Citrus Sinensis ID: 036666

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350

MKKTLLFFSFLFLLTMSNTFVSSLSPDGEALLSLISAAGPSAKASSSILSSWNPSNLTPCSWQGITCSPQNRVISLSLPDTFLNLSALPPQLSSLSSLQLLNLSSTNISGIIPPSFGQLTHLRLLDLSSNSLSGPIPEELGQLSLLQFLFLNTNRLSGSIPPQLANLTSLQVLCLQDNLLNGSIPSQLGSLVSLQQFRIGGNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTEVFGSIPPEIGLCSELRNLYLHMNKLTGSIPSELGKLQKLTSLLLWGNTLSGPIPAELSNCSALVVLDASANDLSGELPGDLGKLVLLEQLHLSDNMLT

cccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEcccccEEEEEccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEccccccEEcccHHccccccccEEEcccccccccccHHHcccccccEEEccccccccccccHHHHccccccEEEccccccccccccccccccccccEEccccccEEcccccccccccccEEEcccccccccccHHHHcccccccEEcccccccccccHHccccccccEEEcccccccccccHHHcccccccEEEccccccc

ccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccccEEEccHHHHHcccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccE

MKKTLLFFSFLFLLTMSNtfvsslspdGEALLSLISAagpsakasssilsswnpsnltpcswqgitcspqnrvislslpdtflnlsalppqlsslsslqllnlsstnisgiippsfgqlthlrlldlssnslsgpipeelgQLSLLQFLFLNtnrlsgsippqlanlTSLQVLCLqdnllngsipsqlgSLVSLQqfriggnpyltgeiptqlgmltnlttfgaaatglsgvipptfgnlinlqtlalydtevfgsippeigLCSELRNLYLHMNKltgsipselgKLQKLTSLLLWgntlsgpipaelsncsALVVLDAsandlsgelpgdlGKLVLLEQLHLSDNMLT

mkktllffsflflltmsNTFVSSLSPDGEALLSLIsaagpsakasssilsswnpsnlTPCSWQGITCSPQNRVISLSLPDTFlnlsalppqlsslsslqllnlssTNISGIIPPSFGQLTHlrlldlssnslsGPIPEElgqlsllqflflNTNRLSGSIPPQLANLTSLQVLCLQDNLLNGSIPSQLGSLVSLQQFRIGGNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTEVFGSIPPEIGLCSELRNLYLHMNKLTGSIPSElgklqkltslllWGNTLSGPIPAELSNCSALVVLDASANDLSGELPGDLGKLVLLEQLHLSDNMLT

***TLLFFSFLFLLTMSNTFVSSLS****ALLSLI****************WNPSNLTPCSWQGITCSPQNRVISLSLPDTFLNLSALPPQLSSLSSLQLLNLSSTNISGIIPPSFGQLTHLRLLDLSSNSL*GPIPEELGQLSLLQFLFLNTNRLSGSIPPQLANLTSLQVLCLQDNLLNGSIPSQLGSLVSLQQFRIGGNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTEVFGSIPPEIGLCSELRNLYLHMNKLTGSIPSELGKLQKLTSLLLWGNTLSGPIPAELSNCSALVVLDASANDLSGELPGDLGKLVLLEQL********

*KKTLLFFSFLFLLTMSNTFVSSLSPDGEALLSLISAAGPSAKASSSILSSWNPSNLTPCSWQGITCSPQNRVISLSLPDTFLNLSALPPQLSSLSSLQLLNLSSTNISGIIPPSFGQLTHLRLLDLSSNSLSGPIPEELGQLSLLQFLFLNTNRLSGSIPPQLANLTSLQVLCLQDNLLNGSIPSQLGSLVSLQQFRIGGNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTEVFGSIPPEIGLCSELRNLYLHMNKLTGSIPSELGKLQKLTSLLLWGNTLSGPIPAELSNCSALVVLDASANDLSGELPGDLGKLVLLEQLHLSDNMLT

MKKTLLFFSFLFLLTMSNTFVSSLSPDGEALLSLISAA***********SSWNPSNLTPCSWQGITCSPQNRVISLSLPDTFLNLSALPPQLSSLSSLQLLNLSSTNISGIIPPSFGQLTHLRLLDLSSNSLSGPIPEELGQLSLLQFLFLNTNRLSGSIPPQLANLTSLQVLCLQDNLLNGSIPSQLGSLVSLQQFRIGGNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTEVFGSIPPEIGLCSELRNLYLHMNKLTGSIPSELGKLQKLTSLLLWGNTLSGPIPAELSNCSALVVLDASANDLSGELPGDLGKLVLLEQLHLSDNMLT

*KKTLLFFSFLFLLTMSNTFVSSLSPDGEALLSLISAAGPS*K*SSSILSSWNPSNLTPCSWQGITCSPQNRVISLSLPDTFLNLSALPPQLSSLSSLQLLNLSSTNISGIIPPSFGQLTHLRLLDLSSNSLSGPIPEELGQLSLLQFLFLNTNRLSGSIPPQLANLTSLQVLCLQDNLLNGSIPSQLGSLVSLQQFRIGGNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTEVFGSIPPEIGLCSELRNLYLHMNKLTGSIPSELGKLQKLTSLLLWGNTLSGPIPAELSNCSALVVLDASANDLSGELPGDLGKLVLLEQLHLS*****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		350	2.2.26 [Sep-21-2011]
C0LGF5		1072	Probable LRR receptor-lik	yes	no	0.974	0.318	0.728	1e-117
Q9LHP4		1141	Receptor-like protein kin	no	no	0.854	0.262	0.458	5e-67
C0LGV1		1135	LRR receptor-like serine/	no	no	0.945	0.291	0.436	4e-66
C0LGR3		1091	Probable LRR receptor-lik	no	no	0.925	0.296	0.466	2e-64
Q8VZG8		1045	Probable LRR receptor-lik	no	no	0.931	0.311	0.415	5e-52
Q9LP24		1120	Probable leucine-rich rep	no	no	0.922	0.288	0.413	5e-52
Q9FL28		1173	LRR receptor-like serine/	no	no	0.985	0.294	0.387	2e-50
Q9LVP0		1102	Probable leucine-rich rep	no	no	0.922	0.293	0.382	4e-50
O49318		1124	Probable leucine-rich rep	no	no	0.974	0.303	0.364	2e-49
Q9SHI2		1101	Leucine-rich repeat recep	no	no	0.98	0.311	0.367	2e-49

>sp\|C0LGF5\|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2	Back alignment and function desciption

 Score =  423 bits (1088), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 255/350 (72%), Positives = 290/350 (82%), Gaps = 9/350 (2%)

Query: 2   KKTLLFFSFLFLLTMSNTFVS-SLSPDGEALLSLISAAGPSAKASSSILSSWNPSNLTPC 60
           +++  FF FLF   +S    + SLS DG+ALLSL        + S S+ SSW+P + TPC
Sbjct: 4   ERSNFFFLFLFCSWVSMAQPTLSLSSDGQALLSL-------KRPSPSLFSSWDPQDQTPC 56

Query: 61  SWQGITCSPQNRVISLSLPDTFLNLSALPPQLSSLSSLQLLNLSSTNISGIIPPSFGQLT 120
           SW GITCS  NRVIS+S+PDTFLNLS++P  LSSLSSLQ LNLSSTN+SG IPPSFG+LT
Sbjct: 57  SWYGITCSADNRVISVSIPDTFLNLSSIP-DLSSLSSLQFLNLSSTNLSGPIPPSFGKLT 115

Query: 121 HLRLLDLSSNSLSGPIPEELGQLSLLQFLFLNTNRLSGSIPPQLANLTSLQVLCLQDNLL 180
           HLRLLDLSSNSLSGPIP ELG+LS LQFL LN N+LSGSIP Q++NL +LQVLCLQDNLL
Sbjct: 116 HLRLLDLSSNSLSGPIPSELGRLSTLQFLILNANKLSGSIPSQISNLFALQVLCLQDNLL 175

Query: 181 NGSIPSQLGSLVSLQQFRIGGNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNL 240
           NGSIPS  GSLVSLQQFR+GGN  L G IP QLG L NLTT G AA+GLSG IP TFGNL
Sbjct: 176 NGSIPSSFGSLVSLQQFRLGGNTNLGGPIPAQLGFLKNLTTLGFAASGLSGSIPSTFGNL 235

Query: 241 INLQTLALYDTEVFGSIPPEIGLCSELRNLYLHMNKLTGSIPSELGKLQKLTSLLLWGNT 300
           +NLQTLALYDTE+ G+IPP++GLCSELRNLYLHMNKLTGSIP ELGKLQK+TSLLLWGN+
Sbjct: 236 VNLQTLALYDTEISGTIPPQLGLCSELRNLYLHMNKLTGSIPKELGKLQKITSLLLWGNS 295

Query: 301 LSGPIPAELSNCSALVVLDASANDLSGELPGDLGKLVLLEQLHLSDNMLT 350
           LSG IP E+SNCS+LVV D SANDL+G++PGDLGKLV LEQL LSDNM T
Sbjct: 296 LSGVIPPEISNCSSLVVFDVSANDLTGDIPGDLGKLVWLEQLQLSDNMFT 345

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1

>sp\|Q9LHP4\|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1	Back alignment and function description

>sp\|C0LGV1\|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1	Back alignment and function description

>sp\|C0LGR3\|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1	Back alignment and function description

>sp\|Q8VZG8\|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3	Back alignment and function description

>sp\|Q9LP24\|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1	Back alignment and function description

>sp\|Q9FL28\|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1	Back alignment and function description

>sp\|Q9LVP0\|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1	Back alignment and function description

>sp\|O49318\|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1	Back alignment and function description

>sp\|Q9SHI2\|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		350
356574561		1079	PREDICTED: probable LRR receptor-like se	0.931	0.302	0.815	1e-140
255572297		1075	Leucine-rich repeat receptor protein kin	0.737	0.24	0.891	1e-139
356534025		1081	PREDICTED: probable LRR receptor-like se	0.934	0.302	0.809	1e-136
224066599		941	predicted protein [Populus trichocarpa]	0.805	0.299	0.876	1e-136
449494185		1136	PREDICTED: probable LRR receptor-like se	0.802	0.247	0.787	1e-127
449446494		1066	PREDICTED: probable LRR receptor-like se	0.802	0.263	0.787	1e-127
359495205		1060	PREDICTED: probable LRR receptor-like se	0.822	0.271	0.847	1e-127
444737617		1078	Putative Receptor-like protein kinase 2	0.985	0.320	0.75	1e-122
413954515		1079	putative leucine-rich repeat receptor pr	0.928	0.301	0.703	1e-118
242096256		1076	hypothetical protein SORBIDRAFT_10g02291	0.928	0.302	0.7	1e-118

>gi\|356574561\|ref\|XP_003555414.1\| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g34110-like [Glycine max]	Back alignment and taxonomy information

 Score =  505 bits (1301), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 269/330 (81%), Positives = 302/330 (91%), Gaps = 4/330 (1%)

Query: 21  VSSLSPDGEALLSLISAAGPSAKASSSILSSWNPSNLTPCSWQGITCSPQNRVISLSLPD 80
           V+ LSPDG+ALLSL+    P+A++S S+LSSWNPS+ TPCSW+GITCSPQ RVISLS+PD
Sbjct: 29  VTCLSPDGQALLSLL----PAARSSPSVLSSWNPSSSTPCSWKGITCSPQGRVISLSIPD 84

Query: 81  TFLNLSALPPQLSSLSSLQLLNLSSTNISGIIPPSFGQLTHLRLLDLSSNSLSGPIPEEL 140
           TFLNLS+LPPQLSSLS LQLLNLSSTN+SG IPPSFGQL HL+LLDLSSNSL+G IP EL
Sbjct: 85  TFLNLSSLPPQLSSLSMLQLLNLSSTNVSGSIPPSFGQLPHLQLLDLSSNSLTGSIPAEL 144

Query: 141 GQLSLLQFLFLNTNRLSGSIPPQLANLTSLQVLCLQDNLLNGSIPSQLGSLVSLQQFRIG 200
           G+LS LQFL+LN+NRL+GSIP  L+NLTSL+V CLQDNLLNGSIPSQLGSL SLQQ RIG
Sbjct: 145 GRLSSLQFLYLNSNRLTGSIPQHLSNLTSLEVFCLQDNLLNGSIPSQLGSLTSLQQLRIG 204

Query: 201 GNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTEVFGSIPPE 260
           GNPYLTG+IP+QLG+LTNLTTFGAAATGLSGVIP TFGNLINLQTLALYDTE+ GSIPPE
Sbjct: 205 GNPYLTGQIPSQLGLLTNLTTFGAAATGLSGVIPSTFGNLINLQTLALYDTEISGSIPPE 264

Query: 261 IGLCSELRNLYLHMNKLTGSIPSELGKLQKLTSLLLWGNTLSGPIPAELSNCSALVVLDA 320
           +G CSELRNLYLHMNKLTGSIP +L KLQKLTSLLLWGN+L+GPIPAELSNCS+LV+ D 
Sbjct: 265 LGSCSELRNLYLHMNKLTGSIPPQLSKLQKLTSLLLWGNSLTGPIPAELSNCSSLVIFDV 324

Query: 321 SANDLSGELPGDLGKLVLLEQLHLSDNMLT 350
           S+NDLSGE+PGD GKLV+LEQLHLSDN LT
Sbjct: 325 SSNDLSGEIPGDFGKLVVLEQLHLSDNSLT 354

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255572297\|ref\|XP_002527087.1\| Leucine-rich repeat receptor protein kinase EXS precursor, putative [Ricinus communis] gi\|223533510\|gb\|EEF35250.1\| Leucine-rich repeat receptor protein kinase EXS precursor, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356534025\|ref\|XP_003535558.1\| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g34110-like [Glycine max]	Back alignment and taxonomy information

>gi\|224066599\|ref\|XP_002302156.1\| predicted protein [Populus trichocarpa] gi\|222843882\|gb\|EEE81429.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449494185\|ref\|XP_004159472.1\| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g34110-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449446494\|ref\|XP_004141006.1\| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g34110-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|359495205\|ref\|XP_002263569.2\| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g34110-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|444737617\|emb\|CCM07274.1\| Putative Receptor-like protein kinase 2 [Musa balbisiana]	Back alignment and taxonomy information

>gi\|413954515\|gb\|AFW87164.1\| putative leucine-rich repeat receptor protein kinase family protein [Zea mays]	Back alignment and taxonomy information

>gi\|242096256\|ref\|XP_002438618.1\| hypothetical protein SORBIDRAFT_10g022910 [Sorghum bicolor] gi\|241916841\|gb\|EER89985.1\| hypothetical protein SORBIDRAFT_10g022910 [Sorghum bicolor]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		350
TAIR\|locus:2131518		1091	AT4G26540 [Arabidopsis thalian	0.925	0.296	0.347	8e-48
TAIR\|locus:2085949		1141	AT3G24240 [Arabidopsis thalian	0.825	0.253	0.364	8.3e-47
TAIR\|locus:2161825		1090	AT5G56040 [Arabidopsis thalian	0.834	0.267	0.369	2.3e-45
TAIR\|locus:2154344		1135	AT5G48940 [Arabidopsis thalian	0.945	0.291	0.316	1.3e-40
TAIR\|locus:2011339		1120	AT1G35710 [Arabidopsis thalian	0.825	0.258	0.348	4.9e-38
TAIR\|locus:2138268		1045	AT4G08850 [Arabidopsis thalian	0.822	0.275	0.337	1e-36
TAIR\|locus:2170483		1173	FLS2 "FLAGELLIN-SENSITIVE 2" [	0.825	0.246	0.343	4.1e-35
TAIR\|locus:2160791		1102	AT5G63930 [Arabidopsis thalian	0.828	0.263	0.318	4.3e-34
TAIR\|locus:2046525		1124	AT2G33170 [Arabidopsis thalian	0.694	0.216	0.336	1.9e-33
TAIR\|locus:2139885		1013	AT4G28650 [Arabidopsis thalian	0.694	0.239	0.344	7.5e-33

TAIR\|locus:2131518 AT4G26540 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 510 (184.6 bits), Expect = 8.0e-48, P = 8.0e-48
 Identities = 114/328 (34%), Positives = 154/328 (46%)

Query:    23 SLSPDGEALLSLIXXXXXXXXXXXXXXXXXXXXXXTPCSWQGITCSPQNRVISLSLPDTF 82
             SL   G+ALLS                        +PC+W G+ C+ +  V  + L    
Sbjct:    24 SLDQQGQALLSW----KSQLNISGDAFSSWHVADTSPCNWVGVKCNRRGEVSEIQLKGMD 79

Query:    83 XXXXXXXXXXXXXXXXXXXXXXXTNISGIIPPSFGQLTHXXXXXXXXXXXXGPIPEEXXX 142
                                     N++G+IP   G  T             G IP E   
Sbjct:    80 LQGSLPVTSLRSLKSLTSLTLSSLNLTGVIPKEIGDFTELELLDLSDNSLSGDIPVEIFR 139

Query:   143 XXXXXXXXXNTNRLSGSIPPQLANLTSLQVLCLQDNLLNGSIPSQLGSLVSLQQFRIGGN 202
                      NTN L G IP ++ NL+ L  L L DN L+G IP  +G L +LQ  R GGN
Sbjct:   140 LKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGN 199

Query:   203 PYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTEVFGSIPPEIG 262
               L GE+P ++G   NL   G A T LSG +P + GNL  +QT+A+Y + + G IP EIG
Sbjct:   200 KNLRGELPWEIGNCENLVMLGLAETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIG 259

Query:   263 LCSELRNLYLHMNKLTGSIPSEXXXXXXXXXXXXWGNTLSGPIPAELSNCSALVVLDASA 322
              C+EL+NLYL+ N ++GSIP+             W N L G IP EL NC  L ++D S 
Sbjct:   260 YCTELQNLYLYQNSISGSIPTTIGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSE 319

Query:   323 NDLSGELPGDLGKLVLLEQLHLSDNMLT 350
             N L+G +P   GKL  L++L LS N ++
Sbjct:   320 NLLTGTIPRSFGKLENLQELQLSVNQIS 347

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005886 "plasma membrane" evidence=ISM;IDA

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0002237 "response to molecule of bacterial origin" evidence=RCA

GO:0007165 "signal transduction" evidence=RCA

GO:0010103 "stomatal complex morphogenesis" evidence=RCA

GO:0048443 "stamen development" evidence=RCA

TAIR\|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2139885 AT4G28650 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
C0LGF5	Y1341_ARATH	2, ., 7, ., 1, 1, ., 1	0.7285	0.9742	0.3180	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		350
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-58
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-43
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-40
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	4e-30
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	3e-22
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	8e-19
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	5e-17
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	8e-17
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	5e-15
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	1e-12
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	2e-12
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	2e-10
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	1e-08
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	5e-08
pfam08263		42	pfam08263, LRRNT_2, Leucine rich repeat N-terminal	7e-08
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	8e-06
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	9e-05

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

 Score =  203 bits (517), Expect = 2e-58
 Identities = 147/370 (39%), Positives = 192/370 (51%), Gaps = 35/370 (9%)

Query: 5   LLFFSFLFLLTMSNTFVSSLSPDGEALLSLISAAGPSAKASSSILSSWNPSNLTPCSWQG 64
            L F   FL      F    + + E LLS  S    S       LS+WN S    C WQG
Sbjct: 11  YLIFMLFFLFL---NFSMLHAEELELLLSFKS----SINDPLKYLSNWNSSA-DVCLWQG 62

Query: 65  ITCSPQNRVISLSLPD----------TF-------LNLSA------LPPQLSSLS-SLQL 100
           ITC+  +RV+S+ L             F       +NLS       +P  + + S SL+ 
Sbjct: 63  ITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRY 122

Query: 101 LNLSSTNISGIIPPSFGQLTHLRLLDLSSNSLSGPIPEELGQLSLLQFLFLNTNRLSGSI 160
           LNLS+ N +G IP   G + +L  LDLS+N LSG IP ++G  S L+ L L  N L G I
Sbjct: 123 LNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKI 180

Query: 161 PPQLANLTSLQVLCLQDNLLNGSIPSQLGSLVSLQQFRIGGNPYLTGEIPTQLGMLTNLT 220
           P  L NLTSL+ L L  N L G IP +LG + SL+   +G N  L+GEIP ++G LT+L 
Sbjct: 181 PNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNN-LSGEIPYEIGGLTSLN 239

Query: 221 TFGAAATGLSGVIPPTFGNLINLQTLALYDTEVFGSIPPEIGLCSELRNLYLHMNKLTGS 280
                   L+G IP + GNL NLQ L LY  ++ G IPP I    +L +L L  N L+G 
Sbjct: 240 HLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGE 299

Query: 281 IPSELGKLQKLTSLLLWGNTLSGPIPAELSNCSALVVLDASANDLSGELPGDLGKLVLLE 340
           IP  + +LQ L  L L+ N  +G IP  L++   L VL   +N  SGE+P +LGK   L 
Sbjct: 300 IPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLT 359

Query: 341 QLHLSDNMLT 350
            L LS N LT
Sbjct: 360 VLDLSTNNLT 369

Length = 968

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		350
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.97
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.96
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.93
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.92
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.9
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.89
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.88
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.86
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.85
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.84
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.84
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.83
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.83
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.82
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.8
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.78
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.77
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.77
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.71
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.69
PLN03150		623	hypothetical protein; Provisional	99.59
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.33
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.31
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	99.29
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.27
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.27
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	99.25
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.23
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	99.21
PLN03150		623	hypothetical protein; Provisional	99.21
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.21
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.16
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.14
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.12
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	99.1
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.07
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.97
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.94
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.89
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.84
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.79
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.59
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.5
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.49
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.44
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.37
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.34
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.25
PF08263		43	LRRNT_2: Leucine rich repeat N-terminal domain; In	98.25
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.21
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	98.18
KOG4341		483	consensus F-box protein containing LRR [General fu	98.14
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	98.07
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.07
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.02
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	98.01
PRK15386		426	type III secretion protein GogB; Provisional	97.94
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.89
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.87
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	97.82
PRK15386		426	type III secretion protein GogB; Provisional	97.76
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	97.75
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	97.63
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	97.43
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.32
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.89
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.83
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.76
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.89
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.98
KOG4308		478	consensus LRR-containing protein [Function unknown	94.25
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.68
KOG3864		221	consensus Uncharacterized conserved protein [Funct	93.68
KOG4308		478	consensus LRR-containing protein [Function unknown	93.48
KOG0473		326	consensus Leucine-rich repeat protein [Function un	93.43
KOG4341		483	consensus F-box protein containing LRR [General fu	92.01
KOG3864		221	consensus Uncharacterized conserved protein [Funct	90.01
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	89.38
smart00370		26	LRR Leucine-rich repeats, outliers.	88.94
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	88.94
KOG0473		326	consensus Leucine-rich repeat protein [Function un	88.6
smart00365		26	LRR_SD22 Leucine-rich repeat, SDS22-like subfamily	83.37
smart00368		28	LRR_RI Leucine rich repeat, ribonuclease inhibitor	82.97

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Probab=100.00  E-value=9.3e-42  Score=343.94  Aligned_cols=317  Identities=37%  Similarity=0.575  Sum_probs=203.2

Q ss_pred             CCcchHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCcCceeeCCCCCEEEEEcCCCCCCCCCCCccCCCCCCCCEEE
Q 036666           23 SLSPDGEALLSLISAAGPSAKASSSILSSWNPSNLTPCSWQGITCSPQNRVISLSLPDTFLNLSALPPQLSSLSSLQLLN  102 (350)
Q Consensus        23 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~~w~~~~~~~c~~~~~~c~~~~~v~~l~l~~~~~~~~~~~~~~~~~~~L~~L~  102 (350)
                      ..++|..+++.|++.+.    ++.+...+|. ...++|.|.|+.|+..++|+.++++++.+. +.++..+..+++|++|+
T Consensus        26 ~~~~~~~~l~~~~~~~~----~~~~~~~~w~-~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~-~~~~~~~~~l~~L~~L~   99 (968)
T PLN00113         26 LHAEELELLLSFKSSIN----DPLKYLSNWN-SSADVCLWQGITCNNSSRVVSIDLSGKNIS-GKISSAIFRLPYIQTIN   99 (968)
T ss_pred             CCHHHHHHHHHHHHhCC----CCcccCCCCC-CCCCCCcCcceecCCCCcEEEEEecCCCcc-ccCChHHhCCCCCCEEE
Confidence            35689999999999997    6766788997 456899999999987789999999999887 77788888899999999


Q ss_pred             CCCCcCCcCCCcCC-CCCCCCCeEeCCCCCCCCCCCcccCCCCCCCEEEccCCCCCCCCCccCCCCCCCCEEEcccCcCC
Q 036666          103 LSSTNISGIIPPSF-GQLTHLRLLDLSSNSLSGPIPEELGQLSLLQFLFLNTNRLSGSIPPQLANLTSLQVLCLQDNLLN  181 (350)
Q Consensus       103 l~~n~i~~~~~~~~-~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~  181 (350)
                      +++|.+.+.+|..+ ..+++|++|++++|.+.+.+|.  ..+++|++|++++|.+++.+|..++.+++|++|++++|.+.
T Consensus       100 Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~  177 (968)
T PLN00113        100 LSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLV  177 (968)
T ss_pred             CCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCccc
Confidence            99999887777554 3777778887777777655553  34556666666666665555555666666666666666655


Q ss_pred             CCCCccCCCCCCCCEEeccCCCCCcccCChhhcCCCCcCeeecccccCcCCCCccccCCCcCceEeecccccccCCcccc
Q 036666          182 GSIPSQLGSLVSLQQFRIGGNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTEVFGSIPPEI  261 (350)
Q Consensus       182 ~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~  261 (350)
                      +.+|..+.++++|++|++++|. +.+..+..++++++|++|++++|.+++.+|..++++++|++|++++|.+.+.+|..+
T Consensus       178 ~~~p~~~~~l~~L~~L~L~~n~-l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l  256 (968)
T PLN00113        178 GKIPNSLTNLTSLEFLTLASNQ-LVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL  256 (968)
T ss_pred             ccCChhhhhCcCCCeeeccCCC-CcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhH
Confidence            5555555566666666666555 444455555555555555555555555555555555555555555555555555555


Q ss_pred             cCCCCCCeEEccCCcCcccCChhhhCCCCCCEEeccCccCcccCCccCcCCCCCCEEEccCCcCcccCCccccCCCCCCE
Q 036666          262 GLCSELRNLYLHMNKLTGSIPSELGKLQKLTSLLLWGNTLSGPIPAELSNCSALVVLDASANDLSGELPGDLGKLVLLEQ  341 (350)
Q Consensus       262 ~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~  341 (350)
                      ..+++|+.|++++|.+.+.+|..+..+++|++|++++|.+.+.+|..+..+++|+.|++++|.+++.+|..+..+++|+.
T Consensus       257 ~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~  336 (968)
T PLN00113        257 GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQV  336 (968)
T ss_pred             hCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCE
Confidence            55555555555555555444555555555555555555554444444444444444444444444444444444444444


Q ss_pred             EeCcCCC
Q 036666          342 LHLSDNM  348 (350)
Q Consensus       342 L~l~~n~  348 (350)
                      |++++|+
T Consensus       337 L~L~~n~  343 (968)
T PLN00113        337 LQLWSNK  343 (968)
T ss_pred             EECcCCC
Confidence            4444444

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily	Back alignment and domain information

>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		350
3rgx_A		768	Structural Insight Into Brassinosteroid Perception		7e-16
3riz_A		772	Crystal Structure Of The Plant Steroid Receptor Bri		8e-16
1ogq_A		313	The Crystal Structure Of Pgip (Polygalacturonase In		2e-09

>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768

Back alignment and structure

Iteration: 1

Score = 79.3 bits (194), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 79/289 (27%), Positives = 115/289 (39%), Gaps = 47/289 (16%) Query: 108 ISGIIPPSFGQLTHXXXXXXXXXXXXGPIPEEXXXXXXXXXXXXNTNRLSGSIPPQLANL 167 +SG IP S G L+ G IP+E + N L+G IP L+N Sbjct: 430 LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNC 489 Query: 168 TSLQVLCLQDNLLNGSIPSQLGSLVSLQQFRIGGNPYLTGEIPTQLG---------MLTN 218 T+L + L +N L G IP +G L +L ++ N + +G IP +LG + TN Sbjct: 490 TNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSF-SGNIPAELGDCRSLIWLDLNTN 548 Query: 219 LT--TFGAAATGLSGVIPPTF---------------------GNLINLQTLALYD----- 250 L T AA SG I F GNL+ Q + Sbjct: 549 LFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLS 608 Query: 251 --------TEVF-GSIPPEIGLCSELRNLYLHMNKLTGSIPSEXXXXXXXXXXXXWGNTL 301 + V+ G P + L + N L+G IP E N + Sbjct: 609 TRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDI 668 Query: 302 SGPIPAELSNCSALVVLDASANDLSGELPGDLGKLVLLEQLHLSDNMLT 350 SG IP E+ + L +LD S+N L G +P + L +L ++ LS+N L+ Sbjct: 669 SGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLS 717

PyMOL of 3rgx

>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772

Back alignment and structure

>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		350
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-75
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-51
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-12
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-65
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-64
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-62
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-60
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-59
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-58
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-32
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-29
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-44
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-40
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-39
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-42
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	8e-37
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-36
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-36
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-34
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-25
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-14
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-41
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-35
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-24
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-38
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-32
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-31
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	7e-31
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-37
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-31
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-16
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-37
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-34
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-29
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-28
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-27
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-27
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-20
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-34
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-31
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-30
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	8e-31
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-27
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-17
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-30
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-29
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-27
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-25
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-30
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-17
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-28
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-28
1o6v_A		466	Internalin A; bacterial infection, extracellular r	8e-27
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-23
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-19
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-27
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	8e-25
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	6e-17
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-26
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	9e-22
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-26
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-10
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-25
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	9e-18
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-25
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-22
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-13
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-25
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-24
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-24
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-23
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-19
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-13
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-11
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-23
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-21
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-13
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	7e-23
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	5e-12
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-23
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-17
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-17
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	8e-17
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-14
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-11
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-22
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	8e-21
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-14
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-13
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-08
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-19
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-18
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-11
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-10
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	4e-19
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-13
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	5e-19
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	6e-19
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-17
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-16
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	6e-16
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-15
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	6e-14
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-18
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	4e-14
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	6e-09
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	6e-08
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-17
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	3e-17
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	7e-14
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	7e-13
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-11
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	7e-11
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-16
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	7e-14
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-09
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	8e-16
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	3e-13
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-12
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	4e-15
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-11
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	1e-08
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	7e-15
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	3e-06
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	9e-15
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	1e-11
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-08
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	2e-14
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	3e-06
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	3e-05
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	4e-05
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-14
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	9e-06
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-14
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-13
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-13
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-12
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	4e-14
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-10
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	1e-09
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	6e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	5e-14
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-12
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-11
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-11
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-11
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-13
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-10
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-09
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	8e-09
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	8e-13
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	8e-05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	1e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	2e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	8e-13
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	3e-12
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	8e-12
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-11
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-12
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	3e-11
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	3e-10
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	4e-08
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-07
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	2e-12
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	4e-09
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	1e-04
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	3e-04
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	4e-04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	5e-12
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	6e-12
3m19_A		251	Variable lymphocyte receptor A diversity region; a	4e-10
3m19_A		251	Variable lymphocyte receptor A diversity region; a	2e-08
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	5e-10
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	4e-09
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	3e-05
3e6j_A		229	Variable lymphocyte receptor diversity region; var	9e-09
3e6j_A		229	Variable lymphocyte receptor diversity region; var	8e-08
3e6j_A		229	Variable lymphocyte receptor diversity region; var	1e-04
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	9e-09
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	6e-06
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	3e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-08
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-04
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	3e-08
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	2e-07
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	1e-07
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	2e-05
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-07
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	5e-07
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	4e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-07
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-07
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	6e-05
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	2e-07
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	4e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	4e-04
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	3e-07
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	5e-06
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	6e-04
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	1e-04
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	3e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	7e-04
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	9e-04

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

 Score =  233 bits (597), Expect = 3e-75
 Identities = 92/328 (28%), Positives = 143/328 (43%), Gaps = 40/328 (12%)

Query: 27  DGEALLSLISAAGPSAKASSSILSSWNPS-NLTPCSWQGITCSPQ---NRVISLSLPDTF 82
           D +ALL +          + + LSSW P+ +    +W G+ C       RV +L L    
Sbjct: 7   DKQALLQI-----KKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLN 61

Query: 83  LNLSA-LPPQLSSLSSLQLLNLSSTN-ISGIIPPSFGQLTHLRLLDLSSNSLSGPIPEEL 140
           L     +P  L++L  L  L +   N + G IPP+  +LT L  L ++  ++SG IP+ L
Sbjct: 62  LPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFL 121

Query: 141 GQLSLLQFLFLNTNRLSGSIPPQLANLTSLQVLCLQDNLLNGSIPSQLGSLVSLQQF-RI 199
            Q+  L  L  + N LSG++PP +++L +L  +    N ++G+IP   GS   L     I
Sbjct: 122 SQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTI 181

Query: 200 GGNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTEVFGSIPP 259
             N                          L+G IPPTF NL NL  + L    + G    
Sbjct: 182 SRN-------------------------RLTGKIPPTFANL-NLAFVDLSRNMLEGDASV 215

Query: 260 EIGLCSELRNLYLHMNKLTGSIPSELGKLQKLTSLLLWGNTLSGPIPAELSNCSALVVLD 319
             G     + ++L  N L   +   +G  + L  L L  N + G +P  L+    L  L+
Sbjct: 216 LFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLN 274

Query: 320 ASANDLSGELPGDLGKLVLLEQLHLSDN 347
            S N+L GE+P   G L   +    ++N
Sbjct: 275 VSFNNLCGEIP-QGGNLQRFDVSAYANN 301

PyMOL of 1ogq

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		350
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	100.0
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	100.0
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	100.0
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	100.0
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	100.0
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	100.0
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	100.0
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	100.0
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	100.0
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.98
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.98
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.98
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.98
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.98
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.97
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.97
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.97
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.97
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.97
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.97
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.97
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.97
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.97
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.97
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.97
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.97
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.97
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.97
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.96
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.96
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.96
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.96
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.96
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.95
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.95
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.95
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.95
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.95
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.95
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.95
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.94
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.94
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.94
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.93
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.93
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.93
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.93
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.93
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.92
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.92
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.92
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.92
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.92
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.92
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.91
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.91
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.91
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.91
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.91
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.91
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.9
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.9
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.9
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.9
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.89
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.88
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.88
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.87
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.85
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.84
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.84
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.84
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.83
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.83
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.82
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.82
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.82
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.82
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.81
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.81
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.81
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.81
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.81
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.81
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.8
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.79
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.79
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.78
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.78
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.78
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.75
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.75
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.75
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.74
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.74
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.72
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.72
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.72
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.71
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.7
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.69
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.69
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.69
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.68
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.67
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.67
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.66
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.66
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.63
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.56
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.55
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.55
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.53
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.52
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.51
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.46
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	99.44
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.41
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.38
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.35
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	99.35
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	99.33
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.31
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	99.19
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.14
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	99.1
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.06
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.86
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.77
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.58
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.57
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.48
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.32
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.3
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.74
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	97.3
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.29
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	97.06

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

Probab=100.00  E-value=4e-43  Score=309.07  Aligned_cols=292  Identities=31%  Similarity=0.498  Sum_probs=196.7

Q ss_pred             CCCcchHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCC--cCceeeCCC---CCEEEEEcCCCCCCCC--CCCccCCC
Q 036666           22 SSLSPDGEALLSLISAAGPSAKASSSILSSWNPSNLTPCS--WQGITCSPQ---NRVISLSLPDTFLNLS--ALPPQLSS   94 (350)
Q Consensus        22 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~w~~~~~~~c~--~~~~~c~~~---~~v~~l~l~~~~~~~~--~~~~~~~~   94 (350)
                      .|.++|++|++.||..+.    ++. .+.+|. .+.++|.  |.||.|+..   ++|+.++++++.+. +  .+|..+.+
T Consensus         2 ~c~~~~~~aL~~~k~~~~----~~~-~l~~W~-~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~-~~~~~~~~l~~   74 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLG----NPT-TLSSWL-PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLP-KPYPIPSSLAN   74 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTT----CCG-GGTTCC-TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCS-SCEECCGGGGG
T ss_pred             CCCHHHHHHHHHHHHhcC----Ccc-cccCCC-CCCCCCcCCCcceEeCCCCCCceEEEEECCCCCcc-CCcccChhHhC
Confidence            467889999999999997    554 678997 3568898  999999854   68999999998886 5  67888888


Q ss_pred             CCCCCEEECCC-CcCCcCCCcCCCCCCCCCeEeCCCCCCCCCCCcccCCCCCCCEEEccCCCCCCCCCccCCCCCCCCEE
Q 036666           95 LSSLQLLNLSS-TNISGIIPPSFGQLTHLRLLDLSSNSLSGPIPEELGQLSLLQFLFLNTNRLSGSIPPQLANLTSLQVL  173 (350)
Q Consensus        95 ~~~L~~L~l~~-n~i~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L  173 (350)
                      +++|++|++++ |.+.+.+|..|.++++|++|++++|.+.+..|..|..+++|++|++++|.+++.+|..+..+++|++|
T Consensus        75 l~~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L  154 (313)
T 1ogq_A           75 LPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGI  154 (313)
T ss_dssp             CTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEE
T ss_pred             CCCCCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeE
Confidence            88888888884 77877777778888888888888888877777777778888888888887777777777777777777


Q ss_pred             EcccCcCCCCCCccCCCCC-CCCEEeccCCCCCcccCChhhcCCCCcCeeecccccCcCCCCccccCCCcCceEeecccc
Q 036666          174 CLQDNLLNGSIPSQLGSLV-SLQQFRIGGNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTE  252 (350)
Q Consensus       174 ~l~~n~~~~~~~~~~~~l~-~L~~L~l~~n~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~  252 (350)
                      ++++|++.+.+|..+..++ +|++|++++|. +.+..+..+..++ |++|++++|.+++..+..+..+++|+.|++++|.
T Consensus       155 ~L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~-l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~  232 (313)
T 1ogq_A          155 TFDGNRISGAIPDSYGSFSKLFTSMTISRNR-LTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNS  232 (313)
T ss_dssp             ECCSSCCEEECCGGGGCCCTTCCEEECCSSE-EEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSE
T ss_pred             ECcCCcccCcCCHHHhhhhhcCcEEECcCCe-eeccCChHHhCCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCc
Confidence            7777777666666666665 66666666665 4445555555554 5555555555555555555555555555555555


Q ss_pred             cccCCcccccCCCCCCeEEccCCcCcccCChhhhCCCCCCEEeccCccCcccCCccCcCCCCCCEEEccCCc
Q 036666          253 VFGSIPPEIGLCSELRNLYLHMNKLTGSIPSELGKLQKLTSLLLWGNTLSGPIPAELSNCSALVVLDASAND  324 (350)
Q Consensus       253 ~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~  324 (350)
                      +.+.++. +..+++|++|++++|++++.+|..+..+++|++|++++|++++.+|.. ..+++|+.+++++|+
T Consensus       233 l~~~~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~-~~l~~L~~l~l~~N~  302 (313)
T 1ogq_A          233 LAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNK  302 (313)
T ss_dssp             ECCBGGG-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGGGSCGGGTCSSS
T ss_pred             eeeecCc-ccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCCC-ccccccChHHhcCCC
Confidence            5433332 444455555555555555444555555555555555555555444443 444455555555553

PyMOL of 1ogq

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		350
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	7e-26
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	3e-07
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	6e-18
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	4e-04
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-16
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-14
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	6e-12
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-10
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-09
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-09
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-04
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	1e-14
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	3e-13
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	2e-09
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	3e-10
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	4e-10
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	7e-07
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	3e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	1e-07
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	5e-07
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	6e-07
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-06
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	4e-06
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.001
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	1e-07
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	1e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.004
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	4e-07
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	4e-06
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	0.001
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	9e-07
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	3e-06
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	7e-05
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	0.002
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	4e-06
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	7e-05
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	9e-05
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	2e-05
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	3e-05
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	6e-05
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	5e-04
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	0.001
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	0.001
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	0.002
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	0.001
d1w8aa_		192	c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga	0.001
d1m9la_		198	c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree	0.002
d2ifga3		156	c.10.2.7 (A:36-191) High affinity nerve growth fac	0.002
d2ifga3		156	c.10.2.7 (A:36-191) High affinity nerve growth fac	0.004
d2omxa2		199	c.10.2.1 (A:37-235) Internalin B {Listeria monocyt	0.002

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score =  103 bits (256), Expect = 7e-26
 Identities = 83/310 (26%), Positives = 129/310 (41%), Gaps = 14/310 (4%)

Query: 27  DGEALLSLISAAGPSAKASSSILSSWNPS-NLTPCSWQGITCSPQN---RVISLSLPDTF 82
           D +ALL +    G     + + LSSW P+ +    +W G+ C       RV +L L    
Sbjct: 7   DKQALLQIKKDLG-----NPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLN 61

Query: 83  LN-LSALPPQLSSLSSLQLLNLSS-TNISGIIPPSFGQLTHLRLLDLSSNSLSGPIPEEL 140
           L     +P  L++L  L  L +    N+ G IPP+  +LT L  L ++  ++SG IP+ L
Sbjct: 62  LPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFL 121

Query: 141 GQLSLLQFLFLNTNRLSGSIPPQLANLTSLQVLCLQDNLLNGSIPSQLGSLVSLQQFRIG 200
            Q+  L  L  + N LSG++PP +++L +L  +    N ++G+IP   GS   L      
Sbjct: 122 SQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTI 181

Query: 201 GNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTEVFGSIPPE 260
               LTG+IP     L       +                                   +
Sbjct: 182 SRNRLTGKIPPTFANLNLAFVDLSRNM--LEGDASVLFGSDKNTQKIHLAKNSLAFDLGK 239

Query: 261 IGLCSELRNLYLHMNKLTGSIPSELGKLQKLTSLLLWGNTLSGPIPAELSNCSALVVLDA 320
           +GL   L  L L  N++ G++P  L +L+ L SL +  N L G IP +  N     V   
Sbjct: 240 VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAY 298

Query: 321 SANDLSGELP 330
           + N      P
Sbjct: 299 ANNKCLCGSP 308

PyMOL of d1ogqa_

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		350
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	100.0
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.97
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.96
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.95
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.94
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.94
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.94
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.91
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.91
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.91
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.82
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.81
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.81
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.8
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.79
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.76
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.74
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.72
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.72
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.72
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.72
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.69
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.68
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.67
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.66
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.62
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.59
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.59
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.57
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.55
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.54
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.53
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.4
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.39
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.37
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.29
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.59
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.29
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.18
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.95
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	97.59
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	97.16

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=1.8e-40  Score=290.38  Aligned_cols=291  Identities=31%  Similarity=0.497  Sum_probs=219.8

Q ss_pred             CCcchHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCC--cCceeeCCCC---CEEEEEcCCCCCCCC--CCCccCCCC
Q 036666           23 SLSPDGEALLSLISAAGPSAKASSSILSSWNPSNLTPCS--WQGITCSPQN---RVISLSLPDTFLNLS--ALPPQLSSL   95 (350)
Q Consensus        23 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~~w~~~~~~~c~--~~~~~c~~~~---~v~~l~l~~~~~~~~--~~~~~~~~~   95 (350)
                      |.++|++|+++||+.+.    ++ ..+.+|. .+.|+|.  |.||+|+..+   +|+.++++++.+. +  .+|+.+.++
T Consensus         3 c~~~e~~aLl~~k~~~~----~~-~~l~sW~-~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~-g~~~lp~~l~~L   75 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLG----NP-TTLSSWL-PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLP-KPYPIPSSLANL   75 (313)
T ss_dssp             SCHHHHHHHHHHHHHTT----CC-GGGTTCC-TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCS-SCEECCGGGGGC
T ss_pred             CCHHHHHHHHHHHHHCC----CC-CcCCCCC-CCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCC-CCCCCChHHhcC
Confidence            67899999999999997    55 4688997 5679994  9999998643   7999999998886 4  578889999


Q ss_pred             CCCCEEECCC-CcCCcCCCcCCCCCCCCCeEeCCCCCCCCCCCcccCCCCCCCEEEccCCCCCCCCCccCCCCCCCCEEE
Q 036666           96 SSLQLLNLSS-TNISGIIPPSFGQLTHLRLLDLSSNSLSGPIPEELGQLSLLQFLFLNTNRLSGSIPPQLANLTSLQVLC  174 (350)
Q Consensus        96 ~~L~~L~l~~-n~i~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~  174 (350)
                      ++|++|+|++ |.+.+.+|..|.++++|++|++++|.+.+..+..+..+++|++++++.|.+.+.+|..+..++++++++
T Consensus        76 ~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~  155 (313)
T d1ogqa_          76 PYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGIT  155 (313)
T ss_dssp             TTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEE
T ss_pred             ccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceee
Confidence            9999999986 788888888888899999999999988887788888888888888888888888888888888888888


Q ss_pred             cccCcCCCCCCccCCCCCCC-CEEeccCCCCCcccCChhhcCCCCcCeeecccccCcCCCCccccCCCcCceEeeccccc
Q 036666          175 LQDNLLNGSIPSQLGSLVSL-QQFRIGGNPYLTGEIPTQLGMLTNLTTFGAAATGLSGVIPPTFGNLINLQTLALYDTEV  253 (350)
Q Consensus       175 l~~n~~~~~~~~~~~~l~~L-~~L~l~~n~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~  253 (350)
                      +++|.+.+.+|..+..+.++ +.+.+.+|+ +.+..+..+..+..+ .+++..+...+.+|..+..++.++.+++.++.+
T Consensus       156 l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~-l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l  233 (313)
T d1ogqa_         156 FDGNRISGAIPDSYGSFSKLFTSMTISRNR-LTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSL  233 (313)
T ss_dssp             CCSSCCEEECCGGGGCCCTTCCEEECCSSE-EEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEE
T ss_pred             cccccccccccccccccccccccccccccc-ccccccccccccccc-ccccccccccccccccccccccccccccccccc
Confidence            88888887777777777664 667777776 555555555555433 566666666666666666666777777766666


Q ss_pred             ccCCcccccCCCCCCeEEccCCcCcccCChhhhCCCCCCEEeccCccCcccCCccCcCCCCCCEEEccCCc
Q 036666          254 FGSIPPEIGLCSELRNLYLHMNKLTGSIPSELGKLQKLTSLLLWGNTLSGPIPAELSNCSALVVLDASAND  324 (350)
Q Consensus       254 ~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~  324 (350)
                      .+.++ .+..+++|+.|++++|++++.+|..++.+++|++|++++|+++|.+|. +..+++|+.+++++|+
T Consensus       234 ~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         234 AFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             ccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence            55433 455566666777777766666666666666677777777766666663 3556666666666665

PyMOL of d1ogqa_

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure