Citrus Sinensis ID: 036759

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
NRKILPPGPKGFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEFLKTHDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLGKKRSDDEFDERGFET
cccccccccccccccccccccccccHHHHHHHHHHHcccEEEEcccccEEEEccHHHHHHHHHcccccccccccccccHHHcccccEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHcccccccccccccccc
cccccccccccccEEccHHHcccccHHHHHHHHHHcccEEEEEcccccEEEEEcHHHHHHHHHcccHHccccccHHHHHEEEccccEEEccccHHHHHHHHHHHHHHHcHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccccccccc
nrkilppgpkgfpivgclhllgkfppraLHKLAKIYGPIMHLRLGLMTTIVVSspqaaeflkthdlifasrpplqatKYISYQQKnfamapygSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVlgkkrsddefdergfet
nrkilppgpkgFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEFLKTHDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRmvlgkkrsddefdergfet
NRKILPPGPKGFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEFLKTHDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLGKKRSDDEFDERGFET
**********GFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEFLKTHDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVL****************
**KILPPGPKGFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEFLKTHDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYF*********VDISAKLSAVSANMTCRMVLGKKRS***********
NRKILPPGPKGFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEFLKTHDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLGKKR************
****LPPGPKGFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEFLKTHDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLGKKR************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NRKILPPGPKGFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEFLKTHDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLGKKRSDDEFDERGFET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query176 2.2.26 [Sep-21-2011]
O81974 504 Cytochrome P450 71D8 OS=G no no 0.926 0.323 0.447 8e-35
A6YIH8 502 Premnaspirodiene oxygenas N/A no 0.931 0.326 0.410 2e-33
Q9LVD2 502 Cytochrome P450 71B10 OS= yes no 0.886 0.310 0.407 6e-33
P93531 500 Cytochrome P450 71D7 OS=S N/A no 0.943 0.332 0.398 1e-32
Q9LTM2 499 Cytochrome P450 71B21 OS= no no 0.937 0.330 0.409 4e-32
C0SJS4 476 Psoralen synthase (Fragme N/A no 0.937 0.346 0.392 9e-32
Q9LTM1 500 Cytochrome P450 71B22 OS= no no 0.937 0.33 0.421 1e-31
D5JBW9 488 Germacrene A oxidase OS=S N/A no 0.960 0.346 0.431 2e-31
Q9LIP3 500 Cytochrome P450 71B37 OS= no no 0.886 0.312 0.394 2e-31
Q50EK4 525 Cytochrome P450 750A1 OS= N/A no 0.965 0.323 0.448 2e-31
>sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 Back     alignment and function desciption
 Score =  146 bits (368), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 76/170 (44%), Positives = 106/170 (62%), Gaps = 7/170 (4%)

Query: 5   LPPGPKGFPIVGCLH---LLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAA-EF 60
           LPPGP   PI+G LH   L    P +AL KL + YGP+MHL+LG ++T+VVSSP+ A E 
Sbjct: 33  LPPGPWRLPIIGNLHQLALAASLPDQALQKLVRKYGPLMHLQLGEISTLVVSSPKMAMEM 92

Query: 61  LKTHDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIR 120
           +KTHD+ F  RP L A +++ Y   + A APYG YWR+IRK+CT  LL+  ++  F  IR
Sbjct: 93  MKTHDVHFVQRPQLLAPQFMVYGATDIAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIR 152

Query: 121 KEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLGKKRSD-DEF 169
           ++E   LI+    +A +P  +D+S KL ++      R   GK+  D DEF
Sbjct: 153 QDENKKLIQSIHSSAGSP--IDLSGKLFSLLGTTVSRAAFGKENDDQDEF 200

Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 Back     alignment and function description
>sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 Back     alignment and function description
>sp|Q9LTM2|C71BL_ARATH Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=3 SV=1 Back     alignment and function description
>sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LTM1|C71BM_ARATH Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1 Back     alignment and function description
>sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 Back     alignment and function description
>sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 Back     alignment and function description
>sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
255582520 505 flavonoid 3-hydroxylase, putative [Ricin 1.0 0.348 0.677 4e-66
224093820 296 cytochrome P450 [Populus trichocarpa] gi 0.988 0.587 0.668 3e-64
224093826 493 cytochrome P450 [Populus trichocarpa] gi 0.988 0.352 0.668 6e-64
224093840 497 cytochrome P450 [Populus trichocarpa] gi 0.971 0.344 0.645 3e-61
356511127 536 PREDICTED: cytochrome P450 71A1-like [Gl 0.982 0.322 0.632 3e-61
224093824 497 cytochrome P450 [Populus trichocarpa] gi 0.971 0.344 0.639 1e-60
224093842 497 cytochrome P450 [Populus trichocarpa] gi 0.971 0.344 0.645 5e-60
224093838 497 cytochrome P450 [Populus trichocarpa] gi 0.971 0.344 0.645 5e-60
449504852 501 PREDICTED: cytochrome P450 750A1-like [C 0.971 0.341 0.616 4e-57
449451489 501 PREDICTED: cytochrome P450 750A1-like [C 0.971 0.341 0.616 4e-57
>gi|255582520|ref|XP_002532045.1| flavonoid 3-hydroxylase, putative [Ricinus communis] gi|223528288|gb|EEF30335.1| flavonoid 3-hydroxylase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 120/177 (67%), Positives = 145/177 (81%), Gaps = 1/177 (0%)

Query: 1   NRKILPPGPKGFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAE- 59
           N K LPPGP+GFPI G LHLLGK+P R LH+LA+ YGPIMHLRLGL++TIVVSSPQAAE 
Sbjct: 35  NNKKLPPGPRGFPIFGSLHLLGKYPHRELHRLAQKYGPIMHLRLGLVSTIVVSSPQAAES 94

Query: 60  FLKTHDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPI 119
           FLKTHDL FASRPP QA K+ISY+QKN + APYGSYWR +RK+CT  LL+N K+N F+ +
Sbjct: 95  FLKTHDLAFASRPPHQAAKFISYEQKNLSFAPYGSYWRNVRKMCTLELLSNVKVNSFKSM 154

Query: 120 RKEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLGKKRSDDEFDERGFET 176
           RKEELDLLI+  K A+     VD+SAK++++SA+M+CRMV GKK  D EFDERGF+ 
Sbjct: 155 RKEELDLLIDCIKNASCQRVAVDLSAKVASLSADMSCRMVFGKKYMDKEFDERGFKA 211

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224093820|ref|XP_002310005.1| cytochrome P450 [Populus trichocarpa] gi|222852908|gb|EEE90455.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224093826|ref|XP_002310008.1| cytochrome P450 [Populus trichocarpa] gi|222852911|gb|EEE90458.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224093840|ref|XP_002310015.1| cytochrome P450 [Populus trichocarpa] gi|222852918|gb|EEE90465.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356511127|ref|XP_003524281.1| PREDICTED: cytochrome P450 71A1-like [Glycine max] Back     alignment and taxonomy information
>gi|224093824|ref|XP_002310007.1| cytochrome P450 [Populus trichocarpa] gi|222852910|gb|EEE90457.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224093842|ref|XP_002310016.1| cytochrome P450 [Populus trichocarpa] gi|222852919|gb|EEE90466.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224093838|ref|XP_002310014.1| cytochrome P450 [Populus trichocarpa] gi|222852917|gb|EEE90464.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449504852|ref|XP_004162312.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449451489|ref|XP_004143494.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
TAIR|locus:2093531 501 CYP71B23 ""cytochrome P450, fa 0.971 0.341 0.450 8.5e-33
TAIR|locus:2093521 500 CYP71B22 ""cytochrome P450, fa 0.937 0.33 0.421 6e-32
TAIR|locus:2165595 502 CYP71B10 ""cytochrome P450, fa 0.886 0.310 0.407 2.1e-31
TAIR|locus:2031900 502 CYP71B2 ""cytochrome P450, fam 0.937 0.328 0.415 8.5e-31
TAIR|locus:2093541 499 CYP71B21 ""cytochrome P450, fa 0.937 0.330 0.409 3.1e-30
TAIR|locus:2079316 500 CYP71B37 ""cytochrome P450, fa 0.886 0.312 0.394 3.2e-30
TAIR|locus:2179280 496 CYP71B12 ""cytochrome P450, fa 0.909 0.322 0.391 8.7e-30
TAIR|locus:504955640 490 CYP71A22 ""cytochrome P450, fa 0.931 0.334 0.392 1e-29
TAIR|locus:2079311 500 CYP71B36 ""cytochrome P450, fa 0.886 0.312 0.388 1.6e-29
UNIPROTKB|Q6QNI4 494 CYP71AJ1 "Psoralen synthase" [ 0.937 0.334 0.392 1.9e-29
TAIR|locus:2093531 CYP71B23 ""cytochrome P450, family 71, subfamily B, polypeptide 23"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 358 (131.1 bits), Expect = 8.5e-33, P = 8.5e-33
 Identities = 78/173 (45%), Positives = 103/173 (59%)

Query:     5 LPPGPKGFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAE-FLKT 63
             LPPGP   PI+G LH L   P + L  L KI+GP+M L+LG +  +V+SS QAAE  LKT
Sbjct:    31 LPPGPPKLPIIGNLHYLNGLPHKCLLNLWKIHGPVMQLQLGYVPLVVISSNQAAEEVLKT 90

Query:    64 HDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEE 123
             HDL   SRP   A+K ISY  K+   APYG  WR +RKL    L +  K N F+ IR+EE
Sbjct:    91 HDLDCCSRPETIASKTISYNFKDIGFAPYGEEWRALRKLAVIELFSLKKFNSFRYIREEE 150

Query:   124 LDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLGKKRSDDEF-DERGFE 175
              DLL++   EA+     V++   L  +SA++ CR+  G+   + EF DE   E
Sbjct:   151 NDLLVKKLSEASEKQSPVNLKKALFTLSASIVCRLAFGQNLHESEFIDEDSME 203
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
GO:0045087 "innate immune response" evidence=RCA
TAIR|locus:2093521 CYP71B22 ""cytochrome P450, family 71, subfamily B, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165595 CYP71B10 ""cytochrome P450, family 71, subfamily B, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031900 CYP71B2 ""cytochrome P450, family 71, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093541 CYP71B21 ""cytochrome P450, family 71, subfamily B, polypeptide 21"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079316 CYP71B37 ""cytochrome P450, family 71, subfamily B, polypeptide 37"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179280 CYP71B12 ""cytochrome P450, family 71, subfamily B, polypeptide 12"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955640 CYP71A22 ""cytochrome P450, family 71, subfamily A, polypeptide 22"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079311 CYP71B36 ""cytochrome P450, family 71, subfamily B, polypeptide 36"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6QNI4 CYP71AJ1 "Psoralen synthase" [Ammi majus (taxid:48026)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CYP736A5v1
cytochrome P450 (289 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 1e-41
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 6e-38
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 3e-35
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-34
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 7e-33
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 2e-29
pfam00067 461 pfam00067, p450, Cytochrome P450 7e-25
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 4e-17
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 5e-17
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 2e-13
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 5e-13
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 1e-10
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 3e-09
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information 
 Score =  145 bits (367), Expect = 1e-41
 Identities = 65/162 (40%), Positives = 93/162 (57%), Gaps = 1/162 (0%)

Query: 3   KILPPGPKGFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQA-AEFL 61
             LPPGP  +PIVG L  LG  P R L  L K YGP+++LRLG +  I    P+   E L
Sbjct: 31  LRLPPGPPRWPIVGNLLQLGPLPHRDLASLCKKYGPLVYLRLGSVDAITTDDPELIREIL 90

Query: 62  KTHDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRK 121
              D +FASRP   A  +++Y   + A+AP G +W+++R++C ++LLT  ++  F   R 
Sbjct: 91  LRQDDVFASRPRTLAAVHLAYGCGDVALAPLGPHWKRMRRICMEHLLTTKRLESFAKHRA 150

Query: 122 EELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLGKK 163
           EE   LI+   EAA+    V++   L A S N   RM+LGK+
Sbjct: 151 EEARHLIQDVWEAAQTGKPVNLREVLGAFSMNNVTRMLLGKQ 192

Length = 514
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 176
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.98
PLN02687 517 flavonoid 3'-monooxygenase 99.96
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.95
PLN03234 499 cytochrome P450 83B1; Provisional 99.95
PTZ00404 482 cytochrome P450; Provisional 99.95
PLN02971 543 tryptophan N-hydroxylase 99.95
PLN03112 514 cytochrome P450 family protein; Provisional 99.95
PLN02966 502 cytochrome P450 83A1 99.95
PLN02655 466 ent-kaurene oxidase 99.95
PLN02394 503 trans-cinnamate 4-monooxygenase 99.94
PLN02183 516 ferulate 5-hydroxylase 99.94
PLN00168 519 Cytochrome P450; Provisional 99.94
PLN02290 516 cytokinin trans-hydroxylase 99.94
PLN03018 534 homomethionine N-hydroxylase 99.93
PLN02500 490 cytochrome P450 90B1 99.92
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.92
PLN02196 463 abscisic acid 8'-hydroxylase 99.92
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.92
PLN02774 463 brassinosteroid-6-oxidase 99.91
PLN02302 490 ent-kaurenoic acid oxidase 99.9
PLN02648 480 allene oxide synthase 99.89
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.89
PLN02936 489 epsilon-ring hydroxylase 99.89
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.89
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.89
PLN02738 633 carotene beta-ring hydroxylase 99.89
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.88
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.87
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.83
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.69
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.55
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.42
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.98  E-value=3.7e-31  Score=198.92  Aligned_cols=165  Identities=41%  Similarity=0.764  Sum_probs=148.4

Q ss_pred             CCCCCCCCCCCceecccccCCCC-chHHHHHHHHhhCCeEEEecCCeeEEEeccHHHHH-HHHhCCccccCCCc-hhhhh
Q 036759            2 RKILPPGPKGFPIVGCLHLLGKF-PPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAE-FLKTHDLIFASRPP-LQATK   78 (176)
Q Consensus         2 ~~~~ppgp~~~p~~G~~~~~~~~-~~~~~~~~~~~yg~i~~~~~~~~~~v~i~~~~~i~-vl~~~~~~~~~~~~-~~~~~   78 (176)
                      +.++||||+++|+|||++.+... ++..+.+|.++||||+++++|..++|||+|+++++ +|++++..|++|+. .....
T Consensus        24 ~~~lPPGP~~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~  103 (489)
T KOG0156|consen   24 RRNLPPGPPPLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLK  103 (489)
T ss_pred             CCCCCcCCCCCCccccHHHcCCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHH
Confidence            46899999999999999999876 99999999999999999999999999999999999 99999999999997 23445


Q ss_pred             HHhhcCcceEecCCChhHHHHHhhhhhhcCChHHHhhhhHHHHHHHHHHHHHHHHHhcCCCcccHHHHHHHHHhhhhhhh
Q 036759           79 YISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRM  158 (176)
Q Consensus        79 ~~~~~~~~~~~~~~g~~~~~~R~~~~~~~f~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~i~~~  158 (176)
                      .+..++.+++++.+|+.|+.+||++....++...++.+...-.++++++++.+.+ ...+.++|+...+..++.++|+++
T Consensus       104 ~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~-~~~~~~vdl~~~l~~~~~nvI~~~  182 (489)
T KOG0156|consen  104 YLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSK-SKKGEPVDLSELLDLLVGNVICRM  182 (489)
T ss_pred             HhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHh-cCCCceeeHHHHHHHHHHHHHHHH
Confidence            6665678999997899999999999977899999998888889999999999987 223378999999999999999999


Q ss_pred             hccccCCCc
Q 036759          159 VLGKKRSDD  167 (176)
Q Consensus       159 ~fG~~~~~~  167 (176)
                      +||.++++.
T Consensus       183 ~fG~rf~~~  191 (489)
T KOG0156|consen  183 LFGRRFEEE  191 (489)
T ss_pred             HhCCccccC
Confidence            999999974

>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
3qz1_A 496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 2e-09
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 2e-09
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 5e-08
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 2e-07
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 3e-07
3pm0_A 507 Structural Characterization Of The Complex Between 1e-06
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 2e-06
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 5e-06
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 8e-06
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 1e-05
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 4e-05
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 5e-05
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 5e-05
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 5e-05
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 5e-05
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 73/162 (45%), Gaps = 9/162 (5%)
Query: 5   LPPGPKGFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAEFLKTH 64
           LPP   GF     LHLL    P  L  L +  GP+  LRLGL   +V++S +  E     
Sbjct: 30  LPPLVPGF-----LHLLQPNLPIHLLSLTQKLGPVYRLRLGLQEVVVLNSKRTIEEAMIR 84
Query: 65  DLI-FASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEE 123
             + FA RP + + K +S + ++ ++  Y   W+  +KL    LL   + +  +P   + 
Sbjct: 85  KWVDFAGRPQIPSYKLVSQRCQDISLGDYSLLWKAHKKLTRSALLLGTR-SSMEPWVDQL 143
Query: 124 LDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLGKKRS 165
                E  +  A AP  V I  + S ++ ++ C +  G K  
Sbjct: 144 TQEFCERMRVQAGAP--VTIQKEFSLLTCSIICYLTFGNKED 183
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 9e-46
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 4e-43
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-37
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 5e-37
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-33
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-33
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 4e-32
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 3e-30
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-26
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 2e-25
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 7e-25
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-23
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-23
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 5e-23
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-22
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-22
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-20
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-19
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-17
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 7e-15
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 4e-13
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-12
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 6e-12
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-08
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 9e-08
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 7e-04
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score =  155 bits (394), Expect = 9e-46
 Identities = 30/169 (17%), Positives = 56/169 (33%), Gaps = 10/169 (5%)

Query: 5   LPPGPKGFPIVGCLHLLGKFPPRALH----KLAKIYGPIMHLRLGLMTTIVVSSPQAAE- 59
             P P     +   H   +     +H    +  + YGPI   +LG + ++ V  P+    
Sbjct: 10  EIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVAL 69

Query: 60  FLKTHDLIFASRPPLQATKYIS-YQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQP 118
             K+               Y   YQ+    +    + W+K R    Q ++       F P
Sbjct: 70  LFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFLP 129

Query: 119 IRKEE----LDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLGKK 163
           +        + +L    K+A       DIS  L   +      ++ G++
Sbjct: 130 LLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGER 178
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.96
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.96
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.96
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.95
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.95
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.95
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.95
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.95
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.94
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.94
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.94
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.94
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.94
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.93
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.93
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.92
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.92
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.92
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.92
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.91
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.91
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.91
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.9
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.89
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.89
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.87
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.87
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.87
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.86
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.86
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.85
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.84
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.84
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.83
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.82
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.82
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.82
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.81
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.8
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.8
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.79
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.78
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.78
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.75
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.75
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.75
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.75
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.75
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.74
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.74
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.73
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.73
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.73
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.72
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.72
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.71
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.71
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.71
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.68
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.68
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.68
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.67
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.67
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.66
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.65
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.65
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.64
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.63
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.62
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.61
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.56
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.56
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.54
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.5
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.49
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.29
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.83
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 82.06
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
Probab=99.96  E-value=5.8e-29  Score=188.51  Aligned_cols=162  Identities=24%  Similarity=0.352  Sum_probs=136.3

Q ss_pred             CCCCCCCCCCCceecccccCC--CCchHHHHHHHHhhCCeEEEecCCeeEEEeccHHHHH-HHHhCCccccCCCchhhhh
Q 036759            2 RKILPPGPKGFPIVGCLHLLG--KFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAE-FLKTHDLIFASRPPLQATK   78 (176)
Q Consensus         2 ~~~~ppgp~~~p~~G~~~~~~--~~~~~~~~~~~~~yg~i~~~~~~~~~~v~i~~~~~i~-vl~~~~~~~~~~~~~~~~~   78 (176)
                      ..+.||||+++|++||++.+.  +.++..+.+|+++|||||++++|+.++++++||++++ +|.++...|.+++......
T Consensus         6 ~~~~PPgP~~lPliGnl~~l~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~~k~il~~~~~~f~~rp~~~~~~   85 (494)
T 3swz_A            6 GAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLD   85 (494)
T ss_dssp             ------CCBCCCEEEEESSCTTSSCHHHHHHHTHHHHCSEEEEEETTEEEEEECSHHHHHHHHTTTTTTTBBCCCCHHHH
T ss_pred             CCCCCCCCCCCCeEcchHHhCCCCchhHHHHHHHHHcCCEEEEEeCCCCEEEECCHHHHHHHHHhCcHhhCCCCCcHHHH
Confidence            456899999999999998875  3578899999999999999999999999999999999 9998888899888765555


Q ss_pred             HHhhcCcceEecCCChhHHHHHhhhhhhcCCh--HHHhhhhHHHHHHHHHHHHHHHHHhcCCCcccHHHHHHHHHhhhhh
Q 036759           79 YISYQQKNFAMAPYGSYWRKIRKLCTQNLLTN--AKINYFQPIRKEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTC  156 (176)
Q Consensus        79 ~~~~~~~~~~~~~~g~~~~~~R~~~~~~~f~~--~~l~~~~~~i~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~i~  156 (176)
                      .....+.+++++++|+.|+.+|+++. ++|+.  ..+..+.+.+.+++..+++.+.+.  .+.++|+..++..+++|+|+
T Consensus        86 ~~~~~~~gl~~~~~g~~wr~~Rr~~~-~~f~~~~~~~~~~~~~i~~~~~~l~~~l~~~--~~~~vd~~~~~~~~t~dvi~  162 (494)
T 3swz_A           86 IASNNRKGIAFADSGAHWQLHRRLAM-ATFALFKDGDQKLEKIICQEISTLCDMLATH--NGQSIDISFPVFVAVTNVIS  162 (494)
T ss_dssp             HHTTTTCSSSSSCSSHHHHHHHHHHH-HHTTTTSSSTTCHHHHHHHHHHHHHHHHHHT--TTEEECCHHHHHHHHHHHHH
T ss_pred             HhccCCCCeEeCCCCHHHHHHHHHHH-HHHHHhcchHHHHHHHHHHHHHHHHHHHHHc--CCCcccHHHHHHHHHHHHHH
Confidence            55544567777767999999999998 98874  456789999999999999999764  56789999999999999999


Q ss_pred             hhhccccCCC
Q 036759          157 RMVLGKKRSD  166 (176)
Q Consensus       157 ~~~fG~~~~~  166 (176)
                      .++||.+++.
T Consensus       163 ~~~fG~~~~~  172 (494)
T 3swz_A          163 LICFNTSYKN  172 (494)
T ss_dssp             HHHHSCCCCT
T ss_pred             HHHcCCcCCC
Confidence            9999998864
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 176
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 6e-30
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 4e-29
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 4e-28
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 5e-26
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 4e-24
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 1e-22
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-14
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 2e-11
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 9e-10
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  111 bits (278), Expect = 6e-30
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 8/174 (4%)

Query: 6   PPGPKGFPIVGCLHLLGK---FPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAA-EFL 61
           PPGP G P +G ++ L      P   + K +++YG I  L LG ++T+V++      E L
Sbjct: 1   PPGPPGLPFIGNIYSLAASSELPHVYMRKQSQVYGEIFSLDLGGISTVVLNGYDVVKECL 60

Query: 62  KTHDLIFASRPPLQATKYISYQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINY-FQPIR 120
                IFA RP L     ++        + YG  W   R+L   +          F+   
Sbjct: 61  VHQSEIFADRPCLPLFMKMTK-MGGLLNSRYGRGWVDHRRLAVNSFRYFGYGQKSFESKI 119

Query: 121 KEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLGKKRSDDEFDERGF 174
            EE     +  +     P   D    ++   +N+T  ++ G++ + ++ D +  
Sbjct: 120 LEETKFFNDAIETYKGRP--FDFKQLITNAVSNITNLIIFGERFTYEDTDFQHM 171
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.96
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.95
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.93
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.93
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.91
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.91
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.85
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.82
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.74
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.68
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.65
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.64
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.63
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.54
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.53
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.41
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.39
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.33
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.26
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.24
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.86
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 90.8
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=6.3e-29  Score=184.97  Aligned_cols=158  Identities=19%  Similarity=0.317  Sum_probs=135.8

Q ss_pred             CCCCCCCCCceecccccCCCCchHHHHHHHHhhCCeEEEecCCeeEEEeccHHHHH-HHHhCCcc-ccCCCchhhhhHHh
Q 036759            4 ILPPGPKGFPIVGCLHLLGKFPPRALHKLAKIYGPIMHLRLGLMTTIVVSSPQAAE-FLKTHDLI-FASRPPLQATKYIS   81 (176)
Q Consensus         4 ~~ppgp~~~p~~G~~~~~~~~~~~~~~~~~~~yg~i~~~~~~~~~~v~i~~~~~i~-vl~~~~~~-~~~~~~~~~~~~~~   81 (176)
                      +.+|||+++|++||++.+.++++.++.+++++|||||++++++.++|+|+||++++ +|.++... +..+.....   ..
T Consensus         9 ~~iPGP~~~P~iG~~~~~~~~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~~---~~   85 (472)
T d1tqna_           9 LGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGP---VG   85 (472)
T ss_dssp             TTCCCCCCBTTTBTGGGGGGCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCSC---CG
T ss_pred             cCCCCCCCcCceeEHHHhhCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCccccc---cc
Confidence            45689999999999999989999999999999999999999999999999999999 99766433 333332221   12


Q ss_pred             hcCcceEecCCChhHHHHHhhhhhhcCChHHHhhhhHHHHHHHHHHHHHHHHHhcCCCcccHHHHHHHHHhhhhhhhhcc
Q 036759           82 YQQKNFAMAPYGSYWRKIRKLCTQNLLTNAKINYFQPIRKEELDLLIEYFKEAARAPCVVDISAKLSAVSANMTCRMVLG  161 (176)
Q Consensus        82 ~~~~~~~~~~~g~~~~~~R~~~~~~~f~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~i~~~~fG  161 (176)
                      ..+.++++++ |+.|+.+|++++ +.|+...++.+.+.+.+.++.+++.|.+.+..+..+|+.+++.++++++++.++||
T Consensus        86 ~~~~~i~~~~-g~~~~~~R~~~~-~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~dl~~~~~~~~~~v~~~~~~G  163 (472)
T d1tqna_          86 FMKSAISIAE-DEEWKRLRSLLS-PTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFG  163 (472)
T ss_dssp             GGGGSTTTCC-HHHHHHHHHHTT-GGGSHHHHHTTHHHHHHHHHHHHHHHHHHHHHSSCEEHHHHHHHHHHHHHHHTSSC
T ss_pred             ccCCceeccC-cHHHHHhhhhcC-ccccchhhhcccchhhhhhhcccccccccccccccchhhhhhhccchhhhhheecc
Confidence            2245666665 999999999998 99999999999999999999999999887667788999999999999999999999


Q ss_pred             ccCCC
Q 036759          162 KKRSD  166 (176)
Q Consensus       162 ~~~~~  166 (176)
                      .+++.
T Consensus       164 ~~~~~  168 (472)
T d1tqna_         164 VNIDS  168 (472)
T ss_dssp             CCCCG
T ss_pred             ccccc
Confidence            99874
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure