Citrus Sinensis ID: 036642


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------94
MSGVLVFAFLLFELLAIATVSVSFSNGSSYHVGCLESERRALLRFKQDLQDPSNRLASWIGYEDCCAWAGVVCDNVTGHIVELNLRNPFTYCDLSQSKANPRSMLVGKVNPSLLDLKHLSYLDLSYNDFQGVQIPRFICSMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVENLWWLPGLSFLKDLDLSYVNLSKASDWLRVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPNWVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEISEIFDIFSGCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSLGHLSTLQFIDLSYNELNGMNDNWIPPFQLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYSGITGSIPNIFWSSASQIYVLDLSFNQIHGQIPNLTNAAQLEVLSLGSNSFSGALPLISSNLIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQNLMILDLSNNKFTGNLPISLGSLISLQSLHLRKNNLSGTIHSLKNCTALLTLDVGENEFVENIPTWIGERFSRMVVLILRSNKFHSLLPKGLCDLAFLQIVDLADNNLSGEVPRCIHNLRAMVTLNSHAGKAIQYQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNLVRIIDFSKNNFSGKIPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLESIDFSLNQLSGEIPQSMSSLTYLNHLNLSNNNLTGKIPSSTQLQSFDASSYAGNDLCGAPLPRNCSEHVSTPEDENGDEDELDYWLYVSIALGFMGGFWCLIGPLLASRRWRYKYYNFLDRVGDRIVFVNIRTDW
cccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHccccccccEEEccccccccccHHHHHHHcccccccccEEEcccccccccccHHHHccccccEEEccccccEEEccccccccccccEEEccccccccccccccccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEccccccEEccccccccccccEEEccccccEEccccccccccEEEcccccccccccHHHHHcccccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEcccccccEEcccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHcHHcccccccccccHHHHHHHHcccccccccEEEEEEEEEcccHHHHHcccccEEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccEEEEEEEEEEc
cHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccHHHccccccccccccHHHHccHcccEEEccccccccccccHHHcccccccEEEcccccccccccccHccccccEEEEccccccccccHHHHHccccccEEEccccccccccccHHHHccccccEEEEccccccccccccccccccccEEEEccccccccccccHHHHccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccHHcccccccEEEcccccccccccHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEccccccccccEEEEEEccccccccccHHHHccccccEEEcccccccccccHHHHHHcccccEEEcccccccccccccccccccEEEEEccccccccccccccccEEEEccccccccccccHcccccccccccEEEEEccccccccccHHHcccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccccccccEEEEEcccccccccccHHHHHcccccEEEEEccccccccccHHHHcccccEEEEcccccccccccHHHHcHHHHHHccccccccccccccccccccccHEEEHHHHHHccccccHHHHccccEEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHccHHHccHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEcc
MSGVLVFAFLLFELLAIATVSVsfsngssyhvgcLESERRALLRFKQdlqdpsnrlaswigyedccawagvvcdnVTGHIVelnlrnpftycdlsqskanprsmlvgkvnpslldlkhlsyldlsyndfqgvqiprficsmgnlryLNLSYTqfvgmippqlgnlsnlqyldlswNFLYvenlwwlpglsflkdldlsYVNLSKASDWLRVTNTLPSLVKLRLsrcqlhhlpplaianfstLTTLDLLYnqfdnsfvpnwVFGLIQLVFLDLrrnnfqgpipeglQNLTSLKHllldsnrfnssipNWLYRFNRLeslgvsnnslqGRVIRSMASLCNLRSVMLSCVKLSQEISEIFDIFSGCVSSGLEILVLRgssvsghltyklgqfknlyyldlsnnsivgpipfslghlstlqFIDLSYNElngmndnwippfqlatlglrhchlgsrfpswlhsqkhlnyldlsysgitgsipnifwssaSQIYVLDLsfnqihgqipnltnAAQLEVLSlgsnsfsgalplissnlieldfsnnsisgsIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQNLMildlsnnkftgnlpisLGSLISLQSLHLRKNNLSGTIHSLKNCTAlltldvgenefveniptwIGERFSRMVVLILRSNkfhsllpkglcdlAFLQIVDLadnnlsgevprCIHNLRAMVTLNSHAGKAIQYQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNLVRIIDfsknnfsgkipleVTNLKAlqsfnlsnnfftgripesigAMRSLESIDFSLnqlsgeipqsmsslTYLNHLnlsnnnltgkipsstqlqsfdassyagndlcgaplprncsehvstpedengdedelDYWLYVSIALGFMGGFWCLIGPLLASRRWRYKYYNFLDRVGDRIVFVNIRTDW
MSGVLVFAFLLFELLAIATVSVSFSNGSSYHVGCLESERRALLRFKQDLQDPSNRLASWIGYEDCCAWAGVVCDNVTGHIVELNLRNPFTYCDLSQSKANPRSMLVGKVNPSLLDLKHLSYLDLSYNDFQGVQIPRFICSMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVENLWWLPGLSFLKDLDLSYVNLskasdwlrvTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPNWVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEISEIFDIFSGCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSLGHLSTLQFIDLSYNELNGMNDNWIPPFQLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYSGITGSIPNIFWSSASQIYVLDLSFNQIHGQIPNLTNAAQLEVLSLGSNSFSGALPLISSNLIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQNLMILDLSNNKFTGNLPISLGSLISLQSLHLRKNNLSGTIHSLKNCTALLTLDVGENEFVENIPTWIGERFSRMVVLILRSNKFHSLLPKGLCDLAFLQIVDLADNNLSGEVPRCIHNLRAMVTLNSHAGKAIQYQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNLVRIIDFSKNNFSGKIPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLESIDFSLNQLSGEIPQSMSSLTYLNHLNLSNNNLTGKIPSSTQLQSFDASSYAGNDLCGAPLPRNCSEHVSTPEDENGDEDELDYWLYVSIALGFMGGFWCLIGPLLASRRWRYKYYNfldrvgdrivfvnirtdw
MSGvlvfafllfellaIATVSVSFSNGSSYHVGCLESERRALLRFKQDLQDPSNRLASWIGYEDCCAWAGVVCDNVTGHIVELNLRNPFTYCDLSQSKANPRSMLVGKVNPslldlkhlsyldlsyNDFQGVQIPRFICSMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVENLWWLPGLSFLKDLDLSYVNLSKASDWLRVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPNWVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEISEIFDIFSGCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSLGHLSTLQFIDLSYNELNGMNDNWIPPFQLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYSGITGSIPNIFWSSASQIYVLDLSFNQIHGQIPNLTNAAQLEVLSLGSNSFSGALPLISSNLIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQNLMILDLSNNKFTGNlpislgslislqslhlRKNNLSGTIHSLKNCTALLTLDVGENEFVENIPTWIGERFSRMVVLILRSNKFHSLLPKGLCDLAFLQIVDLADNNLSGEVPRCIHNLRAMVTLNSHAGKAIQYQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNLVRIIDFSKNNFSGKIPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLESIDFSLNQLSGEIPQSMssltylnhlnlsnnnlTGKIPSSTQLQSFDASSYAGNDLCGAPLPRNCSEHVSTPEDENGDEDELDYWLYVSIALGFMGGFWCLIGPLLASRRWRYKYYNFLDRVGDRIVFVNIRTDW
***VLVFAFLLFELLAIATVSVSFSNGSSYHVGCLESERRALLRFKQDLQDPSNRLASWIGYEDCCAWAGVVCDNVTGHIVELNLRNPFTYCDLSQS****RSMLVGKVNPSLLDLKHLSYLDLSYNDFQGVQIPRFICSMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVENLWWLPGLSFLKDLDLSYVNLSKASDWLRVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPNWVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEISEIFDIFSGCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSLGHLSTLQFIDLSYNELNGMNDNWIPPFQLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYSGITGSIPNIFWSSASQIYVLDLSFNQIHGQIPNLTNAAQLEVLSLGSNSFSGALPLISSNLIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQNLMILDLSNNKFTGNLPISLGSLISLQSLHLRKNNLSGTIHSLKNCTALLTLDVGENEFVENIPTWIGERFSRMVVLILRSNKFHSLLPKGLCDLAFLQIVDLADNNLSGEVPRCIHNLRAMVTLNSHAGKAIQYQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNLVRIIDFSKNNFSGKIPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLESIDFSLN************LTYLNHLNL*****************************************************LDYWLYVSIALGFMGGFWCLIGPLLASRRWRYKYYNFLDRVGDRIVFVNIR***
***VLVFAFLLFELLAIATVSVSFSNGS*****CLESERRALLRFKQDLQDPSNRLASWIGYEDCCAWAGVVCDNVTGHIVELNLRNPFTYCDLSQSKANPRSMLVGKVNPSLLDLKHLSYLDLSYNDFQGVQIPRFICSMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVENLWWLPGLSFLKDLDLSYVNLSKASDWLRVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPNWVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEISEIFDIFSGCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSLGHLSTLQFIDLSYNELNGMNDNWIPPFQLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYSGITGSIPNIFWSSASQIYVLDLSFNQIHGQIPNLTNAAQLEVLSLGSNSFSGALPLISSNLIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQNLMILDLSNNKFTGNLPISLGSLISLQSLHLRKNNLSGTIHSLKNCTALLTLDVGENEFVENIPTWIGERFSRMVVLILRSNKFHSLLPKGLCDLAFLQIVDLADNNLSGEVPRCIHNLRAMVTLNS**GKAIQYQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNLVRIIDFSKNNFSGKIPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLESIDFSLNQLSGEIPQSMSSLTYLNHLNLSNNNLTGKIPSSTQLQSFDASSYAGNDLCGA*************************WLYVSIALGFMGGFWCLIGPLLASRRWRYKYYNFLDRVGDRIVFVNIRTDW
MSGVLVFAFLLFELLAIATVSVSFSNGSSYHVGCLESERRALLRFKQDLQDPSNRLASWIGYEDCCAWAGVVCDNVTGHIVELNLRNPFTYCDLSQSKANPRSMLVGKVNPSLLDLKHLSYLDLSYNDFQGVQIPRFICSMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVENLWWLPGLSFLKDLDLSYVNLSKASDWLRVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPNWVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEISEIFDIFSGCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSLGHLSTLQFIDLSYNELNGMNDNWIPPFQLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYSGITGSIPNIFWSSASQIYVLDLSFNQIHGQIPNLTNAAQLEVLSLGSNSFSGALPLISSNLIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQNLMILDLSNNKFTGNLPISLGSLISLQSLHLRKNNLSGTIHSLKNCTALLTLDVGENEFVENIPTWIGERFSRMVVLILRSNKFHSLLPKGLCDLAFLQIVDLADNNLSGEVPRCIHNLRAMVTLNSHAGKAIQYQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNLVRIIDFSKNNFSGKIPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLESIDFSLNQLSGEIPQSMSSLTYLNHLNLSNNNLTGKIPSSTQLQSFDASSYAGNDLCGAPLPRNCS************EDELDYWLYVSIALGFMGGFWCLIGPLLASRRWRYKYYNFLDRVGDRIVFVNIRTDW
MSGVLVFAFLLFELLAIATVSVSFSNGSSYHVGCLESERRALLRFKQDLQDPSNRLASWIGYEDCCAWAGVVCDNVTGHIVELNLRNPFTYCDLSQSKANPRSMLVGKVNPSLLDLKHLSYLDLSYNDFQGVQIPRFICSMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVENLWWLPGLSFLKDLDLSYVNLSKASDWLRVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPNWVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEISEIFDIFSGCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSLGHLSTLQFIDLSYNELNGMNDNWIPPFQLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYSGITGSIPNIFWSSASQIYVLDLSFNQIHGQIPNLTNAAQLEVLSLGSNSFSGALPLISSNLIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQNLMILDLSNNKFTGNLPISLGSLISLQSLHLRKNNLSGTIHSLKNCTALLTLDVGENEFVENIPTWIGERFSRMVVLILRSNKFHSLLPKGLCDLAFLQIVDLADNNLSGEVPRCIHNLRAMVTLNSHAGKAIQYQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNLVRIIDFSKNNFSGKIPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLESIDFSLNQLSGEIPQSMSSLTYLNHLNLSNNNLTGKIPSSTQLQSFDASSYAGNDLCGAPLPRNCS*************DELDYWLYVSIALGFMGGFWCLIGPLLASRRWRYKYYNFLDRVGDRIVFVNIRTDW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGVLVFAFLLFELLAIATVSVSFSNGSSYHVGCLESERRALLRFKQDLQDPSNRLASWIGYEDCCAWAGVVCDNVTGHIVELNLRNPFTYCDLSQSKANPRSMLVGKVNPSLLDLKHLSYLDLSYNDFQGVQIPRFICSMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVENLWWLPGLSFLKDLDLSYVNLSKASDWLRVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPNWVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEISEIFDIFSGCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSLGHLSTLQFIDLSYNELNGMNDNWIPPFQLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYSGITGSIPNIFWSSASQIYVLDLSFNQIHGQIPNLTNAAQLEVLSLGSNSFSGALPLISSNLIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQNLMILDLSNNKFTGNLPISLGSLISLQSLHLRKNNLSGTIHSLKNCTALLTLDVGENEFVENIPTWIGERFSRMVVLILRSNKFHSLLPKGLCDLAFLQIVDLADNNLSGEVPRCIHNLRAMVTLNSHAGKAIQYQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNLVRIIDFSKNNFSGKIPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLESIDFSLNQLSGEIPQSMSSLTYLNHLNLSNNNLTGKIPSSTQLQSFDASSYAGNDLCGAPLPRNCSEHVSTPEDENGDEDELDYWLYVSIALGFMGGFWCLIGPLLASRRWRYKYYNFLDRVGDRIVFVNIRTDW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query938 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.849 0.940 0.289 2e-75
Q9FL28 1173 LRR receptor-like serine/ no no 0.795 0.635 0.278 1e-68
C0LGQ5 1249 LRR receptor-like serine/ no no 0.811 0.609 0.303 3e-68
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.772 0.579 0.293 1e-60
Q9SHI2 1101 Leucine-rich repeat recep no no 0.722 0.615 0.286 2e-60
Q9LVP0 1102 Probable leucine-rich rep no no 0.679 0.578 0.312 3e-56
Q9LYN8 1192 Leucine-rich repeat recep no no 0.771 0.607 0.279 4e-56
Q9LP24 1120 Probable leucine-rich rep no no 0.768 0.643 0.278 3e-55
O49318 1124 Probable leucine-rich rep no no 0.678 0.565 0.295 3e-54
O22476 1196 Protein BRASSINOSTEROID I no no 0.642 0.504 0.294 1e-53
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  284 bits (726), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 276/953 (28%), Positives = 415/953 (43%), Gaps = 156/953 (16%)

Query: 2   SGVLVFAFLLFELLAIATVSVSFSNGSSYHVGCLESERRALLRFKQDLQDPSNR------ 55
           S +++F  LL   LA           SS H  C + +R ALL F+ +   P N       
Sbjct: 13  SRIIIFLSLLVHSLA----------SSSPHF-CRDDQRDALLEFRGEF--PINASWHIMN 59

Query: 56  --LASWIGYEDCCAWAGVVCDNVTGHIVELNLRNPFTYCDLSQSKANPRSMLVGKVNPSL 113
                W    DCC W GV C++ +G ++ L++ N F    L             K N SL
Sbjct: 60  QWRGPWNKSTDCCLWNGVTCNDKSGQVISLDIPNTFLNNYL-------------KTNSSL 106

Query: 114 LDLKHLSYLDLSYNDFQGVQIPRFICSMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDL 173
             L++L                         R+L+L+     G IP  LGNLS+L  ++L
Sbjct: 107 FKLQYL-------------------------RHLDLTNCNLYGEIPSSLGNLSHLTLVNL 141

Query: 174 SWNFLYVENLWWLPGLSFLKDLDLSYVNLSKASDWLRVTNTLPSLVKLRLSRCQLHHLPP 233
            +N              F+ ++  S  NL++    +   N L   +             P
Sbjct: 142 YFN-------------KFVGEIPASIGNLNQLRHLILANNVLTGEI-------------P 175

Query: 234 LAIANFSTLTTLDLLYNQFDNSFVPNWVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKH 293
            ++ N S L  L+L  N+     +P+ +  L QL  L L  NN  G IP  L NL++L H
Sbjct: 176 SSLGNLSRLVNLELFSNRLVGK-IPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVH 234

Query: 294 LLLDSNRFNSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEI 353
           L+L  N+    +P  +     L  +   NNSL G +  S A+L                 
Sbjct: 235 LVLTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIPISFANL----------------- 277

Query: 354 SEIFDIFSGCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSLGHL 413
                       + L I VL  ++ +    + +  F NL Y D+S NS  GP P SL  +
Sbjct: 278 ------------TKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLI 325

Query: 414 STLQFIDLSYNELNGMND--NWIPPFQLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYS 471
            +L+ I L  N+  G  +  N     +L  L L    L    P  +    +L  LD+S++
Sbjct: 326 PSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHN 385

Query: 472 GITGSIPNIFWSSASQIYVLDLSFNQIHGQIPNLTNAAQLEVLSLGSNSFSGALPLISSN 531
             TG+IP    S    +  LDLS N + G++P      +L  + L  NSFS         
Sbjct: 386 NFTGAIPPTI-SKLVNLLHLDLSKNNLEGEVP--ACLWRLNTMVLSHNSFSSFENTSQEE 442

Query: 532 LI--ELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQ-NLMILD 588
            +  ELD ++NS  G I + IC    +L  L FL L  N   G +  C  N+  ++  L+
Sbjct: 443 ALIEELDLNSNSFQGPIPYMIC----KLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELN 498

Query: 589 LSNNKFTGNLPISLGSLISLQSLHLRKNNLSGTI-HSLKNCTALLTLDVGENEFVENIPT 647
           L +N F+G LP        L SL +  N L G    SL NC AL  ++V  N+  +  P+
Sbjct: 499 LGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPS 558

Query: 648 WIGERFSRMVVLILRSNKFHSLLPKGLCDLAF--LQIVDLADNNLSGEVPRC-IHNLRAM 704
           W+ E    + VL LRSNKF+  L      + F  L+I+D++ NN SG +P     N + M
Sbjct: 559 WL-ESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDM 617

Query: 705 VTLNSHAGKAIQYQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNLVRIIDFSKNNF 764
            TL     + +  +F  YA           +  +V KG    ++ I    R IDFS N  
Sbjct: 618 TTLTEEMDQYMT-EFWRYADS------YYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKI 670

Query: 765 SGKIPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLESIDFSLNQLSGEIPQSMSSLT 824
           +G IP  +  LK L+  NLS N FT  IP  +  +  LE++D S N+LSG+IPQ +++L+
Sbjct: 671 NGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALS 730

Query: 825 YLNHLNLSNNNLTGKIPSSTQLQSFDASSYAGN-------DLCGAPLPRNCSEHVSTPED 877
           +L+++N S+N L G +P  TQ Q    SS+  N       D+C      N +  +  PED
Sbjct: 731 FLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYGLEDICRDTGALNPTSQL--PED 788

Query: 878 ENGDEDELDYWLYVSIALGFMGGFWC--LIGPLLASRRWRYKYYNFLDRVGDR 928
            +  E+ +  W+  +IA G   G  C  +IG    S    +    F ++ G +
Sbjct: 789 LSEAEENMFNWVAAAIAYG--PGVLCGLVIGHFYTSHNHEW----FTEKFGRK 835




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query938
2240728851024 predicted protein [Populus trichocarpa] 0.950 0.871 0.485 0.0
3154367201020 verticillium wilt resistance-like protei 0.981 0.902 0.464 0.0
209970607 1045 M18S-3Ap [Malus floribunda] 0.979 0.879 0.452 0.0
350284739978 receptor-like protein [Malus x domestica 0.961 0.922 0.468 0.0
209970618967 M18-S3Bp [Malus floribunda] 0.949 0.921 0.478 0.0
350284759980 receptor-like protein [Malus micromalus] 0.971 0.929 0.457 0.0
255543977 1075 serine/threonine-protein kinase bri1, pu 0.950 0.829 0.436 0.0
209970625974 HB09p [Malus floribunda] 0.969 0.933 0.456 0.0
2099706031038 AM19-5p [Malus floribunda] 0.965 0.872 0.446 0.0
143307141015 HcrVf1 protein [Malus floribunda] 0.948 0.876 0.443 0.0
>gi|224072885|ref|XP_002303927.1| predicted protein [Populus trichocarpa] gi|222841359|gb|EEE78906.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/1006 (48%), Positives = 636/1006 (63%), Gaps = 114/1006 (11%)

Query: 24   FSNGSSYHVGCLESERRALLRFKQDLQDPSNRLASWIGYE-DCCAWAGVVCDNVTGHIVE 82
            FS GS +  GC + ER ALL+FK DL+DPSNRLASW G+  DCC W GV+CDNVTGH++E
Sbjct: 28   FSYGS-FTQGCSQIERDALLKFKHDLKDPSNRLASWAGFGGDCCTWRGVICDNVTGHVIE 86

Query: 83   LNLRNPFTYCD-LSQSKANP------RSMLVGKVNPSLLDLKHLSYLDLSYNDFQGVQIP 135
            L LR+  ++ D L+ S A+       + +L G++NPSL+ LKHL YLDL  NDF GVQIP
Sbjct: 87   LRLRS-ISFADYLASSGASTQYEDYLKLILSGRINPSLVSLKHLRYLDLRNNDFGGVQIP 145

Query: 136  RFICSMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLS--WNFLYVENLWWLPGLSFLK 193
            +FI  +G+L++L+LS   F G IP  LGNLS+L YL+L   ++   VENL WL  LS L+
Sbjct: 146  KFIGLIGSLKHLDLSDAGFAGTIPHGLGNLSDLNYLNLHDYYSQFNVENLNWLSQLSSLE 205

Query: 194  DLDLSYVNLSKASDWLRVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFD 253
             LDLS V+L    +WL V NTLPSLV+L LS CQL  +PP+   NFS+L+ LDL  N  D
Sbjct: 206  FLDLSLVHLGNVFNWLEVINTLPSLVELHLSYCQLPPVPPILYVNFSSLSILDLSSNYVD 265

Query: 254  NSFV-----PNWVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNW 308
             S +     P WV  L  L+ L+L  NNFQGPIP GLQNLT LK L L  N F+SSIP W
Sbjct: 266  ESAISMLNFPRWVSHLKTLLSLNLANNNFQGPIPNGLQNLTLLKALDLSINHFSSSIPEW 325

Query: 309  LYRFNRLESLGVSNNSLQG---RVIRSMASL------------------------CNLRS 341
            LY F  L+ L + +N+LQG     I +M SL                        CNLR+
Sbjct: 326  LYGFEHLKLLNLGSNNLQGVLSSAIGNMTSLISLDLSLNHELKFEGGIPGSFKKLCNLRT 385

Query: 342  VMLSCVKLSQEISEIFDIFSGCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNS 401
            + LS VKL+Q+I+E+ ++  GCVS  +E L L G  + G LT  LG+F+NL YL L +NS
Sbjct: 386  LSLSNVKLNQDIAEVLEVLLGCVSEEVESLDLAGCLLFGQLTNHLGKFRNLAYLGLRSNS 445

Query: 402  IVGPIPFSLGHLSTLQFIDLSYNELNG--------------------------------- 428
            I GPIP +LG L +L+ + LS N+LNG                                 
Sbjct: 446  ISGPIPMALGELVSLRSLVLSDNKLNGTLPKSFGELTKLEEMDISHNLFQGEVSEVHFAN 505

Query: 429  -----------------MNDNWIPPFQLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYS 471
                             ++ +WIPP QL  + LR  ++G +FP W+   +HL+YLD+S S
Sbjct: 506  LKNLRNFSAAGNQLNLRVSPDWIPP-QLVFIDLRSWNVGPQFPKWVRPLEHLSYLDISNS 564

Query: 472  GITGSIPNIFWSSASQIYVLDLSFNQIHGQIPN---LTNAAQLEVLSLGSNSFSGALPLI 528
             I+ +IP  FW+ + ++  L+LS NQI G IP+   L   A   ++ L SN F G LP I
Sbjct: 565  SISSTIPIWFWTMSFRMEYLNLSHNQIQGVIPSKLKLDFTASYPLVDLSSNQFKGPLPSI 624

Query: 529  SSNLIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQNLMILD 588
             SN+  LD SNNS SGS+ +F+C++  ELK +Q L L  N L G + DCW ++Q L+ + 
Sbjct: 625  FSNVGALDLSNNSFSGSMLNFLCHKIDELKNMQVLNLGENLLSGVIPDCWSSWQYLVAIK 684

Query: 589  LSNNKFTGNLPISLGSLISLQSLHLRKNNLSGTIH-SLKNCTALLTLDVGENEFVENIPT 647
            LSNNK +GN+P S+G+L  L+SLH+R ++LSG +  SLKNCT L+TLDV ENE V ++P 
Sbjct: 685  LSNNKLSGNIPDSIGALSLLESLHIRNSSLSGKLPISLKNCTKLITLDVAENELVGSMPA 744

Query: 648  WIGERFSRMVVLILRSNKFHSLLPKGLCDLAFLQIVDLADNNLSGEVPRCIHNLRAMVTL 707
            WIG+RFS MVVL +R+NKFH  +P+ LC+LA LQI+DLA N LS  +P C + L AM T 
Sbjct: 745  WIGKRFSSMVVLNMRANKFHGRIPRELCNLASLQILDLAHNRLSWSIPTCFNKLSAMATR 804

Query: 708  NSHAGKAIQYQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNLVRIIDFSKNNFSGK 767
            N   GK       +Y     ST    ++ L+VMKG+  EY  IL  VR ID S N   G+
Sbjct: 805  NDSLGK-------IYLDSGSST---FDNVLLVMKGKVVEYSTILKFVRSIDLSSNALCGE 854

Query: 768  IPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLESIDFSLNQLSGEIPQSMSSLTYLN 827
            IP EVT L  LQS NLS N  TGRIPE IG++R LES+DFS+NQLSGEIPQSMS LT+L+
Sbjct: 855  IPEEVTRLSELQSLNLSQNSLTGRIPEGIGSLRYLESMDFSVNQLSGEIPQSMSDLTFLS 914

Query: 828  HLNLSNNNLTGKIPSSTQLQSFDASSYAGNDLCGAPLPRNCSE----HVSTPEDENGDED 883
            HLNLS+N L G+IPS TQLQSF  SS++GN+LCG PL +NCS     HV    +E+G+  
Sbjct: 915  HLNLSDNRLRGRIPSGTQLQSFGPSSFSGNELCGPPLSKNCSVDNKFHVEHEREEDGNGL 974

Query: 884  ELDYWLYVSIALGFMGGFWCLIGPLLASRRWRYKYYNFLDRVGDRI 929
            +   W YVS+ LGF+ GFW ++GPL+ +RRWRY YY+FLDR+ D+I
Sbjct: 975  K-GRWFYVSMVLGFIVGFWGVVGPLMFNRRWRYVYYHFLDRLRDQI 1019




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|315436720|gb|ADU18533.1| verticillium wilt resistance-like protein [Gossypium barbadense] Back     alignment and taxonomy information
>gi|209970607|gb|ACJ03066.1| M18S-3Ap [Malus floribunda] Back     alignment and taxonomy information
>gi|350284739|gb|AEQ27741.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|209970618|gb|ACJ03070.1| M18-S3Bp [Malus floribunda] Back     alignment and taxonomy information
>gi|350284759|gb|AEQ27751.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|255543977|ref|XP_002513051.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223548062|gb|EEF49554.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|209970625|gb|ACJ03073.1| HB09p [Malus floribunda] Back     alignment and taxonomy information
>gi|209970603|gb|ACJ03064.1| AM19-5p [Malus floribunda] Back     alignment and taxonomy information
>gi|14330714|emb|CAC40825.1| HcrVf1 protein [Malus floribunda] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query938
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.909 0.891 0.293 9.6e-73
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.868 0.911 0.305 1.1e-71
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.740 0.856 0.306 2.9e-71
TAIR|locus:2086979890 RLP42 "receptor like protein 4 0.793 0.835 0.308 7.7e-71
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.794 0.836 0.305 1.6e-70
TAIR|locus:2046357890 RLP23 "receptor like protein 2 0.797 0.840 0.308 3.3e-70
TAIR|locus:2087253884 RLP39 "AT3G24900" [Arabidopsis 0.808 0.857 0.304 8.9e-70
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.804 0.800 0.311 1.1e-69
TAIR|locus:2086974881 RLP41 "AT3G25010" [Arabidopsis 0.793 0.844 0.304 2.1e-68
TAIR|locus:2096349860 RLP31 "receptor like protein 3 0.759 0.827 0.297 9.2e-68
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 735 (263.8 bits), Expect = 9.6e-73, P = 9.6e-73
 Identities = 278/947 (29%), Positives = 420/947 (44%)

Query:    34 CLESERRALLRFKQDLQ--DPS------------NRLASWIGYEDCCAWAGVVCDNVTGH 79
             C   +R ALL FK + +   PS             +  SW    DCC W GV C+  +G 
Sbjct:    37 CRPEQRDALLAFKNEFEIGKPSPDHCKIYGIESPRKTDSWGNNSDCCNWEGVTCNAKSGE 96

Query:    80 IVELNLRNPFTYCDLSQSKANPRSMLVGKVNPXXXXXXXXXXXXXXXNDFQGVQIPRFIC 139
             ++EL         DLS S  + R       N                NDF+G QI   I 
Sbjct:    97 VIEL---------DLSCSSLHGRF----HSNSSIRNLHFLTTLDLSFNDFKG-QITSSIE 142

Query:   140 SMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVENLWWLPGLSFLKDLDLSY 199
             ++ +L YL+LS   F G I   +GNLS L YL+L  N    +    +  LS L  LDLSY
Sbjct:   143 NLSHLTYLDLSSNHFSGQILNSIGNLSRLTYLNLFDNQFSGQAPSSICNLSHLTFLDLSY 202

Query:   200 VNLSKASDWLRVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPN 259
                     +      L  L  L L   +     P +I N S LTTLDL  N F    +P+
Sbjct:   203 NRFF--GQFPSSIGGLSHLTTLSLFSNKFSGQIPSSIGNLSNLTTLDLSNNNFSGQ-IPS 259

Query:   260 WVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESLG 319
             ++  L QL FL L  NNF G IP    NL  L  L +D N+ + + PN L     L  L 
Sbjct:   260 FIGNLSQLTFLGLFSNNFVGEIPSSFGNLNQLTRLYVDDNKLSGNFPNVLLNLTGLSLLS 319

Query:   320 VSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEI-SEIFDIFS----------------- 361
             +SNN   G +  ++ SL NL     S    +    S +F I S                 
Sbjct:   320 LSNNKFTGTLPPNITSLSNLMDFDASDNAFTGTFPSFLFTIPSLTYIRLNGNQLKGTLEF 379

Query:   362 GCVSS--GLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSL-GHLSTLQF 418
             G +SS   L  L +  ++  G +   + +   L+ LD+S+ +  GP+ FS+  HL +L  
Sbjct:   380 GNISSPSNLYELDIGNNNFIGPIPSSISKLVKLFRLDISHLNTQGPVDFSIFSHLKSLLD 439

Query:   419 IDLSY-NELNGMNDNWIPPF--QLATLGLRHCHLGSRFPSWLHS--QKHLNYLDLSYSGI 473
             +++S+ N    ++ N+   +  +L  L L   H+ +   S +     + +  L LS  GI
Sbjct:   440 LNISHLNTTTRIDLNYFLSYFKRLLLLDLSGNHVSATNKSSVSDPPSQLIQSLYLSGCGI 499

Query:   474 TGSIPNIFWSSASQIYVLDLSFNQIHGQIPN-LTNAAQLEVLSLGSNSFSG-ALPLISS- 530
             T   P  F  +  ++  LD+S N+I GQ+P+ L     L  ++L +N+  G   P     
Sbjct:   500 T-EFPE-FVRTQHELGFLDISNNKIKGQVPDWLWRLPILYYVNLSNNTLIGFQRPSKPEP 557

Query:   531 NLIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQN-LMILDL 589
             +L+ L  SNN+  G I  FIC     L+ L  L L  N   G +  C  + ++ L +L+L
Sbjct:   558 SLLYLLGSNNNFIGKIPSFIC----GLRSLNTLDLSDNNFNGSIPRCMGHLKSTLSVLNL 613

Query:   590 SNNKFTGNXXXXXXXXXXXXXXXXRKNNLSGTI-HSLKNCTALLTLDVGENEFVENIPTW 648
               N  +G                   N L G +  SL   + L  L+V  N   +  P W
Sbjct:   614 RQNHLSGGLPKQIFEILRSLDVGH--NQLVGKLPRSLSFFSTLEVLNVESNRINDTFPFW 671

Query:   649 IGERFSRMVVLILRSNKFHSLLPKGLCDLAFLQIVDLADNNLSGEVP-RCIHNLRAMVTL 707
             +     ++ VL+LRSN FH   P        L+I+D++ N  +G +P        AM +L
Sbjct:   672 LSS-LPKLQVLVLRSNAFHG--PIHEATFPELRIIDISHNRFNGTLPTEYFVKWSAMSSL 728

Query:   708 NSHAGKAIQYQFLLYASRAPSTAMLLEDALVVM-KGRAAEYKCILNLVRIIDFSKNNFSG 766
               +  ++ + +++        + +  +D++V+M KG A E   IL +   +DFS N F G
Sbjct:   729 GKNEDQSNE-KYM-------GSGLYYQDSMVLMNKGVAMELVRILTIYTAVDFSGNRFEG 780

Query:   767 KIPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLESIDFSLNQLSGEIPQSMXXXXXX 826
             +IP  +  LK L   +LSNN F+G +P S+G + +LES+D S N+L+GEIPQ +      
Sbjct:   781 EIPKSIGLLKELLVLSLSNNAFSGHMPSSMGNLTALESLDVSKNKLTGEIPQELGDLSFL 840

Query:   827 XXXXXXXXXXTGKIPSSTQLQSFDASSYAGN-DLCGAPLPRNCSE-HV-------STPED 877
                        G +P   Q  + + S++  N  L G+ L   C + H         TPE 
Sbjct:   841 AYMNFSHNQLAGLVPGGQQFLTQNCSAFEDNLGLFGSSLEEVCRDIHTPASHQQFETPET 900

Query:   878 ENGDEDELDYWLYVSIALGFMGGFWCLIGPLLASRRWRYKYYNFLDR 924
             E  DED +  W+  +I  G    F  + G +L S +  + + N  DR
Sbjct:   901 EEEDEDLIS-WIAAAIGFGPGIAFGLMFGYILVSYKPEW-FMNPFDR 945




GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086979 RLP42 "receptor like protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086974 RLP41 "AT3G25010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096349 RLP31 "receptor like protein 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query938
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-59
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-57
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-53
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-21
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-07
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 7e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  219 bits (559), Expect = 3e-59
 Identities = 197/637 (30%), Positives = 288/637 (45%), Gaps = 72/637 (11%)

Query: 3   GVLVFAFLLFELLAIATVSVSFSNGSSYHVGCLESERRALLRFKQDLQDPSNRLASWIGY 62
             L+F                F N S  H   LE     LL FK  + DP   L++W   
Sbjct: 10  PYLIFMLFFL-----------FLNFSMLHAEELE----LLLSFKSSINDPLKYLSNWNSS 54

Query: 63  EDCCAWAGVVCDNVTGHIVELNLRNPFTYCDLSQSKANPRSMLVGKVNPSLLDLKHLSYL 122
            D C W G+ C+N +  +V ++L                   + GK++ ++  L ++  +
Sbjct: 55  ADVCLWQGITCNNSS-RVVSIDL---------------SGKNISGKISSAIFRLPYIQTI 98

Query: 123 DLSYNDFQGVQIPRFI-CSMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVE 181
           +LS N   G  IP  I  +  +LRYLNLS   F G IP   G++ NL+ LDLS N L  E
Sbjct: 99  NLSNNQLSG-PIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGE 155

Query: 182 NLWWLPGLSFLKDLDLSYVNLSKASDWLRVTNTLPSLVKLRLSRCQLHHLPPLAIANFST 241
               +   S LK LDL   N+        +TN L SL  L L+  QL    P  +    +
Sbjct: 156 IPNDIGSFSSLKVLDLGG-NVLVGKIPNSLTN-LTSLEFLTLASNQLVGQIPRELGQMKS 213

Query: 242 LTTLDLLYNQFDNSFVPNWVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRF 301
           L  + L YN      +P  + GL  L  LDL  NN  GPIP  L NL +L++L L  N+ 
Sbjct: 214 LKWIYLGYNNLSGE-IPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKL 272

Query: 302 NSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEISEIFDIFS 361
           +  IP  ++   +L SL +S+NSL G +   +  L NL  + L     + +I        
Sbjct: 273 SGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVAL---- 328

Query: 362 GCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSL---GHLSTLQF 418
                 L++L L  +  SG +   LG+  NL  LDLS N++ G IP  L   G+L  L  
Sbjct: 329 -TSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLI- 386

Query: 419 IDLSYNELNGMNDNWIPPF-----QLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYSGI 473
             L  N L G     IP        L  + L+        PS       + +LD+S + +
Sbjct: 387 --LFSNSLEGE----IPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNL 440

Query: 474 TGSIPNIFWSSASQIYVLDLSFNQIHGQIPNLTNAAQLEVLSLGSNSFSGALPL---ISS 530
            G I +  W     + +L L+ N+  G +P+   + +LE L L  N FSGA+P      S
Sbjct: 441 QGRINSRKW-DMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLS 499

Query: 531 NLIELDFSNNSISGSIFHFICYRAHEL---KKLQFLYLRGNFLQGELTDCWMNYQNLMIL 587
            L++L  S N +SG I         EL   KKL  L L  N L G++   +     L  L
Sbjct: 500 ELMQLKLSENKLSGEI-------PDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQL 552

Query: 588 DLSNNKFTGNLPISLGSLISLQSLHLRKNNLSGTIHS 624
           DLS N+ +G +P +LG++ SL  +++  N+L G++ S
Sbjct: 553 DLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS 589


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 938
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PLN03150623 hypothetical protein; Provisional 99.58
PLN03150623 hypothetical protein; Provisional 99.5
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.18
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.18
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.15
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.02
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.93
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.89
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.82
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.72
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.69
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.69
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.64
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.63
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.37
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.37
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.37
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.36
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.27
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.22
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.17
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.15
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.09
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.03
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.94
PRK15386426 type III secretion protein GogB; Provisional 97.82
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.73
PRK15386426 type III secretion protein GogB; Provisional 97.73
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.64
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.64
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.61
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.48
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.44
KOG4341483 consensus F-box protein containing LRR [General fu 97.3
KOG4341483 consensus F-box protein containing LRR [General fu 97.19
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.98
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.86
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.85
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.2
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.85
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.76
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.68
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.31
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.1
KOG4308478 consensus LRR-containing protein [Function unknown 94.47
KOG4308478 consensus LRR-containing protein [Function unknown 94.32
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.63
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.26
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.84
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.04
smart0037026 LRR Leucine-rich repeats, outliers. 85.43
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.43
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.75
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.3
smart0037026 LRR Leucine-rich repeats, outliers. 83.3
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.2e-71  Score=695.24  Aligned_cols=581  Identities=35%  Similarity=0.549  Sum_probs=391.1

Q ss_pred             HHHHHHHHHhhhcCCCCCCCCCCCCCCCCCccccceeeCCCCCcEEEEecCCCCCccCCccCCCCCCcccCccccCCccC
Q 036642           36 ESERRALLRFKQDLQDPSNRLASWIGYEDCCAWAGVVCDNVTGHIVELNLRNPFTYCDLSQSKANPRSMLVGKVNPSLLD  115 (938)
Q Consensus        36 ~~~~~~ll~~k~~~~~~~~~l~~W~~~~~~c~w~gv~c~~~~~~v~~l~L~~~~~~~~~~~~~~~~~~~~~g~l~~~l~~  115 (938)
                      ++|++||++||+++.+|.+.+.+|+..++||.|.||+|+. .++|+.++|++               +.+.|.+++.+..
T Consensus        28 ~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~---------------~~i~~~~~~~~~~   91 (968)
T PLN00113         28 AEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSG---------------KNISGKISSAIFR   91 (968)
T ss_pred             HHHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecCC-CCcEEEEEecC---------------CCccccCChHHhC
Confidence            5899999999999988888889997668999999999985 57999999988               3677888888899


Q ss_pred             CCCCCEEeCCCCCCCCCccccccc-CCCCCcEEecCCCcCCCCCCcCCCCCCcccEEECCCCcccccCccccCCCCCCCE
Q 036642          116 LKHLSYLDLSYNDFQGVQIPRFIC-SMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVENLWWLPGLSFLKD  194 (938)
Q Consensus       116 l~~L~~L~Ls~n~l~~~~~p~~l~-~l~~L~~L~Ls~n~l~~~~p~~~~~L~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~  194 (938)
                      +++|++|+|++|.+++. +|..+. .+++|++|+|++|++++.+|.  +.+++|++|++++|.+                
T Consensus        92 l~~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~----------------  152 (968)
T PLN00113         92 LPYIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNML----------------  152 (968)
T ss_pred             CCCCCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcc----------------
Confidence            99999999999998873 776544 888899999999888877764  3455555555554433                


Q ss_pred             EeCCCCCCCCCcchhhhhCCCCCCcEEEcCCCCCCCCCcccccCCCCCCEEECCCCCCCCccCcccccCCCCCCEEEccC
Q 036642          195 LDLSYVNLSKASDWLRVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPNWVFGLIQLVFLDLRR  274 (938)
Q Consensus       195 L~Ls~n~l~~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~  274 (938)
                                                        ++..+..++++++|++|++++|.+.+.. |..+.++++|++|++++
T Consensus       153 ----------------------------------~~~~p~~~~~l~~L~~L~L~~n~l~~~~-p~~~~~l~~L~~L~L~~  197 (968)
T PLN00113        153 ----------------------------------SGEIPNDIGSFSSLKVLDLGGNVLVGKI-PNSLTNLTSLEFLTLAS  197 (968)
T ss_pred             ----------------------------------cccCChHHhcCCCCCEEECccCcccccC-ChhhhhCcCCCeeeccC
Confidence                                              3333334444445555555555444433 44555555555555555


Q ss_pred             CcccCCCCccccCCCCCCEEECcCCcCCCccchhhhcCCCCCEEEccCCcCCchhhHhhhccCCCCeeecCCCcCccchh
Q 036642          275 NNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEIS  354 (938)
Q Consensus       275 n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~  354 (938)
                      |.+.+.+|..++++++|++|++++|.+++.+|..++++++|++|++++|.+.+..|..++++++|+.|++++|.+.+.+ 
T Consensus       198 n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~-  276 (968)
T PLN00113        198 NQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPI-  276 (968)
T ss_pred             CCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccC-
Confidence            5555555555555555555555555555555555555555555555555555555544444444444444333333222 


Q ss_pred             hHHHhhhcccccCccEEEccCCcCccccccccCCCCCccEEEccCCeecccccccccCCCCCcEEEccCccCCCCCCCCC
Q 036642          355 EIFDIFSGCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSLGHLSTLQFIDLSYNELNGMNDNWI  434 (938)
Q Consensus       355 ~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~  434 (938)
                                                  |..+..+++|++|++++|.+.+.+|..+.++++|++|++++|.+++      
T Consensus       277 ----------------------------p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~------  322 (968)
T PLN00113        277 ----------------------------PPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTG------  322 (968)
T ss_pred             ----------------------------chhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCC------
Confidence                                        2233444455555555555555555445555555555554444433      


Q ss_pred             CccccceeecccccCCCCCCcccCCCCCCcEEEccCcccccccchhHhhcCcCccEEecccccccccCCCccccccCcee
Q 036642          435 PPFQLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYSGITGSIPNIFWSSASQIYVLDLSFNQIHGQIPNLTNAAQLEVL  514 (938)
Q Consensus       435 ~~~~L~~L~L~~~~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~l~~~~~L~~L  514 (938)
                                       ..|..+..+++|+.|++++|.+.+.+|..+                                 
T Consensus       323 -----------------~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l---------------------------------  352 (968)
T PLN00113        323 -----------------KIPVALTSLPRLQVLQLWSNKFSGEIPKNL---------------------------------  352 (968)
T ss_pred             -----------------cCChhHhcCCCCCEEECcCCCCcCcCChHH---------------------------------
Confidence                             223333333333333333333332222221                                 


Q ss_pred             ecCCccCccCCCCCCCCCcEEEccCCccccccchhhhhhhccCCCcceeeccCccCCCccchhhhcCCCCCEEEcCCCcc
Q 036642          515 SLGSNSFSGALPLISSNLIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQNLMILDLSNNKF  594 (938)
Q Consensus       515 ~L~~n~l~~~~p~~~~~L~~L~ls~n~l~~~~~~~~~~~l~~l~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l  594 (938)
                                                              +.+++|+.|++++|++++.+|..+..+++|+.|++++|++
T Consensus       353 ----------------------------------------~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l  392 (968)
T PLN00113        353 ----------------------------------------GKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSL  392 (968)
T ss_pred             ----------------------------------------hCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEe
Confidence                                                    2233444444444444444455555555555555555555


Q ss_pred             cccCCcccCCCCCCcEEEccccccccccc-ccccCcCCcEEECCCCccCCCCChhHhhhcCcccEEeeCCCcccccCCcc
Q 036642          595 TGNLPISLGSLISLQSLHLRKNNLSGTIH-SLKNCTALLTLDVGENEFVENIPTWIGERFSRMVVLILRSNKFHSLLPKG  673 (938)
Q Consensus       595 ~~~~p~~~~~l~~L~~L~L~~n~l~~~~~-~l~~l~~L~~L~Ls~N~l~~~~p~~~~~~l~~L~~L~L~~n~l~~~~~~~  673 (938)
                      .+.+|..++.+++|+.|++++|++++.+| .+.++++|+.|++++|++.+.+|.++. .+++|+.|++++|++.+.+|..
T Consensus       393 ~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~-~l~~L~~L~L~~n~~~~~~p~~  471 (968)
T PLN00113        393 EGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKW-DMPSLQMLSLARNKFFGGLPDS  471 (968)
T ss_pred             cccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhc-cCCCCcEEECcCceeeeecCcc
Confidence            55555555555555555555555555555 555555666666666666665555554 4666666677767666666655


Q ss_pred             ccCCCccCeeeccccccccccchhhhcchhhhhccccccchhhhhhhhccCCCcchhhcccceeeeecCcchhhhhhccc
Q 036642          674 LCDLAFLQIVDLADNNLSGEVPRCIHNLRAMVTLNSHAGKAIQYQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNL  753 (938)
Q Consensus       674 l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  753 (938)
                      + ..++|+.|++++|++++.+|..+.++++|                                                 
T Consensus       472 ~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L-------------------------------------------------  501 (968)
T PLN00113        472 F-GSKRLENLDLSRNQFSGAVPRKLGSLSEL-------------------------------------------------  501 (968)
T ss_pred             c-ccccceEEECcCCccCCccChhhhhhhcc-------------------------------------------------
Confidence            4 34788999999999998888887776655                                                 


Q ss_pred             eeEEEeecCccCccCchhccCccCCCEEeCcCccCcccCCccccccCCCCEEECCCCcccccCCccccCCCCCCeEeCcC
Q 036642          754 VRIIDFSKNNFSGKIPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLESIDFSLNQLSGEIPQSMSSLTYLNHLNLSN  833 (938)
Q Consensus       754 l~~L~Ls~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~~~ip~~~~~l~~L~~LdLs~N~l~~~ip~~l~~l~~L~~L~ls~  833 (938)
                       +.|+|++|++.|.+|+.++++++|+.|+|++|.++|.+|..++++++|+.|||++|+++|.+|..+.++++|+++++++
T Consensus       502 -~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~  580 (968)
T PLN00113        502 -MQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISH  580 (968)
T ss_pred             -CEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccC
Confidence             6889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcccccCCCCCcCCCcCCCCcCCC-CCCCCC
Q 036642          834 NNLTGKIPSSTQLQSFDASSYAGN-DLCGAP  863 (938)
Q Consensus       834 N~l~g~ip~~~~~~~~~~~~~~~n-~lc~~~  863 (938)
                      |+++|.+|..+++.++...+|.|| .+||.+
T Consensus       581 N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        581 NHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             CcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            999999999999999999999999 899864



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query938
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-41
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-24
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-41
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-24
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-10
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-09
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-04
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 9e-08
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 2e-07
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 3e-07
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 3e-07
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 5e-07
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 6e-07
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 6e-07
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-06
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 6e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-05
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 2e-05
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 9e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-05
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 4e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 4e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 6e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 3e-04
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 2e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 2e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 2e-04
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 2e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 3e-04
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 3e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 3e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 4e-04
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 4e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 4e-04
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 5e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 6e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 166 bits (420), Expect = 5e-41, Method: Compositional matrix adjust. Identities = 191/664 (28%), Positives = 278/664 (41%), Gaps = 80/664 (12%) Query: 266 QLVFLDLRRNNFQGPIPE--GLQNLTSLKHLLLDSNR--FNSSIPNWLYRFNRLESLGVS 321 L LDL RN+ GP+ L + + LK L + SN F + L + N LE L +S Sbjct: 98 SLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGL-KLNSLEVLDLS 156 Query: 322 NNSLQGRVIRS--MASLCN-LRSVMLSCVKLSQEIS-------EIFDIFSGCVSSG---- 367 NS+ G + ++ C L+ + +S K+S ++ E D+ S S+G Sbjct: 157 ANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPFL 216 Query: 368 -----LEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSLGHLSTLQFIDLS 422 L+ L + G+ +SG + + L L++S+N VGPIP L +LQ++ L+ Sbjct: 217 GDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLA 274 Query: 423 YNELNGMNDNWIPPF------QLATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYSGITGS 476 N+ G IP F L L L H P + S L L LS + +G Sbjct: 275 ENKFTG----EIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGE 330 Query: 477 IPNIFWSSASQIYVLDLSFNQIHGQIP-NLTN-AAQLEVLSLGSNSFSGA-LPLISSN-- 531 +P + VLDLSFN+ G++P +LTN +A L L L SN+FSG LP + N Sbjct: 331 LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK 390 Query: 532 --LIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWMNYQNLMILDL 589 L EL NN +G I + +L L+L N+L G + + L L L Sbjct: 391 NTLQELYLQNNGFTGKIPPTL----SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKL 446 Query: 590 SNNKFTGNXXXXXXXXXXXXXXXXRKNNLSGTIHS-LKNCTALLTLDVGENEFVENIPTW 648 N G N+L+G I S L NCT L + + N IP W Sbjct: 447 WLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKW 506 Query: 649 IGERFSRMVVLILRSNKFHSLLPKGLCDLAFLQIVDLADNNLSGEVPRCIHNLRAMVTLN 708 IG R + +L L +N F +P L D L +DL N +G +P + + N Sbjct: 507 IG-RLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAAN 565 Query: 709 SHAGKAIQY-------------------------QFLLYASRAPSTAMLLEDALVVMKGR 743 AGK Y Q ++R P V G Sbjct: 566 FIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNI-----TSRVYGGH 620 Query: 744 AAEYKCILNLVRIIDFSKNNFSGKIPLEVTNLKALQSFNLSNNFFTGRIPESIGAMRSLE 803 + + +D S N SG IP E+ ++ L NL +N +G IP+ +G +R L Sbjct: 621 TSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLN 680 Query: 804 SIDFSLNQLSGEIPQSMXXXXXXXXXXXXXXXXTGKIPSSTQLQSFDASSYAGN-DLCGA 862 +D S N+L G IPQ+M +G IP Q ++F + + N LCG Sbjct: 681 ILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGY 740 Query: 863 PLPR 866 PLPR Sbjct: 741 PLPR 744
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query938
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-89
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-84
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-83
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-69
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-67
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-55
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-75
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-70
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-59
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-49
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-73
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-66
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-59
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-56
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-37
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-66
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-64
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-49
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-40
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-30
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-65
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-38
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-65
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-10
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-62
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-49
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-49
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-30
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-51
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-45
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-39
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-23
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-50
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-47
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-46
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-42
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-26
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-19
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-34
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-33
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-28
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-28
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-13
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-20
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  583 bits (1506), Expect = 0.0
 Identities = 224/879 (25%), Positives = 344/879 (39%), Gaps = 149/879 (16%)

Query: 23  SFSNGSSYHVGCLESERRALLRFKQDLQDPSNRLASWIGYEDCCAWAGVVCDNVTGHIVE 82
           SF    S     L  E   L+ FK  L D  N L  W   ++ C + GV C +    +  
Sbjct: 1   SFQASPS---QSLYREIHQLISFKDVLPDK-NLLPDWSSNKNPCTFDGVTCRD--DKVTS 54

Query: 83  LNLRNPFTYCDLSQSKANPRSMLVGKVNPSLLDLKHLSYLDLSYNDFQGVQIPRFICSMG 142
           ++L +             P ++    V+ SLL L  L  L LS +   G  +  F     
Sbjct: 55  IDLSS------------KPLNVGFSAVSSSLLSLTGLESLFLSNSHING-SVSGF-KCSA 100

Query: 143 NLRYLNLSYTQFVGMIPP--QLGNLSNLQYLDLSWNFL-YVENLWWLPGLSFLKDLDLSY 199
           +L  L+LS     G +     LG+ S L++L++S N L +   +     L+ L+ LDLS 
Sbjct: 101 SLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSA 160

Query: 200 VNLSKA-SDWLRVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVP 258
            ++S A      +++    L  L +S  ++     +                        
Sbjct: 161 NSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV------------------------ 196

Query: 259 NWVFGLIQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESL 318
                 + L FLD+  NNF   IP  L + ++L+HL +  N+ +      +     L+ L
Sbjct: 197 ---SRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLL 252

Query: 319 GVSNNSLQGRVIRSMASLCNLRSVMLSCVKLSQEISEIFDIFSGCVSSGLEILVLRGSSV 378
            +S+N   G +      L +L+ + L+  K + EI +                       
Sbjct: 253 NISSNQFVGPI--PPLPLKSLQYLSLAENKFTGEIPDFL--------------------- 289

Query: 379 SGHLTYKLGQFKNLYYLDLSNNSIVGPIPFSLGHLSTLQFIDLSYNELNGMNDNWIPPFQ 438
                   G    L  LDLS N   G +P   G  S L+ + LS N  +G     +P   
Sbjct: 290 -------SGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGE----LPM-- 336

Query: 439 LATLGLRHCHLGSRFPSWLHSQKHLNYLDLSYSGITGSIPNIFWSSASQIYVLDLSFNQI 498
                             L   + L  LDLS++  +G +P    + ++ +  LDLS N  
Sbjct: 337 ----------------DTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNF 380

Query: 499 HGQIPNLTNAAQLEVLSLGSNSFSGALPLISSNLIELDFSNNSISGSIFHFICYRAHELK 558
            G I            +L  N  +         L EL   NN  +G I   +        
Sbjct: 381 SGPILP----------NLCQNPKN--------TLQELYLQNNGFTGKIPPTLS----NCS 418

Query: 559 KLQFLYLRGNFLQGELTDCWMNYQNLMILDLSNNKFTGNLPISLGSLISLQSLHLRKNNL 618
           +L  L+L  N+L G +     +   L  L L  N   G +P  L  + +L++L L  N+L
Sbjct: 419 ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDL 478

Query: 619 SGTI-HSLKNCTALLTLDVGENEFVENIPTWIGERFSRMVVLILRSNKFHSLLPKGLCDL 677
           +G I   L NCT L  + +  N     IP WIG R   + +L L +N F   +P  L D 
Sbjct: 479 TGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIG-RLENLAILKLSNNSFSGNIPAELGDC 537

Query: 678 AFLQIVDLADNNLSGEVPRCIHNLRAMVTLNSHAGKAIQYQFLLYASRAP---------- 727
             L  +DL  N  +G +P  +      +  N  AGK   Y       +            
Sbjct: 538 RSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQ 597

Query: 728 ----------STAMLLEDALVVMKGRAAEYKCILNLVRIIDFSKNNFSGKIPLEVTNLKA 777
                     ST         V  G  +        +  +D S N  SG IP E+ ++  
Sbjct: 598 GIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPY 657

Query: 778 LQSFNLSNNFFTGRIPESIGAMRSLESIDFSLNQLSGEIPQSMSSLTYLNHLNLSNNNLT 837
           L   NL +N  +G IP+ +G +R L  +D S N+L G IPQ+MS+LT L  ++LSNNNL+
Sbjct: 658 LFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLS 717

Query: 838 GKIPSSTQLQSFDASSYAGND-LCGAPLPRNCSEHVSTP 875
           G IP   Q ++F  + +  N  LCG PLPR    +    
Sbjct: 718 GPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGY 756


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query938
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.49
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.34
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.32
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.25
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.18
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.17
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.07
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.79
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.73
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.65
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.57
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.21
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.91
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.62
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.94
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.68
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.65
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.2e-92  Score=860.10  Aligned_cols=705  Identities=30%  Similarity=0.440  Sum_probs=503.2

Q ss_pred             CcHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCccccceeeCCCCCcEEEEecCCCCCccCCccCCCCCCcccCcc---cc
Q 036642           34 CLESERRALLRFKQDLQDPSNRLASWIGYEDCCAWAGVVCDNVTGHIVELNLRNPFTYCDLSQSKANPRSMLVGK---VN  110 (938)
Q Consensus        34 ~~~~~~~~ll~~k~~~~~~~~~l~~W~~~~~~c~w~gv~c~~~~~~v~~l~L~~~~~~~~~~~~~~~~~~~~~g~---l~  110 (938)
                      +.++|++||++||+++.||. .+++|..+++||.|+||+|+  .|||++++|++.               .+.|.   +|
T Consensus         9 ~~~~~~~all~~k~~~~~~~-~l~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~---------------~l~g~~~~l~   70 (768)
T 3rgz_A            9 SLYREIHQLISFKDVLPDKN-LLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSK---------------PLNVGFSAVS   70 (768)
T ss_dssp             CHHHHHHHHHHHHTTCSCTT-SSTTCCTTSCGGGSTTEEEE--TTEEEEEECTTS---------------CCCEEHHHHH
T ss_pred             CCHHHHHHHHHHHhhCCCcc-cccCCCCCCCCcCCcceEEC--CCcEEEEECCCC---------------CcCCccCccC
Confidence            46889999999999999988 89999765899999999998  699999999983               77888   89


Q ss_pred             CCccCCCCCCEEeCCCCCCCCCcccccccCCCCCcEEecCCCcCCCCCCc--CCCCCCcccEEECCCCcccccCcccc-C
Q 036642          111 PSLLDLKHLSYLDLSYNDFQGVQIPRFICSMGNLRYLNLSYTQFVGMIPP--QLGNLSNLQYLDLSWNFLYVENLWWL-P  187 (938)
Q Consensus       111 ~~l~~l~~L~~L~Ls~n~l~~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~--~~~~L~~L~~L~Ls~n~i~~~~~~~~-~  187 (938)
                      +++.++++|+.++++.+.+.  .+|..++++++|++|+|++|.+++.+|.  .++++++|++|++++|.+....+..+ .
T Consensus        71 ~~l~~L~~L~~l~~~~~~~~--~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~  148 (768)
T 3rgz_A           71 SSLLSLTGLESLFLSNSHIN--GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGL  148 (768)
T ss_dssp             HHTTTCTTCCEEECTTSCEE--ECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCC
T ss_pred             hhHhccCcccccCCcCCCcC--CCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhc
Confidence            99999999999999999876  4678899999999999999999998998  99999999999999999876555544 6


Q ss_pred             CCCCCCEEeCCCCCCCCCcch-hhhhCCCCCCcEEEcCCCCCCCCCcccccCCCCCCEEECCCCCCCCccCcccccCCCC
Q 036642          188 GLSFLKDLDLSYVNLSKASDW-LRVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPNWVFGLIQ  266 (938)
Q Consensus       188 ~l~~L~~L~Ls~n~l~~~~~~-~~~~~~l~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~  266 (938)
                      ++++|++|++++|++++.... ...+.++++|++|++++|.+++..+.  ..+++|++|++++|.+.+.. |. ++++++
T Consensus       149 ~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n~l~~~~-~~-l~~l~~  224 (768)
T 3rgz_A          149 KLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNFSTGI-PF-LGDCSA  224 (768)
T ss_dssp             CCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSSCCCSCC-CB-CTTCCS
T ss_pred             cCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCCcCCCCC-cc-cccCCC
Confidence            777888888887777654321 11256666677777776666654432  55666666666666665533 33 555566


Q ss_pred             CCEEEccCCcccCCCCccccCCCCCCEEECcCCcCCCccchhhhcCCCCCEEEccCCcCCchhhHhhhcc-CCCCeeecC
Q 036642          267 LVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASL-CNLRSVMLS  345 (938)
Q Consensus       267 L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l-~~L~~L~L~  345 (938)
                      |++|++++|.+++.+|..+..+++|++|++++|.+++.+|..  .+++|++|++++|.+++.+|..+... +        
T Consensus       225 L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~--------  294 (768)
T 3rgz_A          225 LQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACD--------  294 (768)
T ss_dssp             CCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCT--------
T ss_pred             CCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcC--------
Confidence            666666666655555555555555666666555555544443  45555555555555555544444332 4        


Q ss_pred             CCcCccchhhHHHhhhcccccCccEEEccCCcCccccccccCCCCCccEEEccCCeeccccccc-ccCCCCCcEEEccCc
Q 036642          346 CVKLSQEISEIFDIFSGCVSSGLEILVLRGSSVSGHLTYKLGQFKNLYYLDLSNNSIVGPIPFS-LGHLSTLQFIDLSYN  424 (938)
Q Consensus       346 ~n~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-l~~l~~L~~L~Ls~n  424 (938)
                                           +|++|++++|.+++.+|..++.+++|++|++++|++++.+|.. +..+++|++|++++|
T Consensus       295 ---------------------~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n  353 (768)
T 3rgz_A          295 ---------------------TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN  353 (768)
T ss_dssp             ---------------------TCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSS
T ss_pred             ---------------------cCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCC
Confidence                                 4555555555555555555566666666666666666555543 556666666666666


Q ss_pred             cCCC-CCCCCCCcc-ccceeecccccCCCCCCcccCC--CCCCcEEEccCcccccccchhHhhcCcCccEEecccccccc
Q 036642          425 ELNG-MNDNWIPPF-QLATLGLRHCHLGSRFPSWLHS--QKHLNYLDLSYSGITGSIPNIFWSSASQIYVLDLSFNQIHG  500 (938)
Q Consensus       425 ~l~~-~~~~~~~~~-~L~~L~L~~~~l~~~~p~~l~~--l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~  500 (938)
                      ++++ ++..+.... +|++|++++|.+.+.+|..+..  +++|++|++++|.+++.+|..+ ..+++|+.|++++|++++
T Consensus       354 ~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l-~~l~~L~~L~Ls~N~l~~  432 (768)
T 3rgz_A          354 EFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL-SNCSELVSLHLSFNYLSG  432 (768)
T ss_dssp             EEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGG-GGCTTCCEEECCSSEEES
T ss_pred             ccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHH-hcCCCCCEEECcCCcccC
Confidence            5553 111111111 2222233333222233333333  4455555555555555544443 334455555555555554


Q ss_pred             cCC-CccccccCceeecCCccCccCCCCCCCCCcEEEccCCccccccchhhhhhhccCCCcceeeccCccCCCccchhhh
Q 036642          501 QIP-NLTNAAQLEVLSLGSNSFSGALPLISSNLIELDFSNNSISGSIFHFICYRAHELKKLQFLYLRGNFLQGELTDCWM  579 (938)
Q Consensus       501 ~~~-~l~~~~~L~~L~L~~n~l~~~~p~~~~~L~~L~ls~n~l~~~~~~~~~~~l~~l~~L~~L~ls~n~l~~~~~~~~~  579 (938)
                      .+| .+..+++|                     ++|++++|.+++.+|    ..+..+++|++|++++|++++.+|..+.
T Consensus       433 ~~p~~l~~l~~L---------------------~~L~L~~n~l~~~~p----~~~~~l~~L~~L~L~~N~l~~~~p~~l~  487 (768)
T 3rgz_A          433 TIPSSLGSLSKL---------------------RDLKLWLNMLEGEIP----QELMYVKTLETLILDFNDLTGEIPSGLS  487 (768)
T ss_dssp             CCCGGGGGCTTC---------------------CEEECCSSCCCSCCC----GGGGGCTTCCEEECCSSCCCSCCCGGGG
T ss_pred             cccHHHhcCCCC---------------------CEEECCCCcccCcCC----HHHcCCCCceEEEecCCcccCcCCHHHh
Confidence            444 34444444                     444444444444443    2344577788888888888888888888


Q ss_pred             cCCCCCEEEcCCCcccccCCcccCCCCCCcEEEccccccccccc-ccccCcCCcEEECCCCccCCCCChhHhhhcCcccE
Q 036642          580 NYQNLMILDLSNNKFTGNLPISLGSLISLQSLHLRKNNLSGTIH-SLKNCTALLTLDVGENEFVENIPTWIGERFSRMVV  658 (938)
Q Consensus       580 ~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~~-~l~~l~~L~~L~Ls~N~l~~~~p~~~~~~l~~L~~  658 (938)
                      ++++|++|++++|++++.+|.+++.+++|++|+|++|+++|.+| .+.++++|+.|++++|+++|.+|.+++ ....+..
T Consensus       488 ~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~-~~~~~~~  566 (768)
T 3rgz_A          488 NCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMF-KQSGKIA  566 (768)
T ss_dssp             GCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGG-TTTTCBC
T ss_pred             cCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHh-cccchhh
Confidence            88888888888888888888888888888888888888887777 788888888888888888888888776 3444433


Q ss_pred             EeeCC---------C-------------cccccCCccccCCCccCeeeccccccccccchhhhcchhhhhccccccchhh
Q 036642          659 LILRS---------N-------------KFHSLLPKGLCDLAFLQIVDLADNNLSGEVPRCIHNLRAMVTLNSHAGKAIQ  716 (938)
Q Consensus       659 L~L~~---------n-------------~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~~~~~~~~~  716 (938)
                      +.+..         +             .+.+..+..+..++.++.++++.|.+.|.+|..+..++.|            
T Consensus       567 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L------------  634 (768)
T 3rgz_A          567 ANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSM------------  634 (768)
T ss_dssp             CSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCC------------
T ss_pred             hhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccc------------
Confidence            33222         1             2345556666667777777788888888887777665554            


Q ss_pred             hhhhhccCCCcchhhcccceeeeecCcchhhhhhccceeEEEeecCccCccCchhccCccCCCEEeCcCccCcccCCccc
Q 036642          717 YQFLLYASRAPSTAMLLEDALVVMKGRAAEYKCILNLVRIIDFSKNNFSGKIPLEVTNLKALQSFNLSNNFFTGRIPESI  796 (938)
Q Consensus       717 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~Ls~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~~~ip~~~  796 (938)
                                                            +.|||++|+++|.+|.++++++.|+.|+|++|+++|.||+.|
T Consensus       635 --------------------------------------~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l  676 (768)
T 3rgz_A          635 --------------------------------------MFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEV  676 (768)
T ss_dssp             --------------------------------------CEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGG
T ss_pred             --------------------------------------cEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHH
Confidence                                                  789999999999999999999999999999999999999999


Q ss_pred             cccCCCCEEECCCCcccccCCccccCCCCCCeEeCcCCcccccCCCCCcCCCcCCCCcCCC-CCCCCCCCCCCCCC
Q 036642          797 GAMRSLESIDFSLNQLSGEIPQSMSSLTYLNHLNLSNNNLTGKIPSSTQLQSFDASSYAGN-DLCGAPLPRNCSEH  871 (938)
Q Consensus       797 ~~l~~L~~LdLs~N~l~~~ip~~l~~l~~L~~L~ls~N~l~g~ip~~~~~~~~~~~~~~~n-~lc~~~~~~~c~~~  871 (938)
                      +++++|++||||+|+++|.+|..++++++|++||+++|+++|.||.++||++|+..+|.|| ++||.|+. .|...
T Consensus       677 ~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~  751 (768)
T 3rgz_A          677 GDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPS  751 (768)
T ss_dssp             GGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSC
T ss_pred             hCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999 99999987 89633



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 938
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-21
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 9e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 93.7 bits (231), Expect = 2e-21
 Identities = 75/317 (23%), Positives = 117/317 (36%), Gaps = 41/317 (12%)

Query: 34  CLESERRALLRFKQDLQDPSNRLASWIGYEDCC--AWAGVVCDN--VTGHIVELNLRNPF 89
           C   +++ALL+ K+DL +P+  L+SW+   DCC   W GV+CD    T  +  L+L    
Sbjct: 3   CNPQDKQALLQIKKDLGNPTT-LSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG-- 59

Query: 90  TYCDLSQSKANPRSMLVGKVNPSLLDLKHLSYLDLSYNDFQGVQIPRFICSMGNLRYLNL 149
              +L +    P          SL +L +L++L +   +     IP  I  +  L YL +
Sbjct: 60  --LNLPKPYPIP---------SSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYI 108

Query: 150 SYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVENLWWLPGLSFLKDLDLSYVNLSKASDWL 209
           ++T   G IP  L  +  L  LD S+N L       +  L  L  +     N    +   
Sbjct: 109 THTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDG-NRISGAIPD 167

Query: 210 RVTNTLPSLVKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPNWVFGLIQLVF 269
              +       + +SR +L    P   AN +             ++ V        Q + 
Sbjct: 168 SYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIH 227

Query: 270 L---------------------DLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNW 308
           L                     DLR N   G +P+GL  L  L  L +  N     IP  
Sbjct: 228 LAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG 287

Query: 309 LYRFNRLESLGVSNNSL 325
                R +    +NN  
Sbjct: 288 G-NLQRFDVSAYANNKC 303


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query938
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.15
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.14
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.1
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.12
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.68
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.39
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.1
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.66
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=3.3e-38  Score=340.41  Aligned_cols=293  Identities=27%  Similarity=0.374  Sum_probs=221.3

Q ss_pred             CCcHHHHHHHHHhhhcCCCCCCCCCCCCCCCCCcc--ccceeeCCCC--CcEEEEecCCCCCccCCccCCCCCCcccCc-
Q 036642           33 GCLESERRALLRFKQDLQDPSNRLASWIGYEDCCA--WAGVVCDNVT--GHIVELNLRNPFTYCDLSQSKANPRSMLVG-  107 (938)
Q Consensus        33 ~~~~~~~~~ll~~k~~~~~~~~~l~~W~~~~~~c~--w~gv~c~~~~--~~v~~l~L~~~~~~~~~~~~~~~~~~~~~g-  107 (938)
                      -|.++|++||++||+++.||. .+++|..++|||.  |+||+|+..+  +||+.++|++.               .+.| 
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~---------------~l~g~   65 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL---------------NLPKP   65 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECC---------------CCSSC
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCC---------------CCCCC
Confidence            399999999999999998874 6899976689994  9999998644  48999999984               5555 


Q ss_pred             -cccCCccCCCCCCEEeCCC-CCCCCCcccccccCCCCCcEEecCCCcCCCCCCcCCCCCCcccEEECCCCcccccCccc
Q 036642          108 -KVNPSLLDLKHLSYLDLSY-NDFQGVQIPRFICSMGNLRYLNLSYTQFVGMIPPQLGNLSNLQYLDLSWNFLYVENLWW  185 (938)
Q Consensus       108 -~l~~~l~~l~~L~~L~Ls~-n~l~~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~L~~L~~L~Ls~n~i~~~~~~~  185 (938)
                       .+|++++++++|++|||++ |++++. +|..++++++|++|+|++|++.+..|..+..+.+|+++++++|.+....+..
T Consensus        66 ~~lp~~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~  144 (313)
T d1ogqa_          66 YPIPSSLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPS  144 (313)
T ss_dssp             EECCGGGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGG
T ss_pred             CCCChHHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccccccccCchh
Confidence             6889999999999999987 788884 8999999999999999999999988988999999999999999888777777


Q ss_pred             cCCCCCCCEEeCCCCCCCCCcchhhhhCCCCCC-cEEEcCCCCCCCCCcccccCCCCCCEEECCCCCCCCccCcccccCC
Q 036642          186 LPGLSFLKDLDLSYVNLSKASDWLRVTNTLPSL-VKLRLSRCQLHHLPPLAIANFSTLTTLDLLYNQFDNSFVPNWVFGL  264 (938)
Q Consensus       186 ~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~l~~L-~~L~L~~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~l  264 (938)
                      +.+++.|+++++++|.+++.  ++..+..+.++ +.+++++|++++..+..+..+..+ .+++..+...+.. +..+..+
T Consensus       145 l~~l~~L~~l~l~~n~l~~~--ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~-~~~~~~~  220 (313)
T d1ogqa_         145 ISSLPNLVGITFDGNRISGA--IPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDA-SVLFGSD  220 (313)
T ss_dssp             GGGCTTCCEEECCSSCCEEE--CCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECC-GGGCCTT
T ss_pred             hccCcccceeeccccccccc--cccccccccccccccccccccccccccccccccccc-ccccccccccccc-ccccccc
Confidence            88888888888887777642  22344445444 667777777777666666665443 5666666666554 6666666


Q ss_pred             CCCCEEEccCCcccCCCCccccCCCCCCEEECcCCcCCCccchhhhcCCCCCEEEccCCcCCchhhHhhhccCCCCeeec
Q 036642          265 IQLVFLDLRRNNFQGPIPEGLQNLTSLKHLLLDSNRFNSSIPNWLYRFNRLESLGVSNNSLQGRVIRSMASLCNLRSVML  344 (938)
Q Consensus       265 ~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L  344 (938)
                      ++++.+++++|.+.+.+| .+..+++|++|++++|+++|.+|.+++++++|++|+|++|+++|.+|. ++++++|+.+++
T Consensus       221 ~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l  298 (313)
T d1ogqa_         221 KNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAY  298 (313)
T ss_dssp             SCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGT
T ss_pred             cccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHh
Confidence            677777777776665443 456666777777777777666676677777777777777776666653 455666666666


Q ss_pred             CCCc
Q 036642          345 SCVK  348 (938)
Q Consensus       345 ~~n~  348 (938)
                      ++|+
T Consensus       299 ~~N~  302 (313)
T d1ogqa_         299 ANNK  302 (313)
T ss_dssp             CSSS
T ss_pred             CCCc
Confidence            6665



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure