Citrus Sinensis ID: 036753
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 725 | ||||||
| 224101679 | 788 | nbs-lrr resistance protein [Populus tric | 0.892 | 0.821 | 0.446 | 1e-141 | |
| 224122720 | 746 | cc-nbs-lrr resistance protein [Populus t | 0.88 | 0.855 | 0.396 | 1e-125 | |
| 359482794 | 880 | PREDICTED: putative disease resistance p | 0.594 | 0.489 | 0.443 | 1e-90 | |
| 255549784 | 786 | leucine-rich repeat containing protein, | 0.576 | 0.531 | 0.448 | 4e-87 | |
| 224114824 | 941 | cc-nbs-lrr resistance protein [Populus t | 0.587 | 0.452 | 0.420 | 6e-87 | |
| 359482788 | 903 | PREDICTED: putative disease resistance p | 0.579 | 0.465 | 0.437 | 8e-87 | |
| 297743527 | 613 | unnamed protein product [Vitis vinifera] | 0.582 | 0.688 | 0.432 | 5e-86 | |
| 224115608 | 922 | cc-nbs-lrr resistance protein [Populus t | 0.611 | 0.480 | 0.418 | 6e-86 | |
| 147825450 | 927 | hypothetical protein VITISV_000086 [Viti | 0.566 | 0.443 | 0.439 | 1e-85 | |
| 359482792 | 922 | PREDICTED: putative disease resistance p | 0.575 | 0.452 | 0.439 | 2e-85 |
| >gi|224101679|ref|XP_002334255.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222870330|gb|EEF07461.1| nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 507 bits (1305), Expect = e-141, Method: Compositional matrix adjust.
Identities = 324/725 (44%), Positives = 423/725 (58%), Gaps = 78/725 (10%)
Query: 1 MVDAFISPLLQQLTSMAVEEAKEQVRLVTGVGKEVEKLTSNLRAIQAVLHDAEKRQVKDE 60
M DA +S +L++L+S+ E+ ++VRL GV EVEKLTS+ RAIQAV DAE+RQ+KD+
Sbjct: 1 MADALVSVVLERLSSIVSEKVGQKVRLFVGVKNEVEKLTSSFRAIQAVFADAEERQLKDQ 60
Query: 61 TVKLWLDQLRDACYDMEDVLGEWSTARLKLQIDGVDDDPENDVLVCLEKVCSFFPPASCF 120
VK WLDQL+D YDM+DVL EW TA KLQ KVCSF SCF
Sbjct: 61 FVKHWLDQLKDVSYDMDDVLDEWDTAIAKLQSKNT------------RKVCSFM-IFSCF 107
Query: 121 GCKQLVLRRDIALKIKEINETLDNIDKQKAMFRFAANVIKSTERADQRGPSISSIDVSEI 180
+++ LR +A KIKE+NE +D I +K F F ++++ + + + S IDV E+
Sbjct: 108 HFREVGLRHRVAYKIKELNERIDGIVVEKNRFHF--KLLEAGIKQLEHHETASVIDVKEV 165
Query: 181 FGRPKEKKELVDRLLCEGSKEQKGPCI--ISLVGMGGIGKTTLAQFAYNNDDVKKHFDER 238
GR K+K ++ LL E S +GP + ISLVGMGGIGKTTLA+ +N+ VK HF+ R
Sbjct: 166 KGREKDKVRVIKTLLSESS---QGPALRTISLVGMGGIGKTTLAKLVFNDHVVKTHFNRR 222
Query: 239 IWVCVSEPFDEFRIARAVIEALKSGDASNFEAIEKGLLAPLLLSYNELPSKVKRCFSYCA 298
IWVCVS+PFDE RIA+ ++EA +SY++LPS+V+RCFSYCA
Sbjct: 223 IWVCVSDPFDETRIAKEILEA--------------------HMSYHDLPSEVRRCFSYCA 262
Query: 299 VFPKDYGIRKHKLIELWMAQGYLSEKGAKEMEDIGEEYFNILASRSFFQDFDK--GDDGE 356
VFPKD+ + LI+LWMAQG+L E KEME +G E F LA+RSFFQDF K GDD
Sbjct: 263 VFPKDFTFYRGDLIKLWMAQGFLRETQNKEMEVMGRECFEALAARSFFQDFKKEEGDDS- 321
Query: 357 IYKCKMHDIVHDFAQYLCRNECLAVEIHSGEELAISSFEEKKILHLPLTLRRGASVPISI 416
IY CKMHD+VHDFAQ+L +NE VEI E I SF + H + LR+ + S
Sbjct: 322 IYACKMHDMVHDFAQFLTKNESFNVEIDGAAESKIDSF-SRDARHSMVVLRKYKTY--SF 378
Query: 417 WGNVTGLRGLRSLLVKSDEYSWSSEG-LPQLFEKLTCLRALELQVRESWPRNSLIKEIPT 475
+ L+ LRSL+V D Y S LP L L+CLR L L I+E+P+
Sbjct: 379 PETIHSLKKLRSLIV--DGYPSSMNATLPNLIANLSCLRTLRLS-------RCGIEEVPS 429
Query: 476 NIEKLLHLKYLNLKGQKKIENLPETLCELYNLECLNVDDCQNLRELPRGIGKLRKLMYLH 535
NI KL+HL++++L G I LPE +CELYN+ L+V DC+ L LP + KL KL +L
Sbjct: 430 NIGKLIHLRHVDLSGN-LIRELPEEMCELYNMLTLDVSDCEKLERLPDNMEKLVKLRHL- 487
Query: 536 NEDTGCLRYLPAGIGELIRLRRVREFVVGGGYDRACSLGSLKKLNFLQ-QCGIRGLGGVS 594
G L G+ L LR + EF V G + + G L+ LN LQ IR LG V
Sbjct: 488 --SVGRLFVKMRGVEGLSSLRELDEFHVSGSGE-VSNFGDLRNLNHLQGSLKIRWLGDVK 544
Query: 595 DAGEAARAELEKKKYLLKLGLHFDRIRDGDEEQAGRRENEEDEDERLLEALGPPPNLKNL 654
D E +A L+ K++L L L F+ R + D+ +LEAL PPPNL+ L
Sbjct: 545 DPDEVKKALLKSKEHLTCLRLWFE----------SRIDKGTIHDDEVLEALEPPPNLEFL 594
Query: 655 GIDEYRGRRNVVPKNWFMSLTN-LRDLSLFWWSNCEHLPPLGKLKSLESLLIYGMQSVKR 713
I YRG V F S N LR + L W E+LPPLGKL SLE L I M+ VK+
Sbjct: 595 EIRYYRGIDPV-----FSSCINKLRVVELSEWGKIENLPPLGKLPSLEELTISWMECVKK 649
Query: 714 VGNEL 718
+G+E
Sbjct: 650 MGDEF 654
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224122720|ref|XP_002318909.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859582|gb|EEE97129.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359482794|ref|XP_002268547.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255549784|ref|XP_002515943.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223544848|gb|EEF46363.1| leucine-rich repeat containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224114824|ref|XP_002332291.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222832453|gb|EEE70930.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359482788|ref|XP_003632840.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297743527|emb|CBI36394.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224115608|ref|XP_002332098.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874918|gb|EEF12049.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147825450|emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359482792|ref|XP_002268589.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 725 | ||||||
| TAIR|locus:2091672 | 1054 | AT3G14470 [Arabidopsis thalian | 0.331 | 0.227 | 0.343 | 4.2e-53 | |
| TAIR|locus:2091662 | 1424 | AT3G14460 [Arabidopsis thalian | 0.388 | 0.198 | 0.306 | 8.3e-43 | |
| UNIPROTKB|O48647 | 1802 | O48647 "XA1" [Oryza sativa (ta | 0.424 | 0.170 | 0.262 | 1.3e-30 | |
| TAIR|locus:504956483 | 847 | AT3G46730 [Arabidopsis thalian | 0.321 | 0.275 | 0.281 | 7.3e-29 | |
| TAIR|locus:2176486 | 908 | RPP8 "RECOGNITION OF PERONOSPO | 0.315 | 0.252 | 0.251 | 1.4e-28 | |
| TAIR|locus:2078012 | 852 | ZAR1 "HOPZ-ACTIVATED RESISTANC | 0.388 | 0.330 | 0.261 | 3e-28 | |
| TAIR|locus:2152536 | 908 | AT5G48620 [Arabidopsis thalian | 0.326 | 0.261 | 0.290 | 1.8e-27 | |
| TAIR|locus:504956182 | 1049 | AT1G58848 [Arabidopsis thalian | 0.380 | 0.263 | 0.266 | 2.9e-27 | |
| TAIR|locus:2826978 | 1049 | AT1G59218 [Arabidopsis thalian | 0.380 | 0.263 | 0.266 | 2.9e-27 | |
| TAIR|locus:2037623 | 899 | AT1G58410 [Arabidopsis thalian | 0.326 | 0.263 | 0.289 | 4.5e-27 |
| TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 304 (112.1 bits), Expect = 4.2e-53, Sum P(3) = 4.2e-53
Identities = 93/271 (34%), Positives = 146/271 (53%)
Query: 272 EKGLLAPLL-LSYNELPSKVKRCFSYCAVFPKDYGIRKHKLIELWMAQGYLSE-KGAKEM 329
+K L P+L +SY LP+ +KRCF+YC++FPK + K K++ LWMA+G+L + + +K +
Sbjct: 407 DKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKNL 466
Query: 330 EDIGEEYFNILASRSFFQDFDKGDDGEIYKCKMHDIVHDFAQYLCRNECLAVEIHSGEEL 389
E++G EYF+ L SRS Q K I MHD +++ AQ+ E + + G +L
Sbjct: 467 EELGNEYFSELESRSLLQ---KTKTRYI----MHDFINELAQF-ASGE-FSSKFEDGCKL 517
Query: 390 AISSFEEKKILHLPLTLRRGASVPISIWGNVTGLRGLRSLLVKSDEYSWSSEGLPQLF-E 448
+S E + L LR + P+ + ++ LR+ L S S S L Q+ E
Sbjct: 518 QVS--ERTRYLSY---LRDNYAEPMEFEA-LREVKFLRTFLPLSLTNSSRSCCLDQMVSE 571
Query: 449 KL----TCLRALELQVRESWPRNSLIKEIPTNIEK-LLHLKYLNLKGQKKIENLPETLCE 503
KL T LR L L + I +P + K + H ++L+L + ++E LP++LC
Sbjct: 572 KLLPTLTRLRVLSLS-------HYKIARLPPDFFKNISHARFLDLS-RTELEKLPKSLCY 623
Query: 504 LYNLECLNVDDCQNLRELPRGIGKLRKLMYL 534
+YNL+ L + C +L+ELP I L L YL
Sbjct: 624 MYNLQTLLLSYCSSLKELPTDISNLINLRYL 654
|
|
| TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 725 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 8e-17 | |
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 3e-10 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-04 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-04 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 0.002 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 81.2 bits (201), Expect = 8e-17
Identities = 30/84 (35%), Positives = 49/84 (58%), Gaps = 4/84 (4%)
Query: 183 RPKEKKELVDRLLCEGSKEQKGPCIISLVGMGGIGKTTLAQFAYNNDDVKKHFDERIWVC 242
R + L+++L + ++ +VGMGG+GKTTLA+ YN+D V HFD WV
Sbjct: 1 REDMIEALIEKL----LEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVV 56
Query: 243 VSEPFDEFRIARAVIEALKSGDAS 266
VS+ + EFR+ + +++ L D+
Sbjct: 57 VSKTYTEFRLQKDILQELGLDDSD 80
|
Length = 285 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 725 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.85 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 99.85 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.83 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.81 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.81 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.79 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.7 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.68 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.66 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.59 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.49 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.45 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.43 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.43 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.37 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.37 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.35 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.33 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.31 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.25 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.22 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.21 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.15 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.82 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.78 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.69 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.63 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.59 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.59 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.54 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.5 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.5 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.48 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.4 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.35 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.31 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.26 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.26 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.19 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.19 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.14 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.11 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.1 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 98.05 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.03 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.02 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 98.01 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.92 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.88 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.76 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.61 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.61 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 97.6 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 97.59 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 97.57 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.56 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.54 | |
| PTZ00202 | 550 | tuzin; Provisional | 97.52 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 97.45 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.45 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.41 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.33 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.32 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.29 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.19 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.15 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 97.08 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.98 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 96.92 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.92 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 96.89 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.74 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 96.71 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.69 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 96.63 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.6 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 96.56 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 96.55 | |
| PRK07667 | 193 | uridine kinase; Provisional | 96.53 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.44 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 96.43 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 96.37 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.33 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.3 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 96.21 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 96.17 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 96.16 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.16 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.09 | |
| PF05659 | 147 | RPW8: Arabidopsis broad-spectrum mildew resistance | 96.04 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 96.02 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 96.02 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 95.92 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 95.92 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 95.78 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 95.77 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 95.75 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 95.74 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 95.71 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.68 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 95.68 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.62 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.6 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.57 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 95.57 | |
| PF05729 | 166 | NACHT: NACHT domain | 95.53 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 95.5 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 95.47 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 95.46 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 95.45 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 95.32 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 95.31 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 95.25 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 95.2 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 95.18 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 95.17 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 95.16 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 95.07 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 95.02 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 94.97 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 94.91 | |
| PF13173 | 128 | AAA_14: AAA domain | 94.9 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 94.89 | |
| PF12061 | 402 | DUF3542: Protein of unknown function (DUF3542); In | 94.88 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 94.83 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 94.82 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 94.82 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 94.82 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 94.81 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 94.73 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 94.73 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 94.66 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 94.62 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 94.62 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 94.61 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 94.58 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 94.57 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 94.57 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 94.5 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 94.42 | |
| PRK03839 | 180 | putative kinase; Provisional | 94.42 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 94.41 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.35 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 94.34 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 94.32 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 94.27 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 94.26 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 94.24 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 94.18 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 94.17 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 94.15 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 94.15 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 94.11 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 94.08 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 94.05 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 94.05 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 94.03 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 94.01 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 94.0 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 94.0 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 93.98 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 93.95 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 93.94 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 93.92 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 93.9 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 93.89 | |
| PRK06217 | 183 | hypothetical protein; Validated | 93.85 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 93.82 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 93.8 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 93.76 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 93.74 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 93.71 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 93.7 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 93.7 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 93.68 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 93.68 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 93.67 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 93.63 | |
| PRK08727 | 233 | hypothetical protein; Validated | 93.62 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 93.62 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 93.61 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 93.6 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 93.58 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 93.57 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 93.52 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 93.49 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 93.48 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 93.47 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 93.46 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 93.4 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 93.38 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 93.35 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 93.34 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 93.33 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 93.32 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 93.32 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 93.31 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 93.3 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 93.3 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 93.3 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.28 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 93.28 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 93.26 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 93.21 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 93.19 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 93.18 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 93.18 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 93.18 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 93.13 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 93.13 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 93.08 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 93.08 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 93.07 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 93.05 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 93.04 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 92.93 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 92.92 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 92.9 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 92.89 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 92.85 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 92.84 | |
| PLN02348 | 395 | phosphoribulokinase | 92.84 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 92.79 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 92.77 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 92.77 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 92.74 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 92.72 | |
| PRK13236 | 296 | nitrogenase reductase; Reviewed | 92.71 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 92.71 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 92.67 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 92.65 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 92.64 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 92.62 | |
| PRK13695 | 174 | putative NTPase; Provisional | 92.62 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 92.62 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 92.61 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 92.6 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 92.58 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 92.54 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 92.53 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 92.49 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 92.47 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 92.46 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 92.46 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 92.45 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 92.44 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 92.4 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 92.4 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 92.36 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 92.36 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 92.35 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 92.34 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 92.33 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 92.33 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 92.32 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 92.3 | |
| PRK13232 | 273 | nifH nitrogenase reductase; Reviewed | 92.3 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 92.26 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 92.24 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 92.24 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 92.23 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 92.2 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 92.18 | |
| PRK13230 | 279 | nitrogenase reductase-like protein; Reviewed | 92.17 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 92.13 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 92.11 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 92.08 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 92.03 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 92.03 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 92.03 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 92.02 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 91.98 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 91.97 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 91.94 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 91.92 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 91.91 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 91.9 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 91.88 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 91.87 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 91.86 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 91.83 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 91.8 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 91.79 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 91.77 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 91.76 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 91.76 | |
| PRK13768 | 253 | GTPase; Provisional | 91.76 | |
| PRK12377 | 248 | putative replication protein; Provisional | 91.75 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 91.74 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 91.73 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 91.73 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 91.68 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 91.67 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 91.65 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 91.64 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 91.64 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 91.63 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 91.6 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 91.6 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 91.59 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 91.58 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 91.57 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 91.56 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 91.55 | |
| PRK06620 | 214 | hypothetical protein; Validated | 91.54 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 91.54 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 91.52 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 91.5 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 91.49 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 91.48 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 91.47 | |
| PRK09087 | 226 | hypothetical protein; Validated | 91.47 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 91.46 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 91.42 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 91.42 | |
| PRK13233 | 275 | nifH nitrogenase reductase; Reviewed | 91.4 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 91.39 | |
| PF06564 | 243 | YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p | 91.37 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 91.34 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 91.29 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 91.28 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 91.28 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 91.26 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 91.25 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 91.25 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 91.21 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 91.2 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 91.18 | |
| PF00142 | 273 | Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot | 91.18 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 91.14 | |
| PLN02200 | 234 | adenylate kinase family protein | 91.14 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 91.12 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 91.12 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 91.1 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 91.09 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 91.07 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 91.06 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 91.04 | |
| PHA02575 | 227 | 1 deoxynucleoside monophosphate kinase; Provisiona | 91.04 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 91.02 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 91.01 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 91.0 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 90.99 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 90.97 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 90.95 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 90.94 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 90.94 | |
| PRK08116 | 268 | hypothetical protein; Validated | 90.93 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 90.93 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 90.91 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 90.9 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 90.88 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 90.88 | |
| PRK13231 | 264 | nitrogenase reductase-like protein; Reviewed | 90.87 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 90.85 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 90.84 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 90.83 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 90.82 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 90.81 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 90.77 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 90.76 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 90.75 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 90.74 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 90.73 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 90.73 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 90.72 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 90.7 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 90.69 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 90.69 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 90.67 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 90.67 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 90.64 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 90.63 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 90.61 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 90.6 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 90.57 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 90.57 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 90.55 | |
| KOG3308 | 225 | consensus Uncharacterized protein of the uridine k | 90.53 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 90.52 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 90.52 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 90.5 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 90.5 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 90.48 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 90.48 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 90.48 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 90.48 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 90.47 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 90.46 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 90.45 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 90.44 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 90.42 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 90.41 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 90.4 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 90.39 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 90.37 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 90.36 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 90.34 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 90.32 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 90.3 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 90.3 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 90.29 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 90.29 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 90.28 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 90.28 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 90.27 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 90.25 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 90.25 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 90.23 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 90.21 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 90.2 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 90.19 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 90.18 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 90.17 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 90.16 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 90.14 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 90.09 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 90.09 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 90.09 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 90.08 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 90.07 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 90.06 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 90.06 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 90.04 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 90.04 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 90.02 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 90.0 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 89.99 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 89.99 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 89.97 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 89.95 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 89.95 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 89.93 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 89.93 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 89.91 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 89.91 | |
| PF08303 | 168 | tRNA_lig_kinase: tRNA ligase kinase domain; InterP | 89.9 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 89.85 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 89.84 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 89.83 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 89.82 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 89.82 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 89.81 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 89.8 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 89.8 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 89.77 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 89.72 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 89.71 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 89.7 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 89.7 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 89.7 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 89.68 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 89.68 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 89.66 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 89.65 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 89.64 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 89.64 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 89.63 | |
| PRK06526 | 254 | transposase; Provisional | 89.63 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 89.63 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 89.62 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 89.62 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 89.61 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 89.61 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 89.61 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 89.6 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 89.58 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 89.53 | |
| cd01673 | 193 | dNK Deoxyribonucleoside kinase (dNK) catalyzes the | 89.52 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 89.51 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 89.49 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 89.48 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 89.48 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 89.48 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 89.45 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 89.45 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 89.45 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 89.43 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 89.4 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 89.39 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 89.38 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 89.36 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 89.35 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 89.34 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 89.33 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 89.33 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 89.32 | |
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 89.31 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 89.29 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 89.29 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 89.26 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 89.26 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 89.25 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 89.25 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 89.24 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 89.22 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 89.22 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 89.21 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-69 Score=612.05 Aligned_cols=573 Identities=25% Similarity=0.355 Sum_probs=438.3
Q ss_pred hhhhHHHHHHHHhhhhHHHHHHHHHHHhCcHHHHHHHHHHHHHHHHHHHHHhccccCcHHHHHHHHHHHHHhhhhhhhhh
Q 036753 2 VDAFISPLLQQLTSMAVEEAKEQVRLVTGVGKEVEKLTSNLRAIQAVLHDAEKRQVKDETVKLWLDQLRDACYDMEDVLG 81 (725)
Q Consensus 2 a~~~v~~~~~kl~~~l~~~~~~e~~~~~~v~~~~~~L~~~L~~i~~~L~~ae~~~~~~~~~~~wl~~lr~~aydaeD~lD 81 (725)
|++.++..++|+.+ .+.+++..+.+.++.+..|+++|..++.+++|+++++.....++.|.+.+++++|++||+++
T Consensus 1 ~~~~~s~~~~~~~~----~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~ 76 (889)
T KOG4658|consen 1 MGACVSFGVEKLDQ----LLNRESECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIW 76 (889)
T ss_pred CCeEEEEehhhHHH----HHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHH
Confidence 45667778888888 89999999999999999999999999999999999988889999999999999999999999
Q ss_pred hhhhHHHHhhhcCCCCCCCchhhhhhccccccCCCCcccCCcchhhhHHHHHHHHHHHHHHHHHHHhhcccccccccccc
Q 036753 82 EWSTARLKLQIDGVDDDPENDVLVCLEKVCSFFPPASCFGCKQLVLRRDIALKIKEINETLDNIDKQKAMFRFAANVIKS 161 (725)
Q Consensus 82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~i~~~l~~i~~~~~~~~~~~~~~~~ 161 (725)
.|..+....+..+.-.. .....+.. |+ ..++++.+..+..+.+++..+.+....++........
T Consensus 77 ~~~v~~~~~~~~~~l~~--------~~~~~~~~----c~----~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~ 140 (889)
T KOG4658|consen 77 LFLVEEIERKANDLLST--------RSVERQRL----CL----CGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVV 140 (889)
T ss_pred HHHHHHHHHHHhHHhhh--------hHHHHHHH----hh----hhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecc
Confidence 99998876654322000 00011111 11 1455667777777777777777766666544322111
Q ss_pred c--cccCCCCCccccccCCccccchhhHHHHHHHHhcCCCCCCCCCEEEEEEecCCCcHHHHHHHHhcchh-hhccccce
Q 036753 162 T--ERADQRGPSISSIDVSEIFGRPKEKKELVDRLLCEGSKEQKGPCIISLVGMGGIGKTTLAQFAYNNDD-VKKHFDER 238 (725)
Q Consensus 162 ~--~~~~~~~~~~~~~~~~~~vG~~~~~~~l~~~L~~~~~~~~~~~~vi~i~G~gGiGKTtLa~~v~~~~~-~~~~F~~~ 238 (725)
. ..+...+++.+...+.. ||.+..++++++.|..+ +..+|||+||||+||||||+.|||+.. ++.+||..
T Consensus 141 ~~~~~~~~~~e~~~~~~~~~-VG~e~~~~kl~~~L~~d------~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~ 213 (889)
T KOG4658|consen 141 GESLDPREKVETRPIQSESD-VGLETMLEKLWNRLMED------DVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGV 213 (889)
T ss_pred cccccchhhcccCCCCcccc-ccHHHHHHHHHHHhccC------CCCEEEEECCCcccHHHHHHHHhcccchhcccCceE
Confidence 1 11112344445444555 99999999999999865 339999999999999999999999987 99999999
Q ss_pred eeeecCCCccHHHHHHHHHHHhcCCCCCC----------------------------h----------------------
Q 036753 239 IWVCVSEPFDEFRIARAVIEALKSGDASN----------------------------F---------------------- 268 (725)
Q Consensus 239 ~wv~vs~~~~~~~l~~~i~~~l~~~~~~~----------------------------W---------------------- 268 (725)
|||+||+.|+...++++|+..+...+... |
T Consensus 214 iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~Kvv 293 (889)
T KOG4658|consen 214 IWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVV 293 (889)
T ss_pred EEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEE
Confidence 99999999999999999999887731110 2
Q ss_pred --------------------------------------------------------------------------------
Q 036753 269 -------------------------------------------------------------------------------- 268 (725)
Q Consensus 269 -------------------------------------------------------------------------------- 268 (725)
T Consensus 294 lTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~ 373 (889)
T KOG4658|consen 294 LTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQ 373 (889)
T ss_pred EEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHH
Confidence
Q ss_pred -----------------hhhhhhhhhhhhhcccCCchhhhhhhhhcccCCCCCccCHHHHHHHHHHcCCcccC-CCccHH
Q 036753 269 -----------------EAIEKGLLAPLLLSYNELPSKVKRCFSYCAVFPKDYGIRKHKLIELWMAQGYLSEK-GAKEME 330 (725)
Q Consensus 269 -----------------~~~~~~i~~~L~lSy~~L~~~lk~cfl~~~~Fp~~~~i~~~~Li~~Wia~g~i~~~-~~~~~e 330 (725)
....+.|+++|++|||+||.++|.||+|||+|||||+|+++.|+.+|+||||+.+. ++++++
T Consensus 374 eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~ 453 (889)
T KOG4658|consen 374 EWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAE 453 (889)
T ss_pred HHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchh
Confidence 12356789999999999999999999999999999999999999999999999884 468899
Q ss_pred HHHHHHHHHHHhCCCcccccCCCCCceeEeecchhHHHHHHHhhc-----ccceEEecc-CCccccccccccceeEEEee
Q 036753 331 DIGEEYFNILASRSFFQDFDKGDDGEIYKCKMHDIVHDFAQYLCR-----NECLAVEIH-SGEELAISSFEEKKILHLPL 404 (725)
Q Consensus 331 ~~~~~~~~~L~~~~ll~~~~~~~~~~~~~~~mhdl~~dla~~i~~-----~e~~~~~~~-~~~~~~~~~~~~~~~r~L~l 404 (725)
+.|+.|+.+|+.+||++..... ++..+|+|||++||+|.++++ +|+.++... +..+.+....+ ..+|++++
T Consensus 454 d~G~~~i~~LV~~~Ll~~~~~~--~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~-~~~rr~s~ 530 (889)
T KOG4658|consen 454 DVGYDYIEELVRASLLIEERDE--GRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSW-NSVRRMSL 530 (889)
T ss_pred cchHHHHHHHHHHHHHhhcccc--cceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccch-hheeEEEE
Confidence 9999999999999999987754 667789999999999999999 666555543 33334433333 58999999
Q ss_pred eecCCCCcccccccCCCCcccccEEEeccCCccccccchhHHhhcCCcceEEEeccccCCCccccccccccccccCcccc
Q 036753 405 TLRRGASVPISIWGNVTGLRGLRSLLVKSDEYSWSSEGLPQLFEKLTCLRALELQVRESWPRNSLIKEIPTNIEKLLHLK 484 (725)
Q Consensus 405 ~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~l~~Lr~L~L~~~~~~~~~~~~~~lp~~i~~l~~Lr 484 (725)
..+.....+... .+++|++|.+.++.. +.....+.+|..++.||||||+ +|..+..+|.+|+.|.|||
T Consensus 531 ~~~~~~~~~~~~-----~~~~L~tLll~~n~~-~l~~is~~ff~~m~~LrVLDLs------~~~~l~~LP~~I~~Li~Lr 598 (889)
T KOG4658|consen 531 MNNKIEHIAGSS-----ENPKLRTLLLQRNSD-WLLEISGEFFRSLPLLRVLDLS------GNSSLSKLPSSIGELVHLR 598 (889)
T ss_pred eccchhhccCCC-----CCCccceEEEeecch-hhhhcCHHHHhhCcceEEEECC------CCCccCcCChHHhhhhhhh
Confidence 998876544443 677899999999862 1222245668999999999999 7777899999999999999
Q ss_pred EEEeecCCCccccchhhhcCCCCcEeecCCCcccccccccccCCCcCcEEecCCCcccccCCcccCCCccCcccCeEEEc
Q 036753 485 YLNLKGQKKIENLPETLCELYNLECLNVDDCQNLRELPRGIGKLRKLMYLHNEDTGCLRYLPAGIGELIRLRRVREFVVG 564 (725)
Q Consensus 485 ~L~L~~~~~i~~lp~~i~~L~~L~~L~l~~~~~l~~lp~~i~~L~~L~~L~l~~~~~~~~lp~~i~~l~~L~~L~~~~~~ 564 (725)
||+++++. +..+|.++++|++|.+|++..+..+..+|..+..|.+||+|.+.... ...-...++.+.+|++|..+.+.
T Consensus 599 yL~L~~t~-I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~-~~~~~~~l~el~~Le~L~~ls~~ 676 (889)
T KOG4658|consen 599 YLDLSDTG-ISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSA-LSNDKLLLKELENLEHLENLSIT 676 (889)
T ss_pred cccccCCC-ccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeeccc-cccchhhHHhhhcccchhhheee
Confidence 99999999 99999999999999999999998777777777779999999987653 11111234555666666665554
Q ss_pred CcCCCccCccccccCCCCCceEEeCcCCCCChhhhhhhccccccccCcEEEEecCCC
Q 036753 565 GGYDRACSLGSLKKLNFLQQCGIRGLGGVSDAGEAARAELEKKKYLLKLGLHFDRIR 621 (725)
Q Consensus 565 ~~~~~~~~~~~L~~L~~L~~L~i~~~~~~~~~~~~~~~~l~~~~~L~~L~L~~~~l~ 621 (725)
... ...+..+..+.+|+.+.+.-... ........+++..+.+|+.|.+..+.++
T Consensus 677 ~~s--~~~~e~l~~~~~L~~~~~~l~~~-~~~~~~~~~~~~~l~~L~~L~i~~~~~~ 730 (889)
T KOG4658|consen 677 ISS--VLLLEDLLGMTRLRSLLQSLSIE-GCSKRTLISSLGSLGNLEELSILDCGIS 730 (889)
T ss_pred cch--hHhHhhhhhhHHHHHHhHhhhhc-ccccceeecccccccCcceEEEEcCCCc
Confidence 433 22234445555555322211100 0222444567788899999999988753
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PRK13236 nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >PRK13232 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13230 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK13233 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02575 1 deoxynucleoside monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >PRK13231 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 725 | |||
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 2e-29 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 3e-27 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 2e-29 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 2e-27 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-29 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-20 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 7e-19 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 7e-17 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-13 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 4e-05 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 8e-17 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 9e-17 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-14 | |
| 3qfl_A | 115 | MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- | 1e-15 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-13 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-12 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-08 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 6e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-11 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-10 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-09 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 9e-09 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 6e-09 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 8e-09 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-08 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 8e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 7e-09 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-08 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-08 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 7e-08 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 8e-08 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-07 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 9e-05 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 9e-09 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-08 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 5e-08 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 4e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 5e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 3e-05 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-08 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-05 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-08 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-07 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-04 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 5e-07 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 6e-07 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 6e-07 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-06 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 6e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 7e-07 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 7e-07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 3e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 6e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 5e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 9e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 7e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 6e-04 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 3e-06 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 4e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 4e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-04 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 9e-06 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-05 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 9e-05 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-05 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 3e-05 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 4e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 5e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 6e-05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 5e-04 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 6e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 7e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-04 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 4e-04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 4e-04 |
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
Score = 123 bits (309), Expect = 2e-29
Identities = 16/105 (15%), Positives = 37/105 (35%), Gaps = 14/105 (13%)
Query: 274 GLLAPLLLSYNELPSKVKRCFSYCAVFPKDYGIRKHKLIELWMAQGYLSEKGAKEMEDIG 333
L + +S L +K ++ ++ KD + L LW + +
Sbjct: 363 ALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDME-----------TEEV 411
Query: 334 EEYFNILASRSFFQDFDKGDDGEIYKCKMHDIVHDFAQYLCRNEC 378
E+ ++S +G+ ++ +HD+ DF ++
Sbjct: 412 EDILQEFVNKSLLF---CDRNGKSFRYYLHDLQVDFLTEKNCSQL 453
|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Length = 115 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 725 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 99.96 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.89 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.87 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.86 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.86 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 99.86 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.86 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.85 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.85 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.85 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.85 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.85 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.85 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.85 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.84 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.84 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.84 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.84 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.84 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.83 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.83 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.83 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.83 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.82 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.82 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.82 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.82 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.82 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.81 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.81 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.81 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.81 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.8 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.8 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.8 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.8 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.8 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.8 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.8 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.8 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.79 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.79 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.79 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.78 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.78 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.77 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.77 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.76 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.76 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.76 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.76 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.76 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.75 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.75 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.75 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.74 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.74 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 99.74 | |
| 3qfl_A | 115 | MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- | 99.74 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.73 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.73 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.72 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.72 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.71 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.71 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.7 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.7 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.69 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.68 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.67 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.67 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.67 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.66 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.66 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.64 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.64 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.63 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.63 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.63 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.62 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.62 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.62 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.61 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.6 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.6 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.58 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.57 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.56 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.55 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.54 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.54 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.53 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.53 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.51 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.5 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.49 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.49 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.48 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.48 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.48 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.46 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.46 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.44 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.42 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.41 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.41 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.37 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.37 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.36 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.36 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.35 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.35 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.32 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.32 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.32 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.31 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.29 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.29 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.29 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.26 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.24 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.19 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.17 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.16 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.15 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.14 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.13 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.13 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.13 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.11 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.08 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.07 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.05 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.03 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.03 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.0 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.99 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.98 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.86 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.86 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.8 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.8 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.79 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.76 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.74 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.47 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.47 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.45 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.42 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.39 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.32 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.2 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.2 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 97.92 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.89 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.77 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.7 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.63 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.58 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 97.54 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 97.51 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 97.47 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 97.45 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.4 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 97.34 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.32 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.28 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.16 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.14 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.02 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.01 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.98 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 96.89 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 96.85 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 96.62 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.36 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 96.29 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 96.13 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 96.09 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.05 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 95.98 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 95.92 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 95.85 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 95.78 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.77 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 95.75 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 95.63 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.58 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 95.58 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 95.55 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 95.54 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 95.52 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 95.49 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 95.49 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 95.43 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 95.41 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 95.39 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 95.37 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 95.26 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 95.26 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 95.25 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 95.15 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 95.14 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 95.09 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 95.05 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 94.95 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 94.93 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 94.91 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 94.89 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 94.83 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 94.73 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 94.67 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 94.66 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 94.65 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 94.53 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 94.52 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 94.48 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 94.47 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 94.46 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 94.45 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 94.44 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 94.43 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 94.42 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 94.39 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 94.37 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 94.34 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 94.34 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 94.32 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 94.32 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 94.29 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 94.28 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 94.28 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 94.27 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 94.25 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 94.25 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 94.2 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 94.19 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 94.18 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 94.17 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 94.17 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 94.13 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 94.07 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 94.07 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 94.06 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 94.05 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 94.03 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 94.01 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 94.01 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 93.96 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 93.96 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 93.95 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 93.94 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 93.93 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 93.91 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 93.88 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 93.87 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 93.87 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 93.87 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 93.8 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 93.78 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 93.77 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 93.76 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 93.73 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 93.71 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 93.7 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 93.68 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 93.64 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 93.62 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 93.61 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 93.6 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 93.59 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 93.58 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 93.58 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 93.55 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 93.53 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 93.51 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 93.5 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 93.49 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 93.47 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 93.45 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 93.44 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 93.4 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 93.4 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 93.39 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 93.36 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 93.35 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 93.31 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 93.31 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 93.31 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 93.3 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.3 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 93.27 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 93.27 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 93.25 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 93.24 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 93.19 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 93.18 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 93.18 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 93.16 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 93.14 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 93.13 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 93.05 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 93.03 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 92.99 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 92.99 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 92.97 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 92.96 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 92.95 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 92.9 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 92.87 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 92.87 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 92.85 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 92.85 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 92.84 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 92.78 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 92.67 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 92.66 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 92.66 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 92.65 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 92.65 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 92.63 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 92.62 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 92.6 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 92.56 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 92.48 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 92.47 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 92.46 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 92.45 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 92.45 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 92.44 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 92.41 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 92.41 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 92.39 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 92.35 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 92.33 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 92.33 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.3 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 92.29 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 92.27 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 92.25 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 92.25 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 92.25 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 92.2 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 92.16 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 92.16 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 92.15 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 92.08 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 92.08 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 92.07 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 92.07 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 92.05 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 92.0 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 91.98 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 91.87 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 91.86 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 91.85 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 91.83 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 91.82 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 91.8 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 91.79 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 91.79 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 91.78 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 91.75 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 91.69 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 91.69 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 91.68 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 91.65 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 91.56 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 91.55 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 91.55 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 91.53 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 91.5 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 91.49 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 91.49 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 91.48 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 91.45 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 91.44 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 91.41 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 91.36 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 91.32 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 91.32 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 91.28 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 91.26 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 91.26 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 91.26 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 91.19 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 91.16 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 91.15 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 91.08 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 91.07 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 91.07 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 90.97 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 90.94 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 90.9 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 90.87 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 90.75 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 90.71 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 90.68 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 90.64 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 90.56 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 90.46 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 90.4 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 90.37 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 90.35 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 90.34 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 90.33 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 90.28 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 90.25 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 90.21 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 90.19 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 90.18 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 90.17 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 90.17 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 90.17 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 90.09 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 90.0 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 89.96 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 89.87 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 89.83 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 89.82 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 89.79 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 89.79 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 89.76 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 89.75 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 89.67 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 89.63 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 89.53 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 89.52 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 89.5 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 89.45 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 89.41 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 89.35 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 89.25 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 89.22 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 89.19 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 89.18 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 89.18 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 89.17 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 89.15 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 89.13 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 89.12 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 89.11 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 89.11 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 89.06 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 89.03 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 89.01 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 88.83 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 88.79 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 88.78 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 88.77 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 88.72 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 88.68 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 88.66 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 88.65 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 88.64 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 88.57 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 88.54 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 88.53 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 88.53 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 88.49 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 88.47 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 88.42 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 88.4 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 88.36 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 88.3 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 88.3 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 88.3 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 88.26 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 88.2 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 88.13 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 88.12 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 88.09 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 88.09 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 88.09 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 88.06 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 87.99 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 87.97 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 87.95 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 87.95 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 87.86 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 87.82 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 87.78 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 87.77 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 87.74 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 87.7 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 87.66 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 87.65 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 87.62 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 87.62 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 87.62 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 87.61 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 87.6 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 87.57 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 87.57 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 87.53 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 87.51 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 87.5 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 87.5 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 87.49 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 87.45 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
Probab=99.96 E-value=8e-30 Score=285.11 Aligned_cols=188 Identities=19% Similarity=0.322 Sum_probs=156.2
Q ss_pred ccchhhHHHHHHHHhcCCCCCCCCCEEEEEEecCCCcHHHHHHHHhc--chhhhccccceeeeecCCCc--cHHHHHHHH
Q 036753 181 FGRPKEKKELVDRLLCEGSKEQKGPCIISLVGMGGIGKTTLAQFAYN--NDDVKKHFDERIWVCVSEPF--DEFRIARAV 256 (725)
Q Consensus 181 vG~~~~~~~l~~~L~~~~~~~~~~~~vi~i~G~gGiGKTtLa~~v~~--~~~~~~~F~~~~wv~vs~~~--~~~~l~~~i 256 (725)
|||+.++++|+++|.... ++.++||+||||||+||||||+.||+ +.+++.+|++++||+|++.+ ++..+++.|
T Consensus 131 ~GR~~~~~~l~~~L~~~~---~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~i 207 (549)
T 2a5y_B 131 YIREYHVDRVIKKLDEMC---DLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDI 207 (549)
T ss_dssp CCCHHHHHHHHHHHHHHT---TSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHH
T ss_pred CCchHHHHHHHHHHhccc---CCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHH
Confidence 699999999999997642 34689999999999999999999998 67899999999999999985 899999999
Q ss_pred HHHhcCCCC---------C-----------------C---------------h---------------------------
Q 036753 257 IEALKSGDA---------S-----------------N---------------F--------------------------- 268 (725)
Q Consensus 257 ~~~l~~~~~---------~-----------------~---------------W--------------------------- 268 (725)
+.++..... . . |
T Consensus 208 l~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~~~~~~~gs~ilvTTR~~~v~~~~~~~~~~ 287 (549)
T 2a5y_B 208 LLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEF 287 (549)
T ss_dssp HHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHHHTTCEEEEEESBGGGGGGCCSCEEE
T ss_pred HHHHhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhhcccccCCCEEEEEcCCHHHHHHcCCCCeE
Confidence 998875410 0 0 1
Q ss_pred ---------------------------------------------------------------------hhhhhhhhhhh
Q 036753 269 ---------------------------------------------------------------------EAIEKGLLAPL 279 (725)
Q Consensus 269 ---------------------------------------------------------------------~~~~~~i~~~L 279 (725)
......+.++|
T Consensus 288 ~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~w~~~~~l~~~l~~~~~~~i~~~l 367 (549)
T 2a5y_B 288 IEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECIT 367 (549)
T ss_dssp EECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTTCCCS
T ss_pred EECCCCCHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHhCCChHHHHHHHHHhccchHHHHHHhHHHhhcccHHHHHHHH
Confidence 00224577889
Q ss_pred hhcccCCchhhhhhhh-----------hcccCCCCCccCHHHHHHHHHHc--CCcccCC-CccHHHHHHHHHHHHHhCCC
Q 036753 280 LLSYNELPSKVKRCFS-----------YCAVFPKDYGIRKHKLIELWMAQ--GYLSEKG-AKEMEDIGEEYFNILASRSF 345 (725)
Q Consensus 280 ~lSy~~L~~~lk~cfl-----------~~~~Fp~~~~i~~~~Li~~Wia~--g~i~~~~-~~~~e~~~~~~~~~L~~~~l 345 (725)
++||++||.++|.||+ |||+||+++.|+ +++|+|+ ||+...+ +.+++++++ ||++|+++||
T Consensus 368 ~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsL 442 (549)
T 2a5y_B 368 PYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGA 442 (549)
T ss_dssp SSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CCCTHHHHH-HHHHTTTBSS
T ss_pred hcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHHcCC
Confidence 9999999999999999 999999999999 8999999 9998776 677899998 9999999999
Q ss_pred cccccCCCCCceeEeecchhHHHHHHHhhcccce
Q 036753 346 FQDFDKGDDGEIYKCKMHDIVHDFAQYLCRNECL 379 (725)
Q Consensus 346 l~~~~~~~~~~~~~~~mhdl~~dla~~i~~~e~~ 379 (725)
++....+ ...+|+|||++|++|++++.++++
T Consensus 443 l~~~~~~---~~~~~~mHdlv~~~a~~~~~~~~~ 473 (549)
T 2a5y_B 443 LLSGKRM---PVLTFKIDHIIHMFLKHVVDAQTI 473 (549)
T ss_dssp CSEEECS---SSCEEECCHHHHHHHHTTSCTHHH
T ss_pred eeEecCC---CceEEEeChHHHHHHHHHHHHHHH
Confidence 9987653 345799999999999999988764
|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 725 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 2e-15 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 6e-05 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 1e-04 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 0.002 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 75.2 bits (184), Expect = 2e-15
Identities = 16/106 (15%), Positives = 35/106 (33%), Gaps = 5/106 (4%)
Query: 161 STERADQRGPSISSIDVSEIFGRPKEKKELVDRLLCEGSKEQKGPCIISLVGMGGIGKTT 220
S + D++ + + R ++ +L + + L G G GK+
Sbjct: 3 SRQMLDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSF---FLFLHGRAGSGKSV 59
Query: 221 LAQFAYNNDD--VKKHFDERIWVCVSEPFDEFRIARAVIEALKSGD 264
+A A + D + ++D +W+ S + L
Sbjct: 60 IASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKS 105
|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 725 | |||
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.82 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 99.75 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.7 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.7 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.69 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.67 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.64 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.61 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.57 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.56 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.55 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.45 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.45 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.44 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.42 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.41 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.41 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.4 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.34 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.33 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.31 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.26 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.22 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.22 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.19 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.14 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.14 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.91 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.91 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.87 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.76 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.68 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.65 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.65 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.62 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.46 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.36 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.68 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.62 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.38 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 97.31 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.28 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.93 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 96.78 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 96.74 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.67 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.64 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.56 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 96.55 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.54 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.52 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.41 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.37 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 96.26 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.16 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.12 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.09 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.05 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.94 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 95.93 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.92 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.91 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 95.79 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 95.68 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.64 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 95.62 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.55 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 95.47 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.45 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 95.44 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 95.4 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.39 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.36 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.34 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 95.34 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 95.28 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.28 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 95.15 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.11 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.07 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.03 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 94.93 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 94.89 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 94.82 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 94.74 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 94.71 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 94.7 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 94.67 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.66 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 94.55 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 94.42 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 94.1 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 94.06 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 93.91 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 93.87 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 93.81 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 93.77 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 93.69 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 93.69 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 93.67 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 93.59 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 93.58 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 93.43 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 93.24 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 93.17 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 93.05 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 92.92 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 92.78 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.76 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 92.73 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 92.71 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 92.66 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 92.66 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 92.61 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 92.55 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 92.52 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 92.46 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 92.43 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 92.4 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 92.37 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 92.35 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 92.35 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 92.35 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 92.34 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 92.31 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 92.28 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 92.26 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 92.2 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 92.2 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 92.16 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 92.02 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 92.01 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 92.01 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 91.81 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 91.75 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 91.59 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 91.54 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 91.45 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 91.42 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 91.2 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 91.09 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 91.08 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 91.08 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 91.0 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 90.99 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.98 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 90.93 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 90.87 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 90.81 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 90.79 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 90.74 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 90.63 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 90.62 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 90.56 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 90.48 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 90.4 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 90.4 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 90.24 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 90.2 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 90.12 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 89.86 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 89.74 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 89.73 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 89.67 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 89.62 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 89.58 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 89.52 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 89.47 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 89.39 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 89.36 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 89.34 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 89.3 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 89.26 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 89.22 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 89.1 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 89.09 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 89.0 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 88.99 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 88.94 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 88.93 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 88.91 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 88.87 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 88.86 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 88.83 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 88.73 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 88.71 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 88.54 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 88.49 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 88.25 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 88.16 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 88.16 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 88.13 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 88.09 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 88.06 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 88.05 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 87.86 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 87.86 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 87.76 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 87.6 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 87.54 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 87.4 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 87.33 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 87.29 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 87.28 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 87.23 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 87.2 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 87.12 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 86.99 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 86.82 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 86.76 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 86.6 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 86.54 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 86.43 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 86.38 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 86.3 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 86.16 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 86.15 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 85.94 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 85.87 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 85.83 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 85.8 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 85.62 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 85.61 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 85.58 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 85.47 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 85.43 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 85.3 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 85.27 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 85.2 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 85.08 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 84.98 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 84.9 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 84.78 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 84.73 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 84.52 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 84.43 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 84.14 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 83.54 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 83.35 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 82.95 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 82.83 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 82.57 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 81.99 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 81.99 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 81.78 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 81.68 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 81.68 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 81.39 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 81.14 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 80.81 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 80.8 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 80.34 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 80.2 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 80.08 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.82 E-value=8.4e-21 Score=194.77 Aligned_cols=257 Identities=18% Similarity=0.189 Sum_probs=187.7
Q ss_pred ccccEEEeccCCccccccchhHHhhcCCcceEEEeccccCCCc-cccccccccccccCccccEEEeecCCCccccchhhh
Q 036753 424 RGLRSLLVKSDEYSWSSEGLPQLFEKLTCLRALELQVRESWPR-NSLIKEIPTNIEKLLHLKYLNLKGQKKIENLPETLC 502 (725)
Q Consensus 424 ~~L~~L~l~~~~~~~~~~~~~~~~~~l~~Lr~L~L~~~~~~~~-~~~~~~lp~~i~~l~~Lr~L~L~~~~~i~~lp~~i~ 502 (725)
.+++.|++.++.+..... +|..+.++++|++|+|+ + +.+.+.+|.+|++|++|++|+|++|......|..+.
T Consensus 50 ~~v~~L~L~~~~l~g~~~-lp~~l~~L~~L~~L~Ls------~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~ 122 (313)
T d1ogqa_ 50 YRVNNLDLSGLNLPKPYP-IPSSLANLPYLNFLYIG------GINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLS 122 (313)
T ss_dssp CCEEEEEEECCCCSSCEE-CCGGGGGCTTCSEEEEE------EETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGG
T ss_pred EEEEEEECCCCCCCCCCC-CChHHhcCccccccccc------cccccccccccccccccccchhhhcccccccccccccc
Confidence 357778888876643322 67778999999999998 6 454457899999999999999999984444566788
Q ss_pred cCCCCcEeecCCCcccccccccccCCCcCcEEecCCCcccccCCcccCCCccC-cccCeEEEcCcCCCccCccccccCCC
Q 036753 503 ELYNLECLNVDDCQNLRELPRGIGKLRKLMYLHNEDTGCLRYLPAGIGELIRL-RRVREFVVGGGYDRACSLGSLKKLNF 581 (725)
Q Consensus 503 ~L~~L~~L~l~~~~~l~~lp~~i~~L~~L~~L~l~~~~~~~~lp~~i~~l~~L-~~L~~~~~~~~~~~~~~~~~L~~L~~ 581 (725)
.+.+|+++++++|.....+|..+.++++|+++++++|.....+|..++.+..+ +.+....+... +.....+..+..
T Consensus 123 ~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~---~~~~~~~~~l~~ 199 (313)
T d1ogqa_ 123 QIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLT---GKIPPTFANLNL 199 (313)
T ss_dssp GCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEE---EECCGGGGGCCC
T ss_pred chhhhcccccccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccc---cccccccccccc
Confidence 89999999999988777888889999999999999887666788888877766 44443332222 112223344432
Q ss_pred CCceEEeCcCCCCChhhhhhhccccccccCcEEEEecCCCCCCcccccCCCCCchhHHHHhhhcCCCCCCCcEEEeeecC
Q 036753 582 LQQCGIRGLGGVSDAGEAARAELEKKKYLLKLGLHFDRIRDGDEEQAGRRENEEDEDERLLEALGPPPNLKNLGIDEYRG 661 (725)
Q Consensus 582 L~~L~i~~~~~~~~~~~~~~~~l~~~~~L~~L~L~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~L~~~~~ 661 (725)
+ .+.+.... ........+..+++|+.|+++.+.+.. .+..+..+++|+.|+|++|.+
T Consensus 200 ~-~l~l~~~~----~~~~~~~~~~~~~~l~~l~~~~~~l~~------------------~~~~~~~~~~L~~L~Ls~N~l 256 (313)
T d1ogqa_ 200 A-FVDLSRNM----LEGDASVLFGSDKNTQKIHLAKNSLAF------------------DLGKVGLSKNLNGLDLRNNRI 256 (313)
T ss_dssp S-EEECCSSE----EEECCGGGCCTTSCCSEEECCSSEECC------------------BGGGCCCCTTCCEEECCSSCC
T ss_pred c-cccccccc----ccccccccccccccccccccccccccc------------------cccccccccccccccCccCee
Confidence 2 23333211 112223455677899999998887321 134567789999999999998
Q ss_pred CCCCcccccccCccccceeEEcCCCCCCcCCCCCCccccceeecccccCceEeC
Q 036753 662 RRNVVPKNWFMSLTNLRDLSLFWWSNCEHLPPLGKLKSLESLLIYGMQSVKRVG 715 (725)
Q Consensus 662 ~~~~~~p~~l~~l~~L~~L~L~~c~~~~~lp~l~~lp~L~~L~L~~~~~l~~i~ 715 (725)
... + |.+++++++|++|+|++|...+.+|.++.|.+|+.+++.+|+.+...|
T Consensus 257 ~g~-i-P~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~p 308 (313)
T d1ogqa_ 257 YGT-L-PQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSP 308 (313)
T ss_dssp EEC-C-CGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTT
T ss_pred ccc-C-ChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCC
Confidence 742 6 999999999999999999766689999999999999999998665544
|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|