Citrus Sinensis ID: 036743

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
QDVELSQMVLSKYKFPPSLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLKILRPKSMFWVEEWTMRAGAMP
ccccccccccccccccccccEEEEEccccccccHHHHcccccccEEEEEccEEcccEEEEEcccccccccEEEccccccccEEEEcccccc
cccEEccccccccccccccEEEEEEccccccccHHHHHHccccEEEEEEcccccccEEEEcccccccccEEEEEccHHHHcEEEEcccccc
QDVELSQMVlskykfppsltqlsltnaelkydplpaleklphlRVLKLKQSLYSGrklacagfggflqlkilrpksmfWVEEWTMRAGAMP
qdvelsqmvlskykfppsltQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLKILRPKSMFWVEEWTMRAGAMP
QDVELSQMVLSKYKFPPSLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLKILRPKSMFWVEEWTMRAGAMP
************YKF**SLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLKILRPKSMFWVEEWTM******
*DVELSQMVLSKYKFPPSLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLKILRPKSMFWVEEWTMRAGAMP
QDVELSQMVLSKYKFPPSLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLKILRPKSMFWVEEWTMRAGAMP
*DVELSQMVLSKYKFPPSLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLKILRPKSMFWVEEWTMRA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QDVELSQMVLSKYKFPPSLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLKILRPKSMFWVEEWTMRAGAMP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
Q9FJK8908 Probable disease resistan yes no 0.879 0.088 0.382 3e-10
Q9FJB5901 Disease resistance RPP8-l no no 0.879 0.088 0.345 3e-10
Q8W474907 Probable disease resistan no no 0.967 0.097 0.393 3e-10
Q8W4J9908 Disease resistance protei no no 0.879 0.088 0.358 1e-09
Q9XIF0906 Putative disease resistan no no 0.835 0.083 0.428 2e-09
P59584910 Disease resistance protei no no 0.868 0.086 0.35 4e-09
P0C8S1906 Probable disease resistan no no 0.879 0.088 0.370 4e-09
P0DI18 1049 Probable disease resistan no no 0.835 0.072 0.428 4e-09
P0DI17 1049 Probable disease resistan no no 0.835 0.072 0.428 4e-09
P0DI161017 Probable disease resistan no no 0.835 0.074 0.415 2e-07
>sp|Q9FJK8|RP8L4_ARATH Probable disease resistance RPP8-like protein 4 OS=Arabidopsis thaliana GN=RPP8L4 PE=2 SV=1 Back     alignment and function desciption
 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 11  SKYKFPPSLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLK 70
            +++FPP L  + L +  +K DP+P LEKL HL+ + L    + GR++ C+  GGF QL 
Sbjct: 764 DQHQFPPHLAHIHLVHCVMKEDPMPILEKLLHLKSVALSYGAFIGRRVVCSK-GGFPQLC 822

Query: 71  ILRPKSMFWVEEWTMRAGAMP 91
            L       +EEW +  G+MP
Sbjct: 823 ALGISGESELEEWIVEEGSMP 843
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function description
>sp|Q8W474|DRL7_ARATH Probable disease resistance protein At1g58390 OS=Arabidopsis thaliana GN=At1g58390 PE=2 SV=4 Back     alignment and function description
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|Q9XIF0|DRL13_ARATH Putative disease resistance protein At1g59780 OS=Arabidopsis thaliana GN=At1g59780 PE=2 SV=1 Back     alignment and function description
>sp|P59584|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|P0DI18|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1 Back     alignment and function description
>sp|P0DI17|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1 Back     alignment and function description
>sp|P0DI16|DRL44_ARATH Probable disease resistance protein RDL5 OS=Arabidopsis thaliana GN=RDL5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
359489790 944 PREDICTED: probable disease resistance p 0.824 0.079 0.486 2e-11
359489792 916 PREDICTED: probable disease resistance p 0.835 0.082 0.480 1e-10
32453357 506 resistance protein RPP8-like protein [Ar 0.879 0.158 0.407 1e-10
32453355 502 resistance protein RPP8-like protein [Ar 0.879 0.159 0.395 4e-10
297840631 195 predicted protein [Arabidopsis lyrata su 0.835 0.389 0.454 4e-10
147822234 559 hypothetical protein VITISV_021937 [Viti 0.835 0.135 0.480 4e-10
3928862 906 disease resistance protein RPP8 [Arabido 0.879 0.088 0.382 5e-10
339431373 968 putative CC-NBS-LRR protein [Malus x dom 0.846 0.079 0.430 5e-10
359495927 1245 PREDICTED: putative disease resistance p 0.824 0.060 0.407 5e-10
147856113 2540 hypothetical protein VITISV_006121 [Viti 0.824 0.029 0.407 5e-10
>gi|359489790|ref|XP_003633978.1| PREDICTED: probable disease resistance protein At1g58602-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 54/76 (71%), Gaps = 1/76 (1%)

Query: 15  FPPSLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLKILRP 74
           +PP+L +L+L++ ELK DP+  LEKLP LR+L+L  + Y G+ + C+ FGGFLQL+ L  
Sbjct: 806 YPPNLVKLTLSSCELKDDPMLILEKLPTLRILELVGNSYVGKNMVCS-FGGFLQLESLEL 864

Query: 75  KSMFWVEEWTMRAGAM 90
            S+  +EE T+  GAM
Sbjct: 865 DSLNELEELTVEEGAM 880

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359489792|ref|XP_002274076.2| PREDICTED: probable disease resistance protein RDL6/RF9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|32453357|gb|AAP82810.1| resistance protein RPP8-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|32453355|gb|AAP82809.1| resistance protein RPP8-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297840631|ref|XP_002888197.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297334038|gb|EFH64456.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|147822234|emb|CAN70787.1| hypothetical protein VITISV_021937 [Vitis vinifera] Back     alignment and taxonomy information
>gi|3928862|gb|AAC83165.1| disease resistance protein RPP8 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|339431373|gb|AEJ72566.1| putative CC-NBS-LRR protein [Malus x domestica] Back     alignment and taxonomy information
>gi|359495927|ref|XP_002272120.2| PREDICTED: putative disease resistance protein At1g59780-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147856113|emb|CAN82439.1| hypothetical protein VITISV_006121 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.956 0.096 0.348 3.5e-10
TAIR|locus:2037639907 AT1G58390 "AT1G58390" [Arabido 0.956 0.095 0.421 3.5e-10
TAIR|locus:2152536908 AT5G48620 [Arabidopsis thalian 0.956 0.095 0.370 7.4e-10
TAIR|locus:504956182 1049 AT1G58848 [Arabidopsis thalian 0.890 0.077 0.409 1.9e-09
TAIR|locus:2826978 1049 AT1G59218 [Arabidopsis thalian 0.890 0.077 0.409 1.9e-09
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.956 0.095 0.348 2e-09
TAIR|locus:2025916906 AT1G59780 "AT1G59780" [Arabido 0.835 0.083 0.428 2.5e-09
TAIR|locus:5049561861138 AT1G58602 [Arabidopsis thalian 0.813 0.065 0.428 5.5e-09
TAIR|locus:504956184 1017 AT1G58807 "AT1G58807" [Arabido 0.835 0.074 0.402 7.1e-08
TAIR|locus:2827038 1017 AT1G59124 "AT1G59124" [Arabido 0.835 0.074 0.402 7.1e-08
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 157 (60.3 bits), Expect = 3.5e-10, P = 3.5e-10
 Identities = 31/89 (34%), Positives = 55/89 (61%)

Query:     3 VELSQMVLSKYKFPPSLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAG 62
             V LS+ +  +++ PP +  + L    ++ DP+P LEKL HL+ ++L++  + GR++ C+ 
Sbjct:   748 VHLSK-IPDQHQLPPHIAHIYLLFCHMEEDPMPILEKLLHLKSVELRRKAFIGRRMVCSK 806

Query:    63 FGGFLQLKILRPKSMFWVEEWTMRAGAMP 91
              GGF QL+ L+      +EEW +  G+MP
Sbjct:   807 -GGFPQLRALQISEQSELEEWIVEEGSMP 834
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025916 AT1G59780 "AT1G59780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.02
PLN03150 623 hypothetical protein; Provisional 97.98
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.92
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.79
PLN03150623 hypothetical protein; Provisional 97.75
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.65
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.61
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.45
KOG0617 264 consensus Ras suppressor protein (contains leucine 97.14
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.91
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.63
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.6
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.27
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 95.43
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.38
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.35
KOG0472565 consensus Leucine-rich repeat protein [Function un 95.28
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 95.16
KOG0617 264 consensus Ras suppressor protein (contains leucine 95.05
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.01
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 95.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 94.59
KOG1259490 consensus Nischarin, modulator of integrin alpha5 94.58
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 94.31
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 94.05
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 94.03
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 93.54
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 93.18
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 92.93
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 92.63
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 92.59
KOG0472 565 consensus Leucine-rich repeat protein [Function un 92.43
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 92.34
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 91.48
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 91.25
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 90.76
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.67
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 90.1
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 88.67
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 88.39
KOG1259490 consensus Nischarin, modulator of integrin alpha5 88.09
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 87.59
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 87.08
KOG1947 482 consensus Leucine rich repeat proteins, some prote 85.5
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 85.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 84.1
smart0037026 LRR Leucine-rich repeats, outliers. 83.42
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.42
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 81.96
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 81.72
KOG4237 498 consensus Extracellular matrix protein slit, conta 81.58
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information 
Probab=98.02  E-value=8.9e-06  Score=44.04  Aligned_cols=59  Identities=25%  Similarity=0.420  Sum_probs=39.3

Q ss_pred             CCccEEEEecccCCCCCcccccCCCCCceeEEecccccCcEEEeeCCCCCccCcEEeccCC
Q 036743           17 PSLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLKILRPKSM   77 (91)
Q Consensus        17 ~~L~~L~L~~~~l~~~~l~~L~~Lp~L~~L~L~~~~~~~~~l~~~~~~~Fp~Lk~L~l~~~   77 (91)
                      ++|++|+++.|++..-+-..+..+++|++|+|..+...  .+.-+...++++|++|.+.+.
T Consensus         1 p~L~~L~l~~n~l~~i~~~~f~~l~~L~~L~l~~N~l~--~i~~~~f~~l~~L~~L~l~~N   59 (61)
T PF13855_consen    1 PNLESLDLSNNKLTEIPPDSFSNLPNLETLDLSNNNLT--SIPPDAFSNLPNLRYLDLSNN   59 (61)
T ss_dssp             TTESEEEETSSTESEECTTTTTTGTTESEEEETSSSES--EEETTTTTTSTTESEEEETSS
T ss_pred             CcCcEEECCCCCCCccCHHHHcCCCCCCEeEccCCccC--ccCHHHHcCCCCCCEEeCcCC
Confidence            47788888888877655567888888888888644442  222111346777788777653

...
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.45
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.4
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.38
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.33
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.31
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.29
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.28
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.26
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.26
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.24
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 98.24
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.2
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.19
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.17
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.17
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.14
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.14
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.13
3m19_A 251 Variable lymphocyte receptor A diversity region; a 98.13
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.13
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.1
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.1
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 98.09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.06
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.06
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.02
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.02
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.01
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.01
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 97.99
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.99
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 97.98
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.97
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.96
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 97.96
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.96
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.95
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 97.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.95
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 97.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.92
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 97.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.9
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.89
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.89
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.88
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.88
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.86
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.86
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.86
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.86
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.86
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.86
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.85
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.85
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 97.84
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.84
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.84
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 97.83
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.83
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.82
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.79
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.77
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.77
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.77
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 97.75
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.73
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.72
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.68
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 97.67
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.67
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.66
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.65
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.65
4glp_A 310 Monocyte differentiation antigen CD14; alpha beta 97.65
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 97.64
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.63
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.61
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.59
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 97.58
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.56
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 97.56
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.55
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 97.52
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.51
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.49
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 97.47
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.46
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.45
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.41
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.41
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.37
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.36
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.33
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.27
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.26
1o6v_A 466 Internalin A; bacterial infection, extracellular r 97.23
1o6v_A466 Internalin A; bacterial infection, extracellular r 97.18
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 96.97
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.85
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 96.75
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 96.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.71
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 96.7
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 96.68
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 96.61
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 96.56
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.54
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.46
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 96.45
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 96.4
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.3
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 96.14
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 96.04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.69
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 95.19
2ra8_A 362 Uncharacterized protein Q64V53_bacfr; WGR domain, 94.96
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 92.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 92.21
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 87.15
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 86.48
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
Probab=98.46  E-value=2.4e-07  Score=58.39  Aligned_cols=74  Identities=20%  Similarity=0.268  Sum_probs=50.7

Q ss_pred             ceecccccCcccCCCCCccEEEEecccCCCCCcccccCCCCCceeEEecccccCcEEEeeCCCCCccCcEEeccCC
Q 036743            2 DVELSQMVLSKYKFPPSLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLKILRPKSM   77 (91)
Q Consensus         2 ~~~~~~~lP~wi~~L~~L~~L~L~~~~l~~~~l~~L~~Lp~L~~L~L~~~~~~~~~l~~~~~~~Fp~Lk~L~l~~~   77 (91)
                      +|+|.+-.|..+..+++|++|+|++|++..-+-..++++++|++|+|..+...+..  -.....+++|++|.+.+-
T Consensus        39 ~N~i~~~~~~~~~~l~~L~~L~Ls~N~l~~l~~~~f~~l~~L~~L~L~~N~l~~~~--~~~~~~l~~L~~L~L~~N  112 (170)
T 3g39_A           39 DNQITKLEPGVFDRLTQLTRLDLDNNQLTVLPAGVFDKLTQLTQLSLNDNQLKSIP--RGAFDNLKSLTHIWLLNN  112 (170)
T ss_dssp             SSCCCCCCTTTTTTCTTCSEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCCCCC--TTTTTTCTTCCEEECCSS
T ss_pred             CCcCCccChhhhcCcccCCEEECCCCCcCccChhhccCCCCCCEEECCCCccCEeC--HHHhcCCCCCCEEEeCCC
Confidence            56777755777788888888888888877555555788888888888766544311  111245788888888654
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.42
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.15
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.14
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.1
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 98.04
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.03
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.03
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 97.96
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 97.93
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.84
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.82
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.68
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.48
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.48
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.46
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.45
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.42
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.39
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.36
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.32
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.19
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.18
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.17
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 97.1
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.01
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.01
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.81
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 96.4
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 95.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 94.69
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 94.3
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 91.71
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 91.34
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 88.91
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 85.95
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=98.42  E-value=8.2e-08  Score=56.74  Aligned_cols=71  Identities=15%  Similarity=0.155  Sum_probs=38.6

Q ss_pred             ceecccccCcccCCCCCccEEEEecccCCCCCcccccCCCCCceeEEecccccCcEEEeeCCCCCccCcEEeccC
Q 036743            2 DVELSQMVLSKYKFPPSLTQLSLTNAELKYDPLPALEKLPHLRVLKLKQSLYSGRKLACAGFGGFLQLKILRPKS   76 (91)
Q Consensus         2 ~~~~~~~lP~wi~~L~~L~~L~L~~~~l~~~~l~~L~~Lp~L~~L~L~~~~~~~~~l~~~~~~~Fp~Lk~L~l~~   76 (91)
                      +|++.. +|+.+..+++|+.|+++.|.+.  .++.++++|+|+.|++..+......-... ...+++|+.|++.+
T Consensus        29 ~N~l~~-lp~~~~~l~~L~~L~l~~N~i~--~l~~~~~l~~L~~L~l~~N~i~~~~~~~~-l~~~~~L~~L~l~~   99 (124)
T d1dcea3          29 HNRLRA-LPPALAALRCLEVLQASDNALE--NVDGVANLPRLQELLLCNNRLQQSAAIQP-LVSCPRLVLLNLQG   99 (124)
T ss_dssp             SSCCCC-CCGGGGGCTTCCEEECCSSCCC--CCGGGTTCSSCCEEECCSSCCCSSSTTGG-GGGCTTCCEEECTT
T ss_pred             CCccCc-chhhhhhhhccccccccccccc--ccCccccccccCeEECCCCccCCCCCchh-hcCCCCCCEEECCC
Confidence            455553 6665666666666666666654  34556666666666665444332110001 23466677776654
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure