Citrus Sinensis ID: 036674

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MGSRTLNTVVPSLVLLILFFVLSFLITVSSESNEEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSPCAWYGISCNDVGRVVNISLPAKGLKGKLHDFSFSSFPHLAYLDLSHNELFGTIPPQISNLTNLSDLYLEGDQFSGNIPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNLQELILFCNNLSGSIPPSLDNPMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAENHFQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLGTLNVSMNNITGGIP
cccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEEcccccEEEEEccccccEEEEccccccccccccEEEcccccccccccHHHHccccccEEEccccccEEcccHHHcccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEccccEEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEccccccccccc
cccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHcccccccccccccccccccEEEEEEcccccEEEEEEccccccccccHHHHHHcccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccccEEEccHHHcccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEcccccccccc
mgsrtlntvvPSLVLLILFFVLSFLITVSSESNEEADALLKWKASLQIHNRSLLSSWIkdttnvssktspcawygiscndvgrvvnislpakglkgklhdfsfssfphlayldlshnelfgtippqisnltnlsdlylegdqfsgnippevglmSHLKFLYIdtnqldgsippevgqLSSLVELFLFFNhlsgsvppslgnltnLQELILFCNnlsgsippsldnpmltrldldfnhftsylphnvcrggalqnFTVAEnhfqgtipkslrncTSLIRVRVngnnltgnisealgiypnlnyidlsrnnfygeissnlgeypklgtlnvsmnnitggip
mgsrtlntvvPSLVLLILFFVLSFLITVSSESNEEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSPCAWYGISCNDVGRVVNISLPAKGLKGKLHDFSFSSFPHLAYLDLSHNELFGTIPPQISNLTNLSDLYLEGDQFSGNIPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNLQELILFCNNLSGSIPPSLDNPMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAENHFqgtipkslrnCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLgeypklgtlnvsmnnitggip
MGSRTLNTvvpslvllilffvlsflitvssESNEEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSPCAWYGISCNDVGRVVNISLPAKGLKGKLHDFSFSSFPHLAYLDLSHNELFGTIPPQISNLTNLSDLYLEGDQFSGNIPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNLQELILFCNNLSGSIPPSLDNPMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAENHFQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLGTLNVSMNNITGGIP
*****LNTVVPSLVLLILFFVLSFLITVSSESNEEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSPCAWYGISCNDVGRVVNISLPAKGLKGKLHDFSFSSFPHLAYLDLSHNELFGTIPPQISNLTNLSDLYLEGDQFSGNIPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNLQELILFCNNLSGSIPPSLDNPMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAENHFQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLGTLNVS*********
************LVLLILFFVLSFLITVSSESNEEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSPCAWYGISCNDVGRVVNISLPAKGLKGKLHDFSFSSFPHLAYLDLSHNELFGTIPPQISNLTNLSDLYLEGDQFSGNIPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNLQELILFCNNLSGSIPPSLDNPMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAENHFQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLGTLNVSMNNITGGIP
********VVPSLVLLILFFVLSFLITVSSESNEEADALLKWKASLQIHNRSLLSSWIKDT********PCAWYGISCNDVGRVVNISLPAKGLKGKLHDFSFSSFPHLAYLDLSHNELFGTIPPQISNLTNLSDLYLEGDQFSGNIPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNLQELILFCNNLSGSIPPSLDNPMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAENHFQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLGTLNVSMNNITGGIP
****TLNTVVPSLVLLILFFVLSFLITVSSESNEEADALLKWKASLQIHNRSLLSSWIKDT***SSKTSPCAWYGISCNDVGRVVNISLPAKGLKGKLHDFSFSSFPHLAYLDLSHNELFGTIPPQISNLTNLSDLYLEGDQFSGNIPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNLQELILFCNNLSGSIPPSLDNPMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAENHFQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLGTLNVSMNNITGGIP
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSRTLNTVVPSLVLLILFFVLSFLITVSSESNEEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSPCAWYGISCNDVGRVVNISLPAKGLKGKLHDFSFSSFPHLAYLDLSHNELFGTIPPQISNLTNLSDLYLEGDQFSGNIPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNLQELILFCNNLSGSIPPSLDNPMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAENHFQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLGTLNVSMNNITGGIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query339 2.2.26 [Sep-21-2011]
Q8VZG8 1045 Probable LRR receptor-lik yes no 0.743 0.241 0.476 3e-59
Q9LP24 1120 Probable leucine-rich rep no no 0.672 0.203 0.482 6e-55
Q9FL28 1173 LRR receptor-like serine/ no no 0.941 0.271 0.334 2e-39
O82318 960 Probably inactive leucine no no 0.929 0.328 0.317 5e-38
C0LGR3 1091 Probable LRR receptor-lik no no 0.884 0.274 0.365 6e-38
Q9FZ59 1088 Leucine-rich repeat recep no no 0.941 0.293 0.357 1e-36
C0LGQ5 1249 LRR receptor-like serine/ no no 0.817 0.221 0.356 5e-36
Q9SGP2 996 Receptor-like protein kin no no 0.719 0.244 0.372 8e-36
C0LGP9 784 Probable leucine-rich rep no no 0.929 0.401 0.330 4e-35
P93194 1109 Receptor-like protein kin N/A no 0.932 0.284 0.324 1e-34
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function desciption
 Score =  229 bits (583), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 121/254 (47%), Positives = 170/254 (66%), Gaps = 2/254 (0%)

Query: 87  ISLPAKGLKGKLHDFSFSSFPHLAYLDLSHNELFGTIPPQISNLTNLSDLYLEGDQFSGN 146
           + L    L GK+   SF +  ++  L++  N+L G IPP+I N+T L  L L  ++ +G 
Sbjct: 243 LCLDRNNLTGKIPS-SFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGP 301

Query: 147 IPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNLQ 206
           IP  +G +  L  L++  NQL+GSIPPE+G++ S+++L +  N L+G VP S G LT L+
Sbjct: 302 IPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALE 361

Query: 207 ELILFCNNLSGSIPPSLDNPM-LTRLDLDFNHFTSYLPHNVCRGGALQNFTVAENHFQGT 265
            L L  N LSG IPP + N   LT L LD N+FT +LP  +CRGG L+N T+ +NHF+G 
Sbjct: 362 WLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTGFLPDTICRGGKLENLTLDDNHFEGP 421

Query: 266 IPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLG 325
           +PKSLR+C SLIRVR  GN+ +G+ISEA G+YP LN+IDLS NNF+G++S+N  +  KL 
Sbjct: 422 VPKSLRDCKSLIRVRFKGNSFSGDISEAFGVYPTLNFIDLSNNNFHGQLSANWEQSQKLV 481

Query: 326 TLNVSMNNITGGIP 339
              +S N+ITG IP
Sbjct: 482 AFILSNNSITGAIP 495

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGP9|IMK3_ARATH Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
224108393 968 predicted protein [Populus trichocarpa] 0.879 0.307 0.472 5e-75
224108397 968 predicted protein [Populus trichocarpa] 0.879 0.307 0.469 9e-74
147777440 951 hypothetical protein VITISV_008628 [Viti 0.955 0.340 0.429 8e-68
224107159 938 predicted protein [Populus trichocarpa] 0.882 0.318 0.417 5e-65
255545702 1008 receptor protein kinase, putative [Ricin 0.941 0.316 0.373 1e-64
224148440 625 predicted protein [Populus trichocarpa] 0.882 0.478 0.417 1e-64
359484862 991 PREDICTED: probable LRR receptor-like se 0.970 0.331 0.422 2e-64
356574018 961 PREDICTED: probable LRR receptor-like se 0.943 0.332 0.412 3e-64
356529987 1009 PREDICTED: probable LRR receptor-like se 0.893 0.300 0.373 7e-64
225456161 1037 PREDICTED: probable LRR receptor-like se 0.911 0.297 0.470 1e-63
>gi|224108393|ref|XP_002333399.1| predicted protein [Populus trichocarpa] gi|222836439|gb|EEE74846.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  287 bits (735), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 157/332 (47%), Positives = 212/332 (63%), Gaps = 34/332 (10%)

Query: 34  EEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSPCA-WYGISCNDVGRVVNISLPAK 92
           +EA+ALLKWKASL   ++SLLSSW+         TSPC  W GI+C+  G V N++ P  
Sbjct: 61  KEAEALLKWKASLDNQSQSLLSSWVG--------TSPCIDWIGITCDGSGSVANLTFPHF 112

Query: 93  GLKGKLHDFSFSSFPHLAYLDLSHNELFGTIPPQISNLTNLSDLYLEGDQFSGNIPPEVG 152
           GL+G L+DF+FSSFP+L+ LDLS+N + GT+P  I NL+ ++ L L  +  +G+IP E+G
Sbjct: 113 GLRGTLYDFNFSSFPNLSVLDLSNNSIHGTLPSHIGNLSKITQLGLCYNDLTGSIPSEIG 172

Query: 153 LMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNLQELILFC 212
            +  +  L +  N   GSIP E+G+L+SL  L L  N+L+GS+P S+GNL NL  L L+ 
Sbjct: 173 SLKSITDLVLCRNLFSGSIPHEIGKLTSLSRLSLAVNNLTGSIPSSIGNLKNLSNLFLWD 232

Query: 213 NNLSGSIPP----------------SLDNPM---------LTRLDLDFNHFTSYLPHNVC 247
           N LSG IP                  L  P+         L +  L  N FT +LP  VC
Sbjct: 233 NKLSGRIPSEIGQLKSLVGLSLANNKLHGPLPLEMNNLTHLKQFHLSDNEFTGHLPQEVC 292

Query: 248 RGGALQNFTVAENHFQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSR 307
            GG L+N TVA N+F G+IPKSL+NCTSL R+R++ N LTGNISE  GIYP+L+Y+DLS 
Sbjct: 293 HGGVLENLTVANNYFSGSIPKSLKNCTSLHRLRLDRNQLTGNISEDFGIYPHLDYVDLSY 352

Query: 308 NNFYGEISSNLGEYPKLGTLNVSMNNITGGIP 339
           NNFYGE+S   G+Y  + +L +S NN++G IP
Sbjct: 353 NNFYGELSLKWGDYRNITSLKISNNNVSGEIP 384

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224108397|ref|XP_002333400.1| predicted protein [Populus trichocarpa] gi|222836440|gb|EEE74847.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147777440|emb|CAN73693.1| hypothetical protein VITISV_008628 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224107159|ref|XP_002333557.1| predicted protein [Populus trichocarpa] gi|222837233|gb|EEE75612.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255545702|ref|XP_002513911.1| receptor protein kinase, putative [Ricinus communis] gi|223546997|gb|EEF48494.1| receptor protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224148440|ref|XP_002336653.1| predicted protein [Populus trichocarpa] gi|222836449|gb|EEE74856.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359484862|ref|XP_002274094.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356574018|ref|XP_003555150.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Glycine max] Back     alignment and taxonomy information
>gi|356529987|ref|XP_003533567.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Glycine max] Back     alignment and taxonomy information
>gi|225456161|ref|XP_002278590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.766 0.248 0.464 1.4e-58
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.764 0.231 0.467 7.9e-57
TAIR|locus:2131518 1091 AT4G26540 [Arabidopsis thalian 0.884 0.274 0.372 1.7e-41
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.902 0.311 0.345 2.4e-39
TAIR|locus:2007918 1088 PEPR2 "PEP1 receptor 2" [Arabi 0.820 0.255 0.374 3e-39
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.884 0.275 0.339 3.9e-39
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.893 0.357 0.338 7.1e-39
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.879 0.254 0.344 9.5e-39
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.882 0.271 0.347 1.8e-38
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.893 0.321 0.346 3.3e-38
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 609 (219.4 bits), Expect = 1.4e-58, P = 1.4e-58
 Identities = 123/265 (46%), Positives = 176/265 (66%)

Query:    79 NDVGRVVNIS---LPAKGLKGKLHDFSFSSFPHLAYLDLSHNELFGTIPPQISNLTNLSD 135
             +++G + N+    L    L GK+   SF +  ++  L++  N+L G IPP+I N+T L  
Sbjct:   232 SEIGNLPNLRELCLDRNNLTGKIPS-SFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDT 290

Query:   136 LYLEGDQFSGNIPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSV 195
             L L  ++ +G IP  +G +  L  L++  NQL+GSIPPE+G++ S+++L +  N L+G V
Sbjct:   291 LSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPV 350

Query:   196 PPSLGNLTNLQELILFCNNLSGSIPPSLDNPM-LTRLDLDFNHFTSYLPHNVCRGGALQN 254
             P S G LT L+ L L  N LSG IPP + N   LT L LD N+FT +LP  +CRGG L+N
Sbjct:   351 PDSFGKLTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTGFLPDTICRGGKLEN 410

Query:   255 FTVAENHFQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEI 314
              T+ +NHF+G +PKSLR+C SLIRVR  GN+ +G+ISEA G+YP LN+IDLS NNF+G++
Sbjct:   411 LTLDDNHFEGPVPKSLRDCKSLIRVRFKGNSFSGDISEAFGVYPTLNFIDLSNNNFHGQL 470

Query:   315 SSNLGEYPKLGTLNVSMNNITGGIP 339
             S+N  +  KL    +S N+ITG IP
Sbjct:   471 SANWEQSQKLVAFILSNNSITGAIP 495
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0016020 "membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0006995 "cellular response to nitrogen starvation" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131518 AT4G26540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007918 PEPR2 "PEP1 receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-48
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-44
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  173 bits (440), Expect = 3e-48
 Identities = 124/378 (32%), Positives = 181/378 (47%), Gaps = 63/378 (16%)

Query: 11  PSLVLLILFFVLSFLITVSSESNEEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSP 70
           P L+ ++ F  L+F    S    EE + LL +K+S+       LS+W       +S    
Sbjct: 10  PYLIFMLFFLFLNF----SMLHAEELELLLSFKSSIN-DPLKYLSNW-------NSSADV 57

Query: 71  CAWYGISCNDVGRVVNISLPAKGLKGKL-------------------------HDFSFSS 105
           C W GI+CN+  RVV+I L  K + GK+                          D   +S
Sbjct: 58  CLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTS 117

Query: 106 ---------------------FPHLAYLDLSHNELFGTIPPQISNLTNLSDLYLEGDQFS 144
                                 P+L  LDLS+N L G IP  I + ++L  L L G+   
Sbjct: 118 SSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLV 177

Query: 145 GNIPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTN 204
           G IP  +  ++ L+FL + +NQL G IP E+GQ+ SL  ++L +N+LSG +P  +G LT+
Sbjct: 178 GKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTS 237

Query: 205 LQELILFCNNLSGSIPPSLDNPMLTRLDLDF---NHFTSYLPHNVCRGGALQNFTVAENH 261
           L  L L  NNL+G IP SL N  L  L   F   N  +  +P ++     L +  +++N 
Sbjct: 238 LNHLDLVYNNLTGPIPSSLGN--LKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNS 295

Query: 262 FQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEY 321
             G IP+ +    +L  + +  NN TG I  AL   P L  + L  N F GEI  NLG++
Sbjct: 296 LSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKH 355

Query: 322 PKLGTLNVSMNNITGGIP 339
             L  L++S NN+TG IP
Sbjct: 356 NNLTVLDLSTNNLTGEIP 373

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 339
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.86
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.8
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.8
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.78
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.76
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.74
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
PLN03150623 hypothetical protein; Provisional 99.63
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.43
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.39
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.33
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.32
PLN03150623 hypothetical protein; Provisional 99.31
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.29
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.27
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.19
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.18
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.15
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.05
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.04
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.98
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.94
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.89
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.87
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.84
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.68
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.62
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.57
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.53
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.47
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.46
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.44
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.42
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.42
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.15
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
PRK15386 426 type III secretion protein GogB; Provisional 97.98
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.96
PRK15386 426 type III secretion protein GogB; Provisional 97.93
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.86
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.73
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.49
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.44
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.43
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.38
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.26
KOG4341483 consensus F-box protein containing LRR [General fu 97.21
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.97
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.85
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.57
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.52
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.67
KOG4308 478 consensus LRR-containing protein [Function unknown 95.65
KOG4341483 consensus F-box protein containing LRR [General fu 95.51
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.38
KOG4308478 consensus LRR-containing protein [Function unknown 94.54
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.39
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.41
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.38
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.96
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.52
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.47
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.13
smart0037026 LRR Leucine-rich repeats, outliers. 89.13
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2e-40  Score=335.73  Aligned_cols=300  Identities=35%  Similarity=0.578  Sum_probs=194.4

Q ss_pred             CCHHHHHHHHHHHHhcccCCCCcCCCcccCCCCCCCCCCCCcccceEeCCCCCEEEEEcCCCCCccccCCCCCCCCCCCC
Q 036674           31 ESNEEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSPCAWYGISCNDVGRVVNISLPAKGLKGKLHDFSFSSFPHLA  110 (339)
Q Consensus        31 ~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~c~~~gv~c~~~~~v~~l~l~~~~~~~~~~~~~~~~l~~L~  110 (339)
                      ...+|..+|++|++.+ .++...+.+|  +.     ..++|.|.|+.|+..++|+.|+++++++.+.+ +..+..+++|+
T Consensus        26 ~~~~~~~~l~~~~~~~-~~~~~~~~~w--~~-----~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~-~~~~~~l~~L~   96 (968)
T PLN00113         26 LHAEELELLLSFKSSI-NDPLKYLSNW--NS-----SADVCLWQGITCNNSSRVVSIDLSGKNISGKI-SSAIFRLPYIQ   96 (968)
T ss_pred             CCHHHHHHHHHHHHhC-CCCcccCCCC--CC-----CCCCCcCcceecCCCCcEEEEEecCCCccccC-ChHHhCCCCCC
Confidence            3568999999999998 4666677889  33     56899999999987789999999999999887 77888999999


Q ss_pred             EEeCCCCcCCCCCCccCC-CCCccCeeeccCCCCcCcCc----------------------hhhcCCCCCcEEEeeccCC
Q 036674          111 YLDLSHNELFGTIPPQIS-NLTNLSDLYLEGDQFSGNIP----------------------PEVGLMSHLKFLYIDTNQL  167 (339)
Q Consensus       111 ~L~l~~n~~~~~~~~~~~-~l~~L~~L~L~~n~l~~~~p----------------------~~l~~l~~L~~L~l~~n~~  167 (339)
                      +|++++|.+.+.+|..+. .+++|++|++++|.+.+.+|                      ..++.+++|++|++++|.+
T Consensus        97 ~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l  176 (968)
T PLN00113         97 TINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVL  176 (968)
T ss_pred             EEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcc
Confidence            999999998877776544 77777777777776654444                      4444444455555544444


Q ss_pred             CCCCCccccCCCCCcEEEeecCcCCCCCCCCCCCCCCCceeecccccCcccCCCCCCC-CCCcEEeCCCCCCCCCCchhh
Q 036674          168 DGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNLQELILFCNNLSGSIPPSLDN-PMLTRLDLDFNHFTSYLPHNV  246 (339)
Q Consensus       168 ~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~-~~L~~L~l~~n~l~~~~~~~~  246 (339)
                      .+.+|..+.++++|++|++++|.+.+..|..+..+++|++|++++|.+++.+|..+.. ++|++|++++|.+++..|..+
T Consensus       177 ~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l  256 (968)
T PLN00113        177 VGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL  256 (968)
T ss_pred             cccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhH
Confidence            4444444445555555555555544444444555555555555555555444444444 555555555555555555555


Q ss_pred             cCCCccceeeccccccCCCchHhhhcCCCCcEEEccccccccccchhcCCCCCCCEeecccccCcccCCccccCCCCCCe
Q 036674          247 CRGGALQNFTVAENHFQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLGT  326 (339)
Q Consensus       247 ~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~  326 (339)
                      ..+++|+.|++++|.+.+.+|..+..+++|++|++++|.+.+.+|.++..+++|++|++++|.+++.+|..+..+++|+.
T Consensus       257 ~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~  336 (968)
T PLN00113        257 GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQV  336 (968)
T ss_pred             hCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCE
Confidence            55555555555555555555555555556666666666655555555556666666666666666556666666666666


Q ss_pred             EEcccCcCcccCC
Q 036674          327 LNVSMNNITGGIP  339 (339)
Q Consensus       327 L~l~~n~lt~~ip  339 (339)
                      |++++|.++|.+|
T Consensus       337 L~L~~n~l~~~~p  349 (968)
T PLN00113        337 LQLWSNKFSGEIP  349 (968)
T ss_pred             EECcCCCCcCcCC
Confidence            6666666666554

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-24
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-24
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-22
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 4e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-04
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-04
4g8a_A 635 Crystal Structure Of Human Tlr4 Polymorphic Variant 4e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 4e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 130/258 (50%), Gaps = 5/258 (1%)
Query: 87  ISLPAKGLKGKLHDFSFSSFPHLAYLDLSHNELFGTIPPQISNLTNLSDLYLEGDQFSGN 146
           +SL      G++ DF   +   L  LDLS N  +G +PP   + + L  L L  + FSG 
Sbjct: 274 LSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGE 333
Query: 147 IPPEVGL-MSHLKFLYIDTNQLDGSIPPEVGQLS-SLVELFLFFNHLSGSVPPSLGN--L 202
           +P +  L M  LK L +  N+  G +P  +  LS SL+ L L  N+ SG + P+L     
Sbjct: 334 LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK 393
Query: 203 TNLQELILFCNNLSGSIPPSLDN-PMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAENH 261
             LQEL L  N  +G IPP+L N   L  L L FN+ +  +P ++     L++  +  N 
Sbjct: 394 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM 453
Query: 262 FQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEY 321
            +G IP+ L    +L  + ++ N+LTG I   L    NLN+I LS N   GEI   +G  
Sbjct: 454 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 513
Query: 322 PKLGTLNVSMNNITGGIP 339
             L  L +S N+ +G IP
Sbjct: 514 ENLAILKLSNNSFSGNIP 531
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-77
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-27
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-60
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-58
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-56
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-55
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-53
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-46
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-43
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-40
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-35
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-37
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-34
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-21
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-11
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-30
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-25
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-21
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-17
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-16
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-16
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-19
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-14
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-11
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  237 bits (607), Expect = 9e-77
 Identities = 89/314 (28%), Positives = 139/314 (44%), Gaps = 38/314 (12%)

Query: 32  SNEEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSPCAWYGISCNDVG---RVVNIS 88
           + ++  ALL+ K  L   N + LSSW       ++      W G+ C+      RV N+ 
Sbjct: 4   NPQDKQALLQIKKDL--GNPTTLSSW-----LPTTDCCNRTWLGVLCDTDTQTYRVNNLD 56

Query: 89  LPAKGLKGKLH-DFSFSSFPHLAYLDLSH-NELFGTIPPQISNLTNLSDLYLEGDQFSGN 146
           L    L        S ++ P+L +L +   N L G IPP I+ LT L  LY+     SG 
Sbjct: 57  LSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGA 116

Query: 147 IPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNL- 205
           IP  +  +  L  L    N L G++PP +  L +LV +    N +SG++P S G+ + L 
Sbjct: 117 IPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLF 176

Query: 206 QELILFCNNLSGSIPPSLDNPMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAENHFQGT 265
             + +  N L+G IPP+  N  L  +DL  N                           G 
Sbjct: 177 TSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLE------------------------GD 212

Query: 266 IPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLG 325
                 +  +  ++ +  N+L  ++ + +G+  NLN +DL  N  YG +   L +   L 
Sbjct: 213 ASVLFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLH 271

Query: 326 TLNVSMNNITGGIP 339
           +LNVS NN+ G IP
Sbjct: 272 SLNVSFNNLCGEIP 285
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 100.0
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.98
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.98
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.96
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.95
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.92
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.92
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.89
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.88
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.83
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.79
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.79
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.78
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.71
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.61
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.59
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.58
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.45
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.38
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.35
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.31
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.1
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.09
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.05
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.03
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.86
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.76
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.73
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.57
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.48
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.46
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.43
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.43
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.81
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.46
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.22
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.67
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=4.8e-45  Score=323.05  Aligned_cols=295  Identities=28%  Similarity=0.459  Sum_probs=271.9

Q ss_pred             CCCHHHHHHHHHHHHhcccCCCCcCCCcccCCCCCCCCCCCCc--ccceEeCCC---CCEEEEEcCCCCCcc--ccCCCC
Q 036674           30 SESNEEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSPCA--WYGISCNDV---GRVVNISLPAKGLKG--KLHDFS  102 (339)
Q Consensus        30 ~~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~c~--~~gv~c~~~---~~v~~l~l~~~~~~~--~~~~~~  102 (339)
                      .|.++|++||++||+++. ++. .+.+|  ..     +.++|.  |.||.|+..   ++|+.++++++.+.+  .+ +..
T Consensus         2 ~c~~~~~~aL~~~k~~~~-~~~-~l~~W--~~-----~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~-~~~   71 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLG-NPT-TLSSW--LP-----TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPI-PSS   71 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTT-CCG-GGTTC--CT-----TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEEC-CGG
T ss_pred             CCCHHHHHHHHHHHHhcC-Ccc-cccCC--CC-----CCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCccc-Chh
Confidence            578899999999999994 454 78889  33     457888  999999754   799999999999998  77 778


Q ss_pred             CCCCCCCCEEeCCC-CcCCCCCCccCCCCCccCeeeccCCCCcCcCchhhcCCCCCcEEEeeccCCCCCCCccccCCCCC
Q 036674          103 FSSFPHLAYLDLSH-NELFGTIPPQISNLTNLSDLYLEGDQFSGNIPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSL  181 (339)
Q Consensus       103 ~~~l~~L~~L~l~~-n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~n~~~~~~p~~~~~l~~L  181 (339)
                      +.++++|++|++++ |.+.+.+|..++++++|++|++++|.+.+.+|..+..+++|++|++++|.+++.+|..+..+++|
T Consensus        72 l~~l~~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L  151 (313)
T 1ogq_A           72 LANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNL  151 (313)
T ss_dssp             GGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTC
T ss_pred             HhCCCCCCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCC
Confidence            99999999999995 99998999999999999999999999998999999999999999999999999999999999999


Q ss_pred             cEEEeecCcCCCCCCCCCCCCC-CCceeecccccCcccCCCCCCCCCCcEEeCCCCCCCCCCchhhcCCCccceeecccc
Q 036674          182 VELFLFFNHLSGSVPPSLGNLT-NLQELILFCNNLSGSIPPSLDNPMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAEN  260 (339)
Q Consensus       182 ~~L~l~~n~~~~~~~~~l~~l~-~L~~L~l~~n~l~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n  260 (339)
                      ++|++++|.+.+.+|..+..++ +|++|++++|.+++..|..+....|++|++++|.+++..+..+..+++|+.|++++|
T Consensus       152 ~~L~L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N  231 (313)
T 1ogq_A          152 VGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKN  231 (313)
T ss_dssp             CEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSS
T ss_pred             CeEECcCCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCcccEEECcCCcccCcCCHHHhcCCCCCEEECCCC
Confidence            9999999999988999999998 999999999999999998888845999999999999989999999999999999999


Q ss_pred             ccCCCchHhhhcCCCCcEEEccccccccccchhcCCCCCCCEeecccccCcccCCccccCCCCCCeEEcccCc-Ccc
Q 036674          261 HFQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLGTLNVSMNN-ITG  336 (339)
Q Consensus       261 ~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~-lt~  336 (339)
                      .+++.+|. +..+++|++|++++|++++.+|.++..+++|++|++++|++++.+|.. ..+++|+.+++++|+ +.|
T Consensus       232 ~l~~~~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~-~~l~~L~~l~l~~N~~lc~  306 (313)
T 1ogq_A          232 SLAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNKCLCG  306 (313)
T ss_dssp             EECCBGGG-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGGGSCGGGTCSSSEEES
T ss_pred             ceeeecCc-ccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCCC-ccccccChHHhcCCCCccC
Confidence            99977766 788999999999999999999999999999999999999999999886 889999999999997 655
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 339
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-26
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-08
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score =  102 bits (255), Expect = 8e-26
 Identities = 71/311 (22%), Positives = 117/311 (37%), Gaps = 13/311 (4%)

Query: 34  EEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSPCAWYGISCND---VGRVVNISLP 90
           ++  ALL+ K  L   N + LSSW       ++      W G+ C+      RV N+ L 
Sbjct: 6   QDKQALLQIKKDL--GNPTTLSSW-----LPTTDCCNRTWLGVLCDTDTQTYRVNNLDLS 58

Query: 91  AKGLKGKLH-DFSFSSFPHLAYLDLSHNE-LFGTIPPQISNLTNLSDLYLEGDQFSGNIP 148
              L        S ++ P+L +L +     L G IPP I+ LT L  LY+     SG IP
Sbjct: 59  GLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIP 118

Query: 149 PEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSLVELFLFFNHLSGSVPPSLGNLTNLQEL 208
             +  +  L  L    N L G++PP +  L +LV +    N +SG++P S G+ + L   
Sbjct: 119 DFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTS 178

Query: 209 ILFCNNLSGSIPPSLDNPMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAENHFQGTIPK 268
           +    N      P     +         +        +              +       
Sbjct: 179 MTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG 238

Query: 269 SLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLGTLN 328
            +    +L  + +  N + G + + L     L+ +++S NN  GEI    G   +     
Sbjct: 239 KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSA 297

Query: 329 VSMNNITGGIP 339
            + N    G P
Sbjct: 298 YANNKCLCGSP 308
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.84
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.82
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.81
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.79
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.66
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.65
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.61
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.48
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.39
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.31
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.52
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.39
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.18
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.83
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.74
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.26
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=2.9e-43  Score=309.71  Aligned_cols=298  Identities=29%  Similarity=0.463  Sum_probs=268.1

Q ss_pred             CCCHHHHHHHHHHHHhcccCCCCcCCCcccCCCCCCCCCCCC--cccceEeCCC---CCEEEEEcCCCCCccc--cCCCC
Q 036674           30 SESNEEADALLKWKASLQIHNRSLLSSWIKDTTNVSSKTSPC--AWYGISCNDV---GRVVNISLPAKGLKGK--LHDFS  102 (339)
Q Consensus        30 ~~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~c--~~~gv~c~~~---~~v~~l~l~~~~~~~~--~~~~~  102 (339)
                      -|.++|++||++||+.+.. + ..+.+|  ..     +.|||  .|.||+|+..   .||+.|+|+++++.+.  + +..
T Consensus         2 ~c~~~e~~aLl~~k~~~~~-~-~~l~sW--~~-----~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~l-p~~   71 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGN-P-TTLSSW--LP-----TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPI-PSS   71 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTC-C-GGGTTC--CT-----TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEEC-CGG
T ss_pred             CCCHHHHHHHHHHHHHCCC-C-CcCCCC--CC-----CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCC-ChH
Confidence            3788999999999999853 3 468899  33     67889  4999999743   3799999999999874  4 678


Q ss_pred             CCCCCCCCEEeCCC-CcCCCCCCccCCCCCccCeeeccCCCCcCcCchhhcCCCCCcEEEeeccCCCCCCCccccCCCCC
Q 036674          103 FSSFPHLAYLDLSH-NELFGTIPPQISNLTNLSDLYLEGDQFSGNIPPEVGLMSHLKFLYIDTNQLDGSIPPEVGQLSSL  181 (339)
Q Consensus       103 ~~~l~~L~~L~l~~-n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~l~~n~~~~~~p~~~~~l~~L  181 (339)
                      ++++++|++|+|++ |.+.|.+|..|+++++|++|+|++|++.+..+..+..+.+|++++++.|.+.+.+|..+.+++.+
T Consensus        72 l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L  151 (313)
T d1ogqa_          72 LANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNL  151 (313)
T ss_dssp             GGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTC
T ss_pred             HhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCccc
Confidence            99999999999997 78999999999999999999999999998888889999999999999999998999999999999


Q ss_pred             cEEEeecCcCCCCCCCCCCCCCCC-ceeecccccCcccCCCCCCCCCCcEEeCCCCCCCCCCchhhcCCCccceeecccc
Q 036674          182 VELFLFFNHLSGSVPPSLGNLTNL-QELILFCNNLSGSIPPSLDNPMLTRLDLDFNHFTSYLPHNVCRGGALQNFTVAEN  260 (339)
Q Consensus       182 ~~L~l~~n~~~~~~~~~l~~l~~L-~~L~l~~n~l~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n  260 (339)
                      +.+++++|.+.+.+|..+..+..+ +.++++.|++++..+..+.......+++..+...+..|..+..+++++.+++++|
T Consensus       152 ~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~  231 (313)
T d1ogqa_         152 VGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKN  231 (313)
T ss_dssp             CEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSS
T ss_pred             ceeecccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            999999999998999988888876 7899999999998888887766778999999999999999999999999999999


Q ss_pred             ccCCCchHhhhcCCCCcEEEccccccccccchhcCCCCCCCEeecccccCcccCCccccCCCCCCeEEcccCc-Cccc-C
Q 036674          261 HFQGTIPKSLRNCTSLIRVRVNGNNLTGNISEALGIYPNLNYIDLSRNNFYGEISSNLGEYPKLGTLNVSMNN-ITGG-I  338 (339)
Q Consensus       261 ~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~-lt~~-i  338 (339)
                      .+.+.++ .+..+++|+.|++++|++++.+|.+++.+++|++|+|++|+++|.+|. ++++++|+.+++++|+ ++|. +
T Consensus       232 ~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~pl  309 (313)
T d1ogqa_         232 SLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGSPL  309 (313)
T ss_dssp             EECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEESTTS
T ss_pred             ccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCCCC
Confidence            9987766 578889999999999999999999999999999999999999998885 6889999999999997 5664 5


Q ss_pred             C
Q 036674          339 P  339 (339)
Q Consensus       339 p  339 (339)
                      |
T Consensus       310 p  310 (313)
T d1ogqa_         310 P  310 (313)
T ss_dssp             S
T ss_pred             C
Confidence            5
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure