVAPGSRDGGHSQPWLQDDRELKRQRRKQSNRESARRSRLR 325

Query:   372 KQAECDELAQRADALKEENASLRSEVTRIRNEYEQLLAENASLKERLGEIPVQEDERSVR 431
             KQAECDELAQRA+ L EEN +LR+E+ +++++ E+L  EN SLK++L   P  E   S+ 
Sbjct:   326 KQAECDELAQRAEVLNEENTNLRAEINKLKSQCEELTTENTSLKDQLSLFPPLEGI-SMD 384

Query:   432 NDQHLNNDTQQTGHSD 447
             ND H   DT QTG ++
Sbjct:   385 ND-HQEPDTNQTGAAE 399
GO:0003677 "DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA;IDA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0006473 "protein acetylation" evidence=RCA
TAIR|locus:2031705 bZIP68 "basic region/leucine zipper transcription factor 68" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115250 GBF1 "G-box binding factor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124938 GBF2 "G-box binding factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063020 GBF3 "G-box binding factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009932 bZIP58 "AT1G13600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166650 bZIP43 "AT5G38800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018411 bZIP44 "AT1G75390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143191 bZIP3 "AT5G15830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827461 bZIP48 "AT2G04038" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_III000762
hypothetical protein (400 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query453
pfam07777189 pfam07777, MFMR, G-box binding protein MFMR 8e-70
smart0033865 smart00338, BRLZ, basic region leucin zipper 2e-24
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 1e-23
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 4e-14
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 1e-10
pfam0218345 pfam02183, HALZ, Homeobox associated leucine zippe 2e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
COG1340 294 COG1340, COG1340, Uncharacterized archaeal coiled- 3e-04
pfam05557 722 pfam05557, MAD, Mitotic checkpoint protein 3e-04
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 4e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 7e-04
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 7e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 0.001
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
pfam0313193 pfam03131, bZIP_Maf, bZIP Maf transcription factor 0.002
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 0.002
COG2433 652 COG2433, COG2433, Uncharacterized conserved protei 0.003
PRK13922 276 PRK13922, PRK13922, rod shape-determining protein 0.004
COG4942 420 COG4942, COG4942, Membrane-bound metallopeptidase 0.004
>gnl|CDD|219569 pfam07777, MFMR, G-box binding protein MFMR Back     alignment and domain information 
 Score =  219 bits (559), Expect = 8e-70
 Identities = 108/178 (60%), Positives = 127/178 (71%), Gaps = 12/178 (6%)

Query: 69  SRLPTTSTGAVNPDWSGFQAYSPM-PPHGF----LASSPQAHPYMWG-VQHIMPPYGTPP 122
           S    T T  V PDWS  QAY    PP  +    +ASSPQ HPYMWG  Q +MPPYGTP 
Sbjct: 17  SVQEDTPTPTVYPDWSAMQAYYGPRPPPPYFNSSVASSPQPHPYMWGPQQPMMPPYGTP- 75

Query: 123 HPYVAMYPHGGIYAHPSIPPGSYPFSPFAMPSPNGIVEASGNTPGSMEADGKPSDAKEKL 182
            PY AMYP GG+YAHPS+PPGS+PFSP+AMPS     E  G+TP SME D K SD K+K 
Sbjct: 76  PPYAAMYPPGGVYAHPSMPPGSHPFSPYAMPSA----EVPGSTPLSMETDAKSSDNKDKG 131

Query: 183 PIKRSKGSLGSLNM-ITGKNNDLGKASGASANGAYSKSAESGSEGTSEGSDANSQNGS 239
            IK+SKGS GSL + ++GKN + GKASG+SANG  S+S+ESGS+G+SEGSD NSQN S
Sbjct: 132 SIKKSKGSDGSLGLAMSGKNGESGKASGSSANGGSSQSSESGSDGSSEGSDGNSQNAS 189

This region is found to the N-terminus of the pfam00170 transcription factor domain. It is between 150 and 200 amino acids in length. The N-terminal half is rather rich in proline residues and has been termed the PRD (proline rich domain), whereas the C-terminal half is more polar and has been called the MFMR (multifunctional mosaic region). It has been suggested that this family is composed of three sub-families called A, B and C, classified according to motif composition. It has been suggested that some of these motifs may be involved in mediating protein-protein interactions. The MFMR region contains a nuclear localisation signal in bZIP opaque and GBF-2. The MFMR also contains a transregulatory activity in TAF-1. The MFMR in CPRF-2 contains cytoplasmic retention signals. Length = 189
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|202143 pfam02183, HALZ, Homeobox associated leucine zipper Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|190534 pfam03131, bZIP_Maf, bZIP Maf transcription factor Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|237560 PRK13922, PRK13922, rod shape-determining protein MreC; Provisional Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 453
PF07777189 MFMR: G-box binding protein MFMR; InterPro: IPR012 100.0
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.44
smart0033865 BRLZ basic region leucin zipper. 99.36
KOG3584348 consensus cAMP response element binding protein an 99.32
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 99.16
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.16
KOG0709 472 consensus CREB/ATF family transcription factor [Tr 99.13
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.06
KOG0837279 consensus Transcriptional activator of the JUN fam 98.32
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.25
KOG4571294 consensus Activating transcription factor 4 [Trans 97.89
KOG3119269 consensus Basic region leucine zipper transcriptio 97.87
KOG4196135 consensus bZIP transcription factor MafK [Transcri 97.25
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 96.38
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 96.26
PRK10884206 SH3 domain-containing protein; Provisional 96.08
PRK13169110 DNA replication intiation control protein YabA; Re 95.86
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 95.48
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 95.4
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 95.04
COG307479 Uncharacterized protein conserved in bacteria [Fun 94.97
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 94.95
PRK10884206 SH3 domain-containing protein; Provisional 94.82
TIGR0244965 conserved hypothetical protein TIGR02449. Members 94.73
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 94.7
TIGR0244965 conserved hypothetical protein TIGR02449. Members 94.69
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 94.55
COG4467114 Regulator of replication initiation timing [Replic 94.26
KOG1414 395 consensus Transcriptional activator FOSB/c-Fos and 93.81
PRK1542279 septal ring assembly protein ZapB; Provisional 93.73
PF1374789 DUF4164: Domain of unknown function (DUF4164) 93.46
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 93.4
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 93.32
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 93.29
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 93.25
COG4026290 Uncharacterized protein containing TOPRIM domain, 93.11
KOG1962216 consensus B-cell receptor-associated protein and r 93.07
COG307479 Uncharacterized protein conserved in bacteria [Fun 92.71
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 92.43
PRK13922 276 rod shape-determining protein MreC; Provisional 91.81
PRK0211973 hypothetical protein; Provisional 91.73
PF10186 302 Atg14: UV radiation resistance protein and autopha 91.7
PRK0432574 hypothetical protein; Provisional 91.69
PRK0279372 phi X174 lysis protein; Provisional 91.69
PRK1542279 septal ring assembly protein ZapB; Provisional 91.68
smart0033865 BRLZ basic region leucin zipper. 91.61
PRK0073668 hypothetical protein; Provisional 91.6
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 91.53
PRK0029568 hypothetical protein; Provisional 91.49
PRK0440675 hypothetical protein; Provisional 91.24
PRK00888105 ftsB cell division protein FtsB; Reviewed 91.15
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 90.92
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 90.79
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 90.77
PRK11637 428 AmiB activator; Provisional 90.65
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 90.6
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 90.26
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 89.52
KOG3335181 consensus Predicted coiled-coil protein [General f 89.48
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 89.29
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 89.13
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 88.99
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 88.94
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 88.87
PRK11637 428 AmiB activator; Provisional 88.83
PRK0084677 hypothetical protein; Provisional 88.83
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 88.54
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 88.0
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 87.66
PF09789 319 DUF2353: Uncharacterized coiled-coil protein (DUF2 87.45
COG2433 652 Uncharacterized conserved protein [Function unknow 87.39
KOG4196135 consensus bZIP transcription factor MafK [Transcri 87.02
COG4026290 Uncharacterized protein containing TOPRIM domain, 86.8
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 86.77
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 86.66
PF14662193 CCDC155: Coiled-coil region of CCDC155 86.53
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 86.37
PRK13169110 DNA replication intiation control protein YabA; Re 86.21
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 86.02
PF05103131 DivIVA: DivIVA protein; InterPro: IPR007793 The Ba 86.01
PRK12704 520 phosphodiesterase; Provisional 85.77
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 85.57
COG4942 420 Membrane-bound metallopeptidase [Cell division and 85.31
KOG3119269 consensus Basic region leucine zipper transcriptio 85.24
PF09738 302 DUF2051: Double stranded RNA binding protein (DUF2 85.17
PRK00888105 ftsB cell division protein FtsB; Reviewed 85.17
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 85.12
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 85.05
PF1270987 Kinetocho_Slk19: Central kinetochore-associated; I 85.0
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 84.89
PF10186 302 Atg14: UV radiation resistance protein and autopha 84.61
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 84.56
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 84.49
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 84.46
PF10669121 Phage_Gp23: Protein gp23 (Bacteriophage A118); Int 84.39
PHA02562 562 46 endonuclease subunit; Provisional 84.26
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 84.18
PF15294278 Leu_zip: Leucine zipper 84.11
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 84.02
PF13851201 GAS: Growth-arrest specific micro-tubule binding 84.01
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 83.94
KOG0982 502 consensus Centrosomal protein Nuf [Cell cycle cont 83.94
TIGR0220985 ftsL_broad cell division protein FtsL. This model 83.92
PF13815118 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting pro 83.87
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 83.8
PRK00106 535 hypothetical protein; Provisional 83.6
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 83.46
KOG1962216 consensus B-cell receptor-associated protein and r 83.07
KOG1103 561 consensus Predicted coiled-coil protein [Function 82.77
PRK10803 263 tol-pal system protein YbgF; Provisional 82.65
KOG3650120 consensus Predicted coiled-coil protein [General f 82.54
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 82.54
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 82.28
PF10226195 DUF2216: Uncharacterized conserved proteins (DUF22 82.17
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 82.17
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 82.13
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 82.0
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 81.98
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 81.71
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 81.66
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 81.59
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 81.57
PF15058 200 Speriolin_N: Speriolin N terminus 81.39
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 81.22
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 81.14
PRK0211973 hypothetical protein; Provisional 81.01
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 80.92
PF05529192 Bap31: B-cell receptor-associated protein 31-like 80.91
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 80.48
PF05529192 Bap31: B-cell receptor-associated protein 31-like 80.41
KOG2391365 consensus Vacuolar sorting protein/ubiquitin recep 80.15
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 80.15
>PF07777 MFMR: G-box binding protein MFMR; InterPro: IPR012900 This region is found to the N terminus of IPR011616 from INTERPRO, which is a transcription factor domain Back     alignment and domain information 
Probab=100.00  E-value=3.2e-62  Score=456.08  Aligned_cols=161  Identities=59%  Similarity=0.952  Sum_probs=144.5

Q ss_pred             CCCCCCCCCCcccccccCCC---CCCCC--CCCCCCCCCcccc-CCCCCCCCCCCCCCCccccCCCCcCCCCCCCCCCCC
Q 036551           73 TTSTGAVNPDWSGFQAYSPM---PPHGF--LASSPQAHPYMWG-VQHIMPPYGTPPHPYVAMYPHGGIYAHPSIPPGSYP  146 (453)
Q Consensus        73 ~~~~~~~yPDWs~mQAYy~~---pP~~f--~as~~~pHPYmWG-~Q~mmpPYGtP~~PY~A~Yp~GgvYAHP~mp~gs~P  146 (453)
                      .++++++||||++|||||++   |||||  +|++|+||||||| +|||||||||| |||+||||||||||||+||+|+||
T Consensus        22 ~~~~~~~ypDWs~mQAYyg~~~~p~~f~s~va~sp~phPYMWG~~q~mmPPYGtP-~pY~A~YphGgvYAHP~mp~~s~p  100 (189)
T PF07777_consen   22 DQPTPHVYPDWSAMQAYYGPGAPPPYFNSAVASSPQPHPYMWGPQQPMMPPYGTP-VPYPAMYPHGGVYAHPSMPPGSHP  100 (189)
T ss_pred             CCCCCccCCccHhhhhccCCCCCCcccCcccCCCCCCCCcccCCCccccCCCCCC-CCCccccCCCccccCCCCCccccc
Confidence            35667899999999999976   34434  6789999999999 57799999997 499999999999999999999999


Q ss_pred             CCCCCCCCCCcccccCCCCCCCccC-CCCCCCcccccccccccCCcCCcccccccCCCCCCCCCCCCCCCCCCCCCCCCC
Q 036551          147 FSPFAMPSPNGIVEASGNTPGSMEA-DGKPSDAKEKLPIKRSKGSLGSLNMITGKNNDLGKASGASANGAYSKSAESGSE  225 (453)
Q Consensus       147 ~~~~~~~sp~~~~~~~~~tp~s~E~-~~Kss~~kdk~~~Kk~Kg~~Gsl~m~~Gk~~~~gk~~g~s~n~~~SqS~esgse  225 (453)
                      |+++++++    .++.++|++++|+ ++|++++|||+++||||||||.|+|+|||++. +|++++++|++.|||+||++|
T Consensus       101 ~~~~~~~s----~~~~~~tp~s~E~~p~Kss~~kd~~~~KksKg~~g~~a~s~~n~~~-gk~~~~s~n~~~Sqs~eSgse  175 (189)
T PF07777_consen  101 FSPYAMPS----PETPAATPLSTETDPGKSSGNKDKGSMKKSKGFDGGLAMSIKNGES-GKTSGSSANDGSSQSSESGSE  175 (189)
T ss_pred             CCCccccc----ccccCCCCcccccccccCcCccccccccccccccccceeeccCCcc-CccccCCCCCccCcccccccc
Confidence            99999987    3455789999999 59999999999999999999878898886655 999999999999999999999


Q ss_pred             CCCCCCCCCccCCC
Q 036551          226 GTSEGSDANSQNGS  239 (453)
Q Consensus       226 gSSdgSD~Ns~~~s  239 (453)
                      |||||||+|+++++
T Consensus       176 gSSdgSD~Nt~~~~  189 (189)
T PF07777_consen  176 GSSDGSDGNTNNDS  189 (189)
T ss_pred             ccccCcCccccCCC
Confidence            99999999998764

It is between 150 and 200 amino acids in length. The N-terminal half is rather rich in proline residues and has been termed the PRD (proline rich domain) [], whereas the C-terminal half is more polar and has been called the MFMR (multifunctional mosaic region). It has been suggested that this family is composed of three sub-families called A, B and C [], classified according to motif composition. It has been suggested that some of these motifs may be involved in mediating protein-protein interactions []. The MFMR region contains a nuclear localisation signal in bZIP opaque and GBF-2 []. The MFMR also contains a transregulatory activity in TAF-1. The MFMR in CPRF-2 contains cytoplasmic retention signals []. ; GO: 0003677 DNA binding, 0006351 transcription, DNA-dependent, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG3335 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10669 Phage_Gp23: Protein gp23 (Bacteriophage A118); InterPro: IPR018926 This entry is represented by the major tail subunit protein, Gp23 of Listeria phage A118 and prophage found in Bacilli Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>TIGR02209 ftsL_broad cell division protein FtsL Back     alignment and domain information
>PF13815 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting protein N-terminal Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3650 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF15058 Speriolin_N: Speriolin N terminus Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query453
1t2k_D61 Structure Of The Dna Binding Domains Of Irf3, Atf-2 1e-04
>pdb|1T2K|D Chain D, Structure Of The Dna Binding Domains Of Irf3, Atf-2 And Jun Bound To Dna Length = 61 Back     alignment and structure 
Iteration: 1

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 34/55 (61%)
Query: 353 KRQRRKQSNRESARRSRLRKQAECDELAQRADALKEENASLRSEVTRIRNEYEQL 407
           KR++  + NR +A RSR +++     L ++A+ L   N  L+SEVT +RNE  QL
Sbjct: 1   KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQL 55

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query453
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 4e-19
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 8e-18
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 5e-16
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 1e-15
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 1e-15
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 2e-15
2wt7_B90 Transcription factor MAFB; transcription, transcri 8e-14
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 3e-13
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 3e-13
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 5e-13
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 3e-11
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 6e-04
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
 Score = 79.7 bits (197), Expect = 4e-19
 Identities = 14/56 (25%), Positives = 31/56 (55%)

Query: 352 LKRQRRKQSNRESARRSRLRKQAECDELAQRADALKEENASLRSEVTRIRNEYEQL 407
           +K+ ++ + N+ +A R R +K+AE + L      L+++N +L+     +  E + L
Sbjct: 1   MKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYL 56
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query453
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.46
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.35
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.34
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.27
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.25
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 99.16
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 99.1
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.85
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.78
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.67
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.32
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.55
1deb_A54 APC protein, adenomatous polyposis coli protein; c 96.4
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 95.92
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 95.75
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 95.54
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 95.1
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 95.01
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 94.92
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.64
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 93.98
3m48_A33 General control protein GCN4; leucine zipper, synt 93.71
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 93.59
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 93.38
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 93.37
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 93.31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.57
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 92.53
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 92.49
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 92.18
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 92.16
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 92.11
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 91.91
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 91.67
3m9b_A 251 Proteasome-associated ATPase; coil COIL with 5 bet 91.6
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 91.57
2wt7_B90 Transcription factor MAFB; transcription, transcri 91.55
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 91.25
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 91.18
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 91.12
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 91.07
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 91.07
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 90.99
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 90.99
2bni_A34 General control protein GCN4; four helix bundle, a 90.91
1uo4_A34 General control protein GCN4; four helix bundle, c 90.83
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 90.59
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 90.33
2hy6_A34 General control protein GCN4; protein design, para 90.09
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 89.93
4h22_A103 Leucine-rich repeat flightless-interacting protei; 89.54
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 89.46
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 89.46
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 89.39
3cve_A72 Homer protein homolog 1; coiled coil, alternative 89.37
3u06_A 412 Protein claret segregational; motor domain, stalk 88.33
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 87.12
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 86.71
1fmh_A33 General control protein GCN4; coiled coil, leucine 86.28
3htk_A60 Structural maintenance of chromosomes protein 5; S 85.95
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 85.71
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 85.4
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 85.27
3trt_A77 Vimentin; cytoskeleton, intermediate filament, alp 85.26
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 84.56
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 84.41
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 84.38
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 84.24
1jcd_A52 Major outer membrane lipoprotein; protein folding, 84.23
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 84.15
3m9b_A 251 Proteasome-associated ATPase; coil COIL with 5 bet 83.58
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 83.26
2zxx_A79 Geminin; coiled-coil, cell cycle, coiled coil, DNA 83.16
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 83.0
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 82.92
2j5u_A 255 MREC protein; bacterial cell shape determining pro 82.91
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 82.87
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 82.85
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 82.59
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 82.13
1gmj_A84 ATPase inhibitor; coiled-coil structure, P depende 81.38
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 81.25
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 81.13
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 80.73
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 80.39
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 80.12
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.46  E-value=7e-14  Score=107.32  Aligned_cols=53  Identities=34%  Similarity=0.515  Sum_probs=49.7

Q ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 036551          353 KRQRRKQSNRESARRSRLRKQAECDELAQRADALKEENASLRSEVTRIRNEYE  405 (453)
Q Consensus       353 KReRRKqsNRESARRSR~RKqaelEeLE~rVe~Le~EN~~Lr~el~~Lkee~~  405 (453)
                      ||++|+++||+||++||.||++|+++||.+|..|+.||..|..++..|++++.
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~~   53 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLYS   53 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTST
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            57899999999999999999999999999999999999999999999887653
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1fmh_A General control protein GCN4; coiled coil, leucine zipper, inter-helical ION pairing, transcription; NMR {Synthetic} SCOP: k.6.1.1 PDB: 1u2u_A Back     alignment and structure
>3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>2j5u_A MREC protein; bacterial cell shape determining protein MREC, cell shape regulation; 2.5A {Listeria monocytogenes} Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>1gmj_A ATPase inhibitor; coiled-coil structure, P dependent oligomerization, ATP hydrolysis; 2.2A {Bos taurus} SCOP: h.4.8.1 PDB: 1ohh_H* 1hf9_A Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 453
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.001
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

class: All alpha proteins
fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 38.2 bits (88), Expect = 0.001
 Identities = 15/78 (19%), Positives = 31/78 (39%), Gaps = 7/78 (8%)

Query: 341 QSQLWLQDERELKRQRRKQSNRESARRSRLRKQAECDELAQRADALKEENASLRSEVTRI 400
             Q+  Q ER  +   ++ + +    R +L K+ E       A  L+E+   L+      
Sbjct: 230 NEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQE----RTLALKLQEQEQLLKE---GF 282

Query: 401 RNEYEQLLAENASLKERL 418
           + E   +  E   L+ ++
Sbjct: 283 QKESRIMKNEIQDLQTKM 300

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query453
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 91.57
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 83.19
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 80.87
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=91.57  E-value=0.041  Score=42.88  Aligned_cols=27  Identities=30%  Similarity=0.561  Sum_probs=23.3

Q ss_pred             HHHHHHHHHhHHHHHHHHHHHHHHHHH
Q 036551          352 LKRQRRKQSNRESARRSRLRKQAECDE  378 (453)
Q Consensus       352 lKReRRKqsNRESARRSR~RKqaelEe  378 (453)
                      .+-.||+=+||.||+.||.||-...++
T Consensus        47 irDIRRRGKNKvAAqnCRKRKld~~d~   73 (74)
T d1sknp_          47 IRKIRRRGKNKVAARTCRQRRTDRHDK   73 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             HHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence            466889999999999999999887654
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure