Citrus Sinensis ID: 036656

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------
MMSSIIVSICFFIFCCFSFSLQSTDSALKSNETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTCSPRHQRVTALLLPSLLLQGSLSPHIGNLSFLRVLSLKNNSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNISHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPSSFGNLSSLQVLSASANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLPSDLGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPSFGNLHKLQRVIISMNHLGNGEKDDLEFVNSLVNASRLELLQININNFGGMLPEAVGN
cHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccccccccccEEcccccccEEEEEccccccEEEEcccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEEEccEEEEccccccccccccccEEccccEEEEcccHHHHcccccccEEEEccccccccccccccccccccEEcccccccccccHHHHcccccccEEEccccccEEcccHHHHHHccccEEEccccccEEccccccccccccEEEcccccccccccccccHHHHccccccccEEEcccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccEEEEEcccccccEEEEEEccccccccccHcHcccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEcEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHHHccHcccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccEEEEcccccccccccccccccHHHcccccccEEEEccccccccccHcccc
MMSSIIVSICFFIFCCfsfslqstdsalksNETDQLALLEFKakitydplevlsswnysrhfcqwkgvtcsprhqrVTALLLPslllqgslsphignLSFLRVLSLKNNSFRNEIPRAIGYLFRLRILrldnntfggqipdnishCIKLESLRlgfnelegkvpgklgslpklRILVIHsnnlsgeipssfgnlsSLQVLSASANQFVGQIPATLSELKRMRYIsfggnklsgeipfsiynlstlsdfhfpfnqlrgslpsdlgftlpnlevlnlganqftgpipasisnasnlmrlgipmngfrgkvpsfgnlhKLQRVIISMnhlgngekddLEFVNSLVNASRLELLQININNfggmlpeavgn
MMSSIIVSICFFIFCCFSFSLQSTDSALKSNETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTCSPRHQRVTALLLPSLLLQGSLSPHIGNLSFLRVLSLKNNSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNISHCIKLESLRLGFNELEGKvpgklgslpKLRILVIHSNNLSGEIPSSFGNLSSLQVLSASANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLPSDLGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPSFGNLHKLQRVIISMNHLGNGEKDDLEFVNSLVNASRLELLQININNfggmlpeavgn
MMssiivsicffifccfsfsLQSTDSALKSNETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTCSPRHQRVTAlllpslllqgslsPHIGNLSFLRVLSLKNNSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNISHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPSSFGNLSSLQVLSASANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLPSDLGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPSFGNLHKLQRVIISMNHLGNGEKDDLEFVNSLVNASRLELLQININNFGGMLPEAVGN
****IIVSICFFIFCCFSFSLQSTD**L***ETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTCSPRHQRVTALLLPSLLLQGSLSPHIGNLSFLRVLSLKNNSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNISHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPSSFGNLSSLQVLSASANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLPSDLGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPSFGNLHKLQRVIISMNHLGNGEKDDLEFVNSLVNASRLELLQININNFGGM*******
***SIIVSICFFIFCCFSFSLQSTDSA***NETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTCSPRHQRVTALLLPSLLLQGSLSPHIGNLSFLRVLSLKNNSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNISHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPSSFGNLSSLQVLSASANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLPSDLGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPSFGNLHKLQRVIISMNHLGNGEKDDLEFVNSLVNASRLELLQININNFGGMLPEAVGN
MMSSIIVSICFFIFCCFSFSLQSTDSALKSNETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTCSPRHQRVTALLLPSLLLQGSLSPHIGNLSFLRVLSLKNNSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNISHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPSSFGNLSSLQVLSASANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLPSDLGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPSFGNLHKLQRVIISMNHLGNGEKDDLEFVNSLVNASRLELLQININNFGGMLPEAVGN
*MSSIIVSICFFIFCCFSFSLQSTDSALKSNETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTCSPRHQRVTALLLPSLLLQGSLSPHIGNLSFLRVLSLKNNSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNISHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPSSFGNLSSLQVLSASANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLPSDLGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPSFGNLHKLQRVIISMNHLGNGEKDDLEFVNSLVNASRLELLQININNFGGMLP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMSSIIVSICFFIFCCFSFSLQSTDSALKSNETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTCSPRHQRVTALLLPSLLLQGSLSPHIGNLSFLRVLSLKNNSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNISHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPSSFGNLSSLQVLSASANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLPSDLGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPSFGNLHKLQRVIISMNHLGNGEKDDLEFVNSLVNASRLELLQININNFGGMLPEAVGN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query367 2.2.26 [Sep-21-2011]
C0LGP4 1010 Probable LRR receptor-lik yes no 0.899 0.326 0.437 3e-70
C0LGT6 1031 LRR receptor-like serine/ no no 0.959 0.341 0.426 3e-67
Q9SD62 1025 Putative receptor-like pr no no 0.953 0.341 0.443 3e-64
Q9FL28 1173 LRR receptor-like serine/ no no 0.945 0.295 0.349 6e-44
Q9C9H7 847 Receptor-like protein 12 no no 0.874 0.378 0.355 9e-43
O49318 1124 Probable leucine-rich rep no no 0.891 0.290 0.349 6e-40
Q9M2Z1 1002 Leucine-rich repeat recep no no 0.891 0.326 0.360 7e-40
C0LGQ5 1249 LRR receptor-like serine/ no no 0.885 0.260 0.328 2e-39
Q9LVP0 1102 Probable leucine-rich rep no no 0.863 0.287 0.355 3e-39
O49545 1003 Leucine-rich repeat recep no no 0.880 0.322 0.366 4e-39
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function desciption
 Score =  265 bits (678), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 148/338 (43%), Positives = 206/338 (60%)

Query: 30  SNETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTCSPRHQRVTALLLPSLLLQG 89
           ++ETD+ ALL+FK++++ D   VLSSWN+S   C WKGVTC  +++RVT L L  L L G
Sbjct: 21  TDETDRQALLQFKSQVSEDKRVVLSSWNHSFPLCNWKGVTCGRKNKRVTHLELGRLQLGG 80

Query: 90  SLSPHIGNLSFLRVLSLKNNSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNISHCIKL 149
            +SP IGNLSFL  L L  N F   IP+ +G L RL  L +  N   G IP  + +C +L
Sbjct: 81  VISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSRL 140

Query: 150 ESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPSSFGNLSSLQVLSASANQFVG 209
            +LRL  N L G VP +LGSL  L  L ++ NN+ G++P+S GNL+ L+ L+ S N   G
Sbjct: 141 LNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLEG 200

Query: 210 QIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLPSDLGFTLPN 269
           +IP+ +++L ++  +    N  SG  P ++YNLS+L      +N   G L  DLG  LPN
Sbjct: 201 EIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGILLPN 260

Query: 270 LEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPSFGNLHKLQRVIISMNHLGN 329
           L   N+G N FTG IP ++SN S L RLG+  N   G +P+FGN+  L+ + +  N LG+
Sbjct: 261 LLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIPTFGNVPNLKLLFLHTNSLGS 320

Query: 330 GEKDDLEFVNSLVNASRLELLQININNFGGMLPEAVGN 367
               DLEF+ SL N ++LE L I  N  GG LP ++ N
Sbjct: 321 DSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPISIAN 358

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query367
255577438 1028 receptor-kinase, putative [Ricinus commu 0.983 0.351 0.528 3e-96
224145847418 predicted protein [Populus trichocarpa] 0.950 0.834 0.522 1e-95
255585471 963 serine-threonine protein kinase, plant-t 0.959 0.365 0.515 1e-95
224097748 1032 predicted protein [Populus trichocarpa] 0.964 0.343 0.558 5e-95
224081190 1011 predicted protein [Populus trichocarpa] 0.978 0.355 0.527 5e-94
224097750 1023 predicted protein [Populus trichocarpa] 0.983 0.352 0.521 9e-94
224127492 1022 predicted protein [Populus trichocarpa] 0.956 0.343 0.539 1e-92
224119022 1021 predicted protein [Populus trichocarpa] 0.978 0.351 0.509 2e-92
147853780 1904 hypothetical protein VITISV_030954 [Viti 0.978 0.188 0.5 3e-92
224097752 1025 predicted protein [Populus trichocarpa] 0.983 0.352 0.508 2e-91
>gi|255577438|ref|XP_002529598.1| receptor-kinase, putative [Ricinus communis] gi|223530931|gb|EEF32790.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  358 bits (918), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 192/363 (52%), Positives = 248/363 (68%), Gaps = 2/363 (0%)

Query: 7   VSICFFIFCCFSFSLQSTDSAL--KSNETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQ 64
           +SI   ++  F   +Q + S+L  + NETD+L+LL FKA IT DPL +LSSWN S HFC+
Sbjct: 6   ISIFILLWVLFLKMIQLSCSSLSGRGNETDRLSLLAFKAHITDDPLHILSSWNESLHFCK 65

Query: 65  WKGVTCSPRHQRVTALLLPSLLLQGSLSPHIGNLSFLRVLSLKNNSFRNEIPRAIGYLFR 124
           W G+TC  RHQRV  + L S  L GSL+  IGNLSFLRVL+L+NNS  + IP+ IG LFR
Sbjct: 66  WSGITCGSRHQRVIEIDLESSRLSGSLTAFIGNLSFLRVLNLQNNSLSHYIPQEIGRLFR 125

Query: 125 LRILRLDNNTFGGQIPDNISHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLS 184
           LR L L  N+F G+IP NIS+C  L +LRLG N L GK+P +L SL KL++     N L+
Sbjct: 126 LRTLILRRNSFSGEIPVNISYCSNLLTLRLGRNNLTGKLPAELKSLSKLQMFEFEINYLT 185

Query: 185 GEIPSSFGNLSSLQVLSASANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLST 244
           GEI  SF NLSSL+++  + N F G+IP ++ +LK ++  S GG+  SG IP SI+NLS+
Sbjct: 186 GEISPSFSNLSSLEIIYGTRNNFHGEIPNSIGQLKSLQTFSLGGSNFSGVIPPSIFNLSS 245

Query: 245 LSDFHFPFNQLRGSLPSDLGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGF 304
           L+    P NQL G+LP DLG +LP LEVL L AN+F+G IP +ISNASNL+ L +  N F
Sbjct: 246 LTILSVPINQLHGNLPPDLGQSLPKLEVLRLYANKFSGSIPPTISNASNLVALDVSQNNF 305

Query: 305 RGKVPSFGNLHKLQRVIISMNHLGNGEKDDLEFVNSLVNASRLELLQININNFGGMLPEA 364
            GKVPS   LH L  + I  N+LGNGE DDL F+ +L N + LE+L I  NN GG+LPE 
Sbjct: 306 TGKVPSLARLHNLSYIGIHKNNLGNGEDDDLSFLYTLANNTNLEILAITENNLGGVLPEM 365

Query: 365 VGN 367
           + N
Sbjct: 366 LSN 368

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224145847|ref|XP_002336269.1| predicted protein [Populus trichocarpa] gi|222833133|gb|EEE71610.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255585471|ref|XP_002533428.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526716|gb|EEF28948.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224097748|ref|XP_002311065.1| predicted protein [Populus trichocarpa] gi|222850885|gb|EEE88432.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224081190|ref|XP_002306327.1| predicted protein [Populus trichocarpa] gi|222855776|gb|EEE93323.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224097750|ref|XP_002311066.1| predicted protein [Populus trichocarpa] gi|222850886|gb|EEE88433.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127492|ref|XP_002329291.1| predicted protein [Populus trichocarpa] gi|222870745|gb|EEF07876.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224119022|ref|XP_002331306.1| predicted protein [Populus trichocarpa] gi|222873889|gb|EEF11020.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147853780|emb|CAN83822.1| hypothetical protein VITISV_030954 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224097752|ref|XP_002311067.1| predicted protein [Populus trichocarpa] gi|222850887|gb|EEE88434.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query367
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.920 0.329 0.439 7.9e-70
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.920 0.327 0.435 1.1e-69
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.920 0.334 0.420 1e-65
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.920 0.334 0.424 2.3e-63
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.910 0.325 0.418 4.9e-60
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.920 0.334 0.389 3.8e-56
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.899 0.405 0.344 2.9e-44
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.847 0.329 0.381 3.9e-44
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.716 0.310 0.405 4.8e-41
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.904 0.283 0.350 5.4e-41
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 710 (255.0 bits), Expect = 7.9e-70, P = 7.9e-70
 Identities = 149/339 (43%), Positives = 200/339 (58%)

Query:    30 SNETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTCSPRHQRVTAXXXXXXXXXX 89
             + ETD+ ALLEFK++++     VL SWN S   C W GV C  +H+RVT           
Sbjct:    36 TEETDKQALLEFKSQVSETSRVVLGSWNDSLPLCSWTGVKCGLKHRRVTGVDLGGLKLTG 95

Query:    90 XXXPHIGNLSFLRVLSLKNNSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNISHCIKL 149
                P +GNLSFLR L+L +N F   IP  +G LFRL+ L + NN FGG IP  +S+C  L
Sbjct:    96 VVSPFVGNLSFLRSLNLADNFFHGAIPSEVGNLFRLQYLNMSNNLFGGVIPVVLSNCSSL 155

Query:   150 ESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPSSFGNLSSLQVLSASANQFVG 209
              +L L  N LE  VP + GSL KL +L +  NNL+G+ P+S GNL+SLQ+L    NQ  G
Sbjct:   156 STLDLSSNHLEQGVPLEFGSLSKLVLLSLGRNNLTGKFPASLGNLTSLQMLDFIYNQIEG 215

Query:   210 QIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLPSDLGFTLPN 269
             +IP  ++ LK+M +     NK +G  P  IYNLS+L       N   G+L  D G  LPN
Sbjct:   216 EIPGDIARLKQMIFFRIALNKFNGVFPPPIYNLSSLIFLSITGNSFSGTLRPDFGSLLPN 275

Query:   270 LEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVP-SFGNLHKLQRVIISMNHLG 328
             L++L +G N FTG IP ++SN S+L +L IP N   GK+P SFG L  L  + ++ N LG
Sbjct:   276 LQILYMGINSFTGTIPETLSNISSLRQLDIPSNHLTGKIPLSFGRLQNLLLLGLNNNSLG 335

Query:   329 NGEKDDLEFVNSLVNASRLELLQININNFGGMLPEAVGN 367
             N    DL+F+ +L N S+L+ L +  N  GG LP  + N
Sbjct:   336 NYSSGDLDFLGALTNCSQLQYLNVGFNKLGGQLPVFIAN 374
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query367
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-58
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-32
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-27
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-22
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-11
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  202 bits (514), Expect = 6e-58
 Identities = 129/358 (36%), Positives = 193/358 (53%), Gaps = 17/358 (4%)

Query: 11  FFIFCCFSFSLQSTDSALKSNETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTC 70
           + IF  F   L    S L + E +   LL FK+ I  DPL+ LS+WN S   C W+G+TC
Sbjct: 11  YLIFMLFFLFLNF--SMLHAEELE--LLLSFKSSIN-DPLKYLSNWNSSADVCLWQGITC 65

Query: 71  SPRHQRVTALLLPSLLLQGSLSPHIGNLSFLRVLSLKNNSFRNEIPRAIGYL-FRLRILR 129
           +    RV ++ L    + G +S  I  L +++ ++L NN     IP  I      LR L 
Sbjct: 66  N-NSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLN 124

Query: 130 LDNNTFGGQIPDNISHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPS 189
           L NN F G IP        LE+L L  N L G++P  +GS   L++L +  N L G+IP+
Sbjct: 125 LSNNNFTGSIPRGSIPN--LETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPN 182

Query: 190 SFGNLSSLQVLSASANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFH 249
           S  NL+SL+ L+ ++NQ VGQIP  L ++K +++I  G N LSGEIP+ I  L++L+   
Sbjct: 183 SLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLD 242

Query: 250 FPFNQLRGSLPSDLGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVP 309
             +N L G +PS LG  L NL+ L L  N+ +GPIP SI +   L+ L +  N   G++P
Sbjct: 243 LVYNNLTGPIPSSLG-NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIP 301

Query: 310 SF-GNLHKLQRVIISMNHLGNGEKDDLEFVNSLVNASRLELLQININNFGGMLPEAVG 366
                L  L+ + +  N+         +   +L +  RL++LQ+  N F G +P+ +G
Sbjct: 302 ELVIQLQNLEILHLFSNNFTG------KIPVALTSLPRLQVLQLWSNKFSGEIPKNLG 353

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 367
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.84
KOG4237498 consensus Extracellular matrix protein slit, conta 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.72
PLN03150623 hypothetical protein; Provisional 99.6
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.34
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.33
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.31
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.31
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.26
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.26
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.23
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.23
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.19
PLN03150623 hypothetical protein; Provisional 99.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.08
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.94
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.8
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.63
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.62
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.57
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.55
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.52
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.5
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.31
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.3
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.28
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.14
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.11
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.07
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.06
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
PRK15386 426 type III secretion protein GogB; Provisional 97.98
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.98
PRK15386 426 type III secretion protein GogB; Provisional 97.84
KOG4341483 consensus F-box protein containing LRR [General fu 97.63
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.47
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.46
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.41
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.36
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.27
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.03
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.83
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.69
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.24
KOG4341483 consensus F-box protein containing LRR [General fu 96.12
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.65
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.49
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.21
KOG4308 478 consensus LRR-containing protein [Function unknown 95.1
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.56
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.27
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.65
KOG4308478 consensus LRR-containing protein [Function unknown 93.54
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.84
smart0037026 LRR Leucine-rich repeats, outliers. 92.58
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.58
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.08
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.08
smart0037026 LRR Leucine-rich repeats, outliers. 90.08
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 89.85
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=5.8e-43  Score=357.35  Aligned_cols=325  Identities=34%  Similarity=0.572  Sum_probs=210.8

Q ss_pred             CHHhHHHHHHHHHhCCCCCCCCCCCCCCCCCCCCccceEecCCCCcEEEEEcCCCCcccccCccccCCCCCcEEEccCCC
Q 036656           31 NETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTCSPRHQRVTALLLPSLLLQGSLSPHIGNLSFLRVLSLKNNS  110 (367)
Q Consensus        31 ~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~~~~~~c~~~~~~v~~l~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~  110 (367)
                      .+.|+.+|.+|++.+. +|...+.+|....++|.|.|+.|... .+|+.|+++++++.|.++..+..+++|+.|++++|+
T Consensus        27 ~~~~~~~l~~~~~~~~-~~~~~~~~w~~~~~~c~w~gv~c~~~-~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~  104 (968)
T PLN00113         27 HAEELELLLSFKSSIN-DPLKYLSNWNSSADVCLWQGITCNNS-SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQ  104 (968)
T ss_pred             CHHHHHHHHHHHHhCC-CCcccCCCCCCCCCCCcCcceecCCC-CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCc
Confidence            4578999999999986 67667789988889999999999854 699999999999999999999999999999999999


Q ss_pred             CCCCcchhhc-CCCCCcEEEccCCCCCCCcCccccCCCCCCEEEeeCCCCCCCCCCcCCCCCCCcEEEcccccccccCCC
Q 036656          111 FRNEIPRAIG-YLFRLRILRLDNNTFGGQIPDNISHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPS  189 (367)
Q Consensus       111 l~~~~~~~l~-~l~~L~~L~l~~~~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~  189 (367)
                      +++.+|..+. .+++|++|++++|.+++.+|.  ..+++|++|++++|.+.+..|..++.+++|++|++++|.+.+.+|.
T Consensus       105 ~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~  182 (968)
T PLN00113        105 LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPN  182 (968)
T ss_pred             cCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCCh
Confidence            9888887654 777788888777777655543  2344555555555555444444455555555555555554444444


Q ss_pred             CCCCCCCCCEEEcccCcC------------------------cccCCcccCCCCCCCEEEeecCcCccccCccccCCCCC
Q 036656          190 SFGNLSSLQVLSASANQF------------------------VGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTL  245 (367)
Q Consensus       190 ~l~~l~~L~~L~l~~n~~------------------------~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~l~~~~~L  245 (367)
                      .++++++|++|++++|.+                        .+.+|..+..+++|++|++++|.+.+..|..+.++++|
T Consensus       183 ~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L  262 (968)
T PLN00113        183 SLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNL  262 (968)
T ss_pred             hhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCC
Confidence            444444555555544444                        44444444445555555555555544445555555555


Q ss_pred             CEEECCCCcCcccCChhhhcCCCCCCEEEeecCcCccccchhhhCCCCCCeEeccCccCcccCCC-CCCCCCCCEEEccC
Q 036656          246 SDFHFPFNQLRGSLPSDLGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPS-FGNLHKLQRVIISM  324 (367)
Q Consensus       246 ~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~-~~~~~~L~~L~l~~  324 (367)
                      ++|++++|.+.+.+|..+. .+++|++|++++|.+.+.+|..+..+++|+.|++++|.+.+.+|. +..+++|+.|++++
T Consensus       263 ~~L~L~~n~l~~~~p~~l~-~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~  341 (968)
T PLN00113        263 QYLFLYQNKLSGPIPPSIF-SLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWS  341 (968)
T ss_pred             CEEECcCCeeeccCchhHh-hccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcC
Confidence            5555555555544444444 355555555555555555555555555555555555555555554 55556666666666


Q ss_pred             CcCCCcCCCchhhhhhhcCCCCCCEEeCcCCeeeeeCCCCCC
Q 036656          325 NHLGNGEKDDLEFVNSLVNASRLELLQININNFGGMLPEAVG  366 (367)
Q Consensus       325 n~l~~~~~~~~~~~~~l~~~~~L~~L~l~~n~l~g~iP~~~~  366 (367)
                      |.+++.      .+..+..+++|+.|++++|+++|.+|+++|
T Consensus       342 n~l~~~------~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~  377 (968)
T PLN00113        342 NKFSGE------IPKNLGKHNNLTVLDLSTNNLTGEIPEGLC  377 (968)
T ss_pred             CCCcCc------CChHHhCCCCCcEEECCCCeeEeeCChhHh
Confidence            666555      344556677777777777777777777665

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query367
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-24
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-24
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-19
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 7e-05
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 142/280 (50%), Gaps = 13/280 (4%)
Query: 93  PHIGNLSFLRVLSLKNNSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNISHCIKLESL 152
           P +G+ S L+ L +  N    +  RAI     L++L + +N F G IP        L+ L
Sbjct: 217 PFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP--LPLKSLQYL 274
Query: 153 RLGFNELEGKVPGKL-GSLPKLRILVIHSNNLSGEIPSSFGNLSSLQVLSASANQFVGQI 211
            L  N+  G++P  L G+   L  L +  N+  G +P  FG+ S L+ L+ S+N F G++
Sbjct: 275 SLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGEL 334
Query: 212 PA-TLSELKRMRYISFGGNKLSGEIPFSIYNLS-TLSDFHFPFNQLRGSLPSDLGFTLPN 269
           P  TL +++ ++ +    N+ SGE+P S+ NLS +L       N   G +  +L     N
Sbjct: 335 PMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKN 394
Query: 270 -LEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVP-SFGNLHKLQRVIISMNHL 327
            L+ L L  N FTG IP ++SN S L+ L +  N   G +P S G+L KL+ + + +N L
Sbjct: 395 TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNML 454
Query: 328 GNGEKDDLEFVNSLVNASRLELLQININNFGGMLPEAVGN 367
                 +L +V +      LE L ++ N+  G +P  + N
Sbjct: 455 EGEIPQELMYVKT------LETLILDFNDLTGEIPSGLSN 488
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query367
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-84
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-70
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-58
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-52
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-51
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-46
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-30
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-29
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-26
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-30
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-29
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-36
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-34
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-27
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-27
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-25
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-18
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-12
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  257 bits (660), Expect = 2e-84
 Identities = 89/303 (29%), Positives = 131/303 (43%), Gaps = 13/303 (4%)

Query: 31  NETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQ--WKGVTCSPRHQ--RVTALLLPSLL 86
           N  D+ ALL+ K  +       LSSW  +   C   W GV C    Q  RV  L L  L 
Sbjct: 4   NPQDKQALLQIKKDLGNPT--TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLN 61

Query: 87  LQGS--LSPHIGNLSFLRVLSL-KNNSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNI 143
           L     +   + NL +L  L +   N+    IP AI  L +L  L + +    G IPD +
Sbjct: 62  LPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFL 121

Query: 144 SHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPSSFGNLSSL-QVLSA 202
           S    L +L   +N L G +P  + SLP L  +    N +SG IP S+G+ S L   ++ 
Sbjct: 122 SQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTI 181

Query: 203 SANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLPSD 262
           S N+  G+IP T + L  + ++    N L G+      +       H   N L   L   
Sbjct: 182 SRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK- 239

Query: 263 LGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPSFGNLHKLQRVII 322
           +G    NL  L+L  N+  G +P  ++    L  L +  N   G++P  GNL +      
Sbjct: 240 VGL-SKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAY 298

Query: 323 SMN 325
           + N
Sbjct: 299 ANN 301
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query367
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.98
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.98
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.97
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.92
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.89
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.87
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.83
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.79
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.43
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.41
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.28
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.21
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.2
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.15
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.14
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.13
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.09
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.02
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.74
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.63
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.56
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.4
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.27
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.85
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.62
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.56
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=7.5e-45  Score=361.40  Aligned_cols=326  Identities=27%  Similarity=0.387  Sum_probs=206.7

Q ss_pred             cCCCCHHhHHHHHHHHHhCCCCCCCCCCCCCCCCCCCCccceEecCCCCcEEEEEcCCCCcccc---cC-----------
Q 036656           27 ALKSNETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQWKGVTCSPRHQRVTALLLPSLLLQGS---LS-----------   92 (367)
Q Consensus        27 ~~~~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~~~~~~c~~~~~~v~~l~l~~~~~~~~---~~-----------   92 (367)
                      ++...++|+.||++||+++. ||. .+.+|..+.+||.|.||.|+  .++|+.++++++.+.|.   ++           
T Consensus         6 ~~~~~~~~~~all~~k~~~~-~~~-~l~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~   81 (768)
T 3rgz_A            6 PSQSLYREIHQLISFKDVLP-DKN-LLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLES   81 (768)
T ss_dssp             --CCHHHHHHHHHHHHTTCS-CTT-SSTTCCTTSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCE
T ss_pred             cccCCHHHHHHHHHHHhhCC-Ccc-cccCCCCCCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhHhccCcccc
Confidence            34457789999999999998 777 88999988899999999998  37999999999998886   43           


Q ss_pred             ------------ccccCCCCCcEEEccCCCCCCCcch--hhcCCCCCcEEEccCCCCCCCcCccc-cCCCCCCEEEeeCC
Q 036656           93 ------------PHIGNLSFLRVLSLKNNSFRNEIPR--AIGYLFRLRILRLDNNTFGGQIPDNI-SHCIKLESLRLGFN  157 (367)
Q Consensus        93 ------------~~~~~l~~L~~L~l~~~~l~~~~~~--~l~~l~~L~~L~l~~~~l~~~~p~~~-~~l~~L~~L~l~~n  157 (367)
                                  ..++++++|++|++++|.+++.+|.  .++++++|++|++++|.+.+..|..+ .++++|++|++++|
T Consensus        82 l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n  161 (768)
T 3rgz_A           82 LFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSAN  161 (768)
T ss_dssp             EECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSS
T ss_pred             cCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCC
Confidence                        4567778888888888888877777  78888888888888888877777655 67778888888887


Q ss_pred             CCCCCCCCc---CCCCCCCcEEEcccccccccCCCCCCCCCCCCEEEcccCcCcccCCcccCCCCCCCEEEeecCcCccc
Q 036656          158 ELEGKVPGK---LGSLPKLRILVIHSNNLSGEIPSSFGNLSSLQVLSASANQFVGQIPATLSELKRMRYISFGGNKLSGE  234 (367)
Q Consensus       158 ~~~~~~~~~---l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~~~~~  234 (367)
                      .+++..+..   +..+++|++|++++|.+.+..+  +..+++|++|++++|.+++..|. +..+++|++|++++|.+++.
T Consensus       162 ~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~  238 (768)
T 3rgz_A          162 SISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGD  238 (768)
T ss_dssp             CCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSC
T ss_pred             ccCCcCChhhhhhccCCCCCEEECCCCcccccCC--cccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCc
Confidence            777655544   5556666666666665554332  24555666666666665554444 55556666666666665555


Q ss_pred             cCccccCCCCCCEEECCCCcCcccC----------------------ChhhhcCCCCCCEEEeecCcCccccchhhhCCC
Q 036656          235 IPFSIYNLSTLSDFHFPFNQLRGSL----------------------PSDLGFTLPNLEVLNLGANQFTGPIPASISNAS  292 (367)
Q Consensus       235 ~~~~l~~~~~L~~L~l~~n~~~~~~----------------------~~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~l~  292 (367)
                      .|..+..+++|++|++++|.+++.+                      |..++..+++|++|++++|++++.+|..+..++
T Consensus       239 ~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~  318 (768)
T 3rgz_A          239 FSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCS  318 (768)
T ss_dssp             HHHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCT
T ss_pred             ccHHHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCC
Confidence            5555555555555555555555444                      433332224444444444444444444444444


Q ss_pred             CCCeEeccCccCcccCCC--CCCCCCCCEEEccCCcCCCcCCCchhhhhhhcCCC-CCCEEeCcCCeeeeeCCCCC
Q 036656          293 NLMRLGIPMNGFRGKVPS--FGNLHKLQRVIISMNHLGNGEKDDLEFVNSLVNAS-RLELLQININNFGGMLPEAV  365 (367)
Q Consensus       293 ~L~~L~l~~n~~~~~~~~--~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~l~~~~-~L~~L~l~~n~l~g~iP~~~  365 (367)
                      +|++|++++|.+++.+|.  +..+++|++|++++|++++.+|      ..+..++ +|++|++++|+++|.+|+.+
T Consensus       319 ~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p------~~l~~l~~~L~~L~Ls~N~l~~~~~~~~  388 (768)
T 3rgz_A          319 LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP------ESLTNLSASLLTLDLSSNNFSGPILPNL  388 (768)
T ss_dssp             TCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCC------TTHHHHTTTCSEEECCSSEEEEECCTTT
T ss_pred             CccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCcccc------HHHHhhhcCCcEEEccCCCcCCCcChhh
Confidence            445555544444444442  4444455555555554444422      2233333 55555555555555555544
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 367
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-28
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score =  109 bits (272), Expect = 6e-28
 Identities = 79/302 (26%), Positives = 118/302 (39%), Gaps = 11/302 (3%)

Query: 31  NETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQ--WKGVTCSP--RHQRVTALLLPSLL 86
           N  D+ ALL+ K  +       LSSW  +   C   W GV C    +  RV  L L  L 
Sbjct: 4   NPQDKQALLQIKKDLGNPT--TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLN 61

Query: 87  LQG--SLSPHIGNLSFLRVLSLKNN-SFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNI 143
           L     +   + NL +L  L +    +    IP AI  L +L  L + +    G IPD +
Sbjct: 62  LPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFL 121

Query: 144 SHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSNNLSGEIPSSFGNLSSLQVLSAS 203
           S    L +L   +N L G +P  + SLP L  +    N +SG IP S+G+ S L      
Sbjct: 122 SQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTI 181

Query: 204 ANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLPSDL 263
           +   +            + ++    N L G+      +       H   N L   L    
Sbjct: 182 SRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKV- 240

Query: 264 GFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPSFGNLHKLQRVIIS 323
                NL  L+L  N+  G +P  ++    L  L +  N   G++P  GNL +      +
Sbjct: 241 -GLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYA 299

Query: 324 MN 325
            N
Sbjct: 300 NN 301
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query367
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.98
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.59
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.57
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.32
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.28
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.41
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.35
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.11
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.87
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.71
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.21
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=1.5e-42  Score=307.44  Aligned_cols=293  Identities=30%  Similarity=0.529  Sum_probs=203.1

Q ss_pred             CCCHHhHHHHHHHHHhCCCCCCCCCCCCCCCCCCCC--ccceEecCCC--CcEEEEEcCCCCccc--ccCccccCCCCCc
Q 036656           29 KSNETDQLALLEFKAKITYDPLEVLSSWNYSRHFCQ--WKGVTCSPRH--QRVTALLLPSLLLQG--SLSPHIGNLSFLR  102 (367)
Q Consensus        29 ~~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~--~~~~~c~~~~--~~v~~l~l~~~~~~~--~~~~~~~~l~~L~  102 (367)
                      -|.++|++||++||+++. +|. .+.+|..+.|||.  |.||+|+..+  .||++|+++++++.|  .+|..++++++|+
T Consensus         2 ~c~~~e~~aLl~~k~~~~-~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~   79 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLG-NPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLN   79 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTT-CCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCS
T ss_pred             CCCHHHHHHHHHHHHHCC-CCC-cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCcccc
Confidence            478999999999999997 443 5889998889994  9999998754  489999999998887  4677888888888


Q ss_pred             EEEccC-CCCCCCcchhhcCCCCCcEEEccCCCCCCCcCccccCCCCCCEEEeeCCCCCCCCCCcCCCCCCCcEEEcccc
Q 036656          103 VLSLKN-NSFRNEIPRAIGYLFRLRILRLDNNTFGGQIPDNISHCIKLESLRLGFNELEGKVPGKLGSLPKLRILVIHSN  181 (367)
Q Consensus       103 ~L~l~~-~~l~~~~~~~l~~l~~L~~L~l~~~~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n  181 (367)
                      +|+|++ |+++|.+|..|+++++|++|++++|.+.+..+..+..+..|++++++.|.+.+.+|..+..+++++++++++|
T Consensus        80 ~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n  159 (313)
T d1ogqa_          80 FLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGN  159 (313)
T ss_dssp             EEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSS
T ss_pred             ccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecccc
Confidence            888876 6777778888888888888888888877767777777777777777777777667777777777777777777


Q ss_pred             cccccCCCCCCCCCCC-CEEEcccCcCcccCCcccCCCCCCCEEEeecCcCccccCccccCCCCCCEEECCCCcCcccCC
Q 036656          182 NLSGEIPSSFGNLSSL-QVLSASANQFVGQIPATLSELKRMRYISFGGNKLSGEIPFSIYNLSTLSDFHFPFNQLRGSLP  260 (367)
Q Consensus       182 ~~~~~~~~~l~~l~~L-~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~  260 (367)
                      .+.+.+|..+..+.++ +.++++.|++++..+..+..+.. ..++++.+...+..|..+..+++++.++++++.+.+.++
T Consensus       160 ~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~  238 (313)
T d1ogqa_         160 RISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-AFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG  238 (313)
T ss_dssp             CCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-SEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG
T ss_pred             cccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccccccccccccccccccccccccc
Confidence            7776666666666554 66666666666665555554433 356666666655555555556666666666665554333


Q ss_pred             hhhhcCCCCCCEEEeecCcCccccchhhhCCCCCCeEeccCccCcccCCCCCCCCCCCEEEccCCc
Q 036656          261 SDLGFTLPNLEVLNLGANQFTGPIPASISNASNLMRLGIPMNGFRGKVPSFGNLHKLQRVIISMNH  326 (367)
Q Consensus       261 ~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~~L~~L~l~~n~  326 (367)
                       .+. .+++|++|++++|+++|.+|..+..+++|++|+|++|+++|.+|.++.+++|+.+++++|+
T Consensus       239 -~~~-~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         239 -KVG-LSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNK  302 (313)
T ss_dssp             -GCC-CCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSS
T ss_pred             -ccc-cccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCc
Confidence             222 3555566666666555555555555555555555555555555555555555555555554
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure