Citrus Sinensis ID: 036865

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-
MAQHFSKRTPLVLAFICVLPFARPFTVIMQDSGGSSGLVDGPQTGFSMNKDGARTEPKEQEAVYDIMRATGNDWATEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPTRSHISRSITKLPYLRTLFFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLMDLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPITIPNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSELRLNNNGLTGPLPFEREMVWKMKSKLRLHNNSGLCYNAGSDFEDGLDSSIDSGIGLCESGKPGSANSVQHLGTLEENITGTINTSV
ccccccccHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccEEcccccccEEEEEEcccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccccccccccHHcccccccEEEcccccccccccHHccccccccEEccccccccccccccccccccccEEEccccccccccccccHHHcHHHHHHHHccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccc
cHHHHHHHHHHHHHHHHHcHccccEEEEEccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHccccccccccccccccEEEEEEcccccccccccccHHccccHHHHHHHcccccccccHHHcccccccEEEEccccccccccccHHHHHHcHHccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHHccEEEcccccccccEEEEEccccccccccHHHcccccccEEEccccccccccccccHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccHHHHHHHHccccccccccccccccccEEEcccccccccccccc
maqhfskrtPLVLAFICvlpfarpftvimqdsggssglvdgpqtgfsmnkdgartepkeQEAVYDIMRATgndwateipdvcrgrwhgiecmpdkenVYHVVSLMFgalsddtafptcdptrshisrsitklpylrtLFFYRcfthnpqpipafLGQLGQTLQTLVLrengnvgpipselgnltrlKVLDLHknnlngsipvslgringlrsldlsgnkltgsipsisfpvlnVLDLNQNLLMDLILLDlsynhlsgpfpisIRNLNSLQALILKsnsmgpitipnysfiGMRNLMILILSNmnlrgpipeslgqlpnlhvlhldenhlngsipnsfknLKHVSELRlnnngltgplpfEREMVWKMKSKLRlhnnsglcynagsdfedgldssidsgiglcesgkpgsansvqhlgtleenitgtintsv
maqhfskrtplVLAFICVLPFARPFTVIMQDSGGSSGLVDGPQTGfsmnkdgartepKEQEAVYDIMRAtgndwateipDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTcdptrshisrsitklpYLRTLFFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLMDLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPITIPNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSELRLnnngltgplPFEREMVWKMKSKLRLHNNSGLCYNAGSDFEDGLDSSIDSGIGLCESGKPGSANsvqhlgtleenitgtintsv
MAQHFSKRTPLVLAFICVLPFARPFTVIMQDSGGSSGLVDGPQTGFSMNKDGARTEPKEQEAVYDIMRATGNDWATEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPTRSHISRSITKLPYLRTLFFYRCFTHNPQPIPAFlgqlgqtlqtlVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVlnvldlnqnllmdlilldlSYNHLSGPFPISIRNLNSLQALILKSNSMGPITIPNYSFIGmrnlmililsnmnlrGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSELRLNNNGLTGPLPFEREMVWKMKSKLRLHNNSGLCYNAGSDFEDGLDSSIDSGIGLCESGKPGSANSVQHLGTLEENITGTINTSV
********TPLVLAFICVLPFARPFTVIMQ*******************************AVYDIMRATGNDWATEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPTRSHISRSITKLPYLRTLFFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLMDLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPITIPNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSELRLNNNGLTGPLPFEREMVWKMKSKLRLHNNSGLCYNAGSDFE*******************************************
******KRTPLVLAFICVLPFARPFTVIMQDSGGSSGLVDG********************AVYDIMRATGNDWATEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPTRSHISRSITKLPYLRTLFFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLMDLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPITIPNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSELRLNNNGLTGPLPFEREMVWKMKSKLRLHNNSGLCYNAGSDFEDGLDSSIDSGIGLCESGKPGSANSVQHLGTLEENITGTINTS*
MAQHFSKRTPLVLAFICVLPFARPFTVIMQDSGGSSGLVDGPQTGFSMNKDGARTEPKEQEAVYDIMRATGNDWATEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPTRSHISRSITKLPYLRTLFFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLMDLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPITIPNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSELRLNNNGLTGPLPFEREMVWKMKSKLRLHNNSGLCYNAGSDFEDGLDSSIDSGIGLCESGKPGSANSVQHLGTLEENITGTINTSV
MAQHFSKRTPLVLAFICVLPFARPFTVIMQDSGGSSGLVDGPQTGFSMNKDGARTEPKEQEAVYDIMRATGNDWATEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPTRSHISRSITKLPYLRTLFFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLMDLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPITIPNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSELRLNNNGLTGPLPFEREMVWKMKSKLRLHNNSGLCYNAGSDFEDGLDSSIDSGIGLCESGKPGSANSVQHLGTLEENITGTIN***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQHFSKRTPLVLAFICVLPFARPFTVIMQDSGGSSGLVDGPQTGFSMNKDGARTEPKEQEAVYDIMRATGNDWATEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPTRSHISRSITKLPYLRTLFFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLMDLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPITIPNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSELRLNNNGLTGPLPFEREMVWKMKSKLRLHNNSGLCYNAGSDFEDGLDSSIDSGIGLCESGKPGSANSVQHLGTLEENITGTINTSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query431 2.2.26 [Sep-21-2011]
Q9SSD1496 Protein TOO MANY MOUTHS O yes no 0.972 0.844 0.594 1e-153
Q5PP26424 Piriformospora indica-ins no no 0.749 0.761 0.307 2e-30
Q9LP24 1120 Probable leucine-rich rep no no 0.575 0.221 0.389 3e-27
C0LGG8 1038 Probable LRR receptor-lik no no 0.482 0.200 0.386 2e-25
C0LGQ5 1249 LRR receptor-like serine/ no no 0.522 0.180 0.375 3e-25
C0LGW6 966 LRR receptor-like serine/ no no 0.450 0.200 0.411 1e-24
Q42371 976 LRR receptor-like serine/ no no 0.505 0.223 0.385 2e-24
Q9LVP0 1102 Probable leucine-rich rep no no 0.505 0.197 0.371 5e-24
C0LGG9 1035 Probable LRR receptor-lik no no 0.452 0.188 0.385 6e-24
C0LGH3 1033 Probable LRR receptor-lik no no 0.473 0.197 0.359 2e-23
>sp|Q9SSD1|TMM_ARATH Protein TOO MANY MOUTHS OS=Arabidopsis thaliana GN=TMM PE=2 SV=1 Back     alignment and function desciption
 Score =  542 bits (1397), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 273/459 (59%), Positives = 333/459 (72%), Gaps = 40/459 (8%)

Query: 1   MAQH-FSKRTPLVLAFICVLPFARPFTVIMQDSGGSSGLVDGPQTGFSMNKDGARTEPKE 59
           MA++ F ++  +VL+ +   P  R FTVI  DS   S L+DGPQTGF+M  DGARTEP E
Sbjct: 1   MARYEFFRQIFIVLSIVS--PLVRSFTVITSDSTAPSALIDGPQTGFTMTNDGARTEPDE 58

Query: 60  QEAVYDIMRATGNDWATEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCD 119
           Q+AVYDIMRATGNDWA  IPDVCRGRWHGIECMPD++NVYHVVSL FGALSDDTAFPTCD
Sbjct: 59  QDAVYDIMRATGNDWAAAIPDVCRGRWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCD 118

Query: 120 PTRSHISRSITKLPYLRTLFFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSE 179
           P RS++S S+T+L +L+ LFFYRC    PQ IPAFLG+LG +LQTLVLRENG +GPIP E
Sbjct: 119 PQRSYVSESLTRLKHLKALFFYRCLGRAPQRIPAFLGRLGSSLQTLVLRENGFLGPIPDE 178

Query: 180 LGNLTRLKVLDLHKNNLNGSIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQ 239
           LGNLT LKVLDLHKN+LNGSIP+S  R +GLRSLDLSGN+LTGSIP    P L+VLDLNQ
Sbjct: 179 LGNLTNLKVLDLHKNHLNGSIPLSFNRFSGLRSLDLSGNRLTGSIPGFVLPALSVLDLNQ 238

Query: 240 NLLM-----------------------------------DLILLDLSYNHLSGPFPISIR 264
           NLL                                     L+LLDLSYN LSGPFP S++
Sbjct: 239 NLLTGPVPPTLTSCGSLIKIDLSRNRVTGPIPESINRLNQLVLLDLSYNRLSGPFPSSLQ 298

Query: 265 NLNSLQALILKSNSMGPITIPNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHL 324
            LNSLQAL+LK N+    TIP  +F G++NLMIL+LSN N++G IP+SL +L +L VLHL
Sbjct: 299 GLNSLQALMLKGNTKFSTTIPENAFKGLKNLMILVLSNTNIQGSIPKSLTRLNSLRVLHL 358

Query: 325 DENHLNGSIPNSFKNLKHVSELRLNNNGLTGPLPFEREMVWKMKSKLRLHNNSGLCYNAG 384
           + N+L G IP  F+++KH+SELRLN+N LTGP+PFER+ VW+M+ KLRL+NN+GLC N  
Sbjct: 359 EGNNLTGEIPLEFRDVKHLSELRLNDNSLTGPVPFERDTVWRMRRKLRLYNNAGLCVNRD 418

Query: 385 SDFEDGLDSSIDSGIGLC--ESGKPGSANSVQHLGTLEE 421
           SD +D   S   S + LC  E+ +P  + +VQHL   E+
Sbjct: 419 SDLDDAFGSKSGSTVRLCDAETSRPAPSGTVQHLSREED 457
May participate in the initiation of asymmetric divisions that form stomata by sensing positional cues during epidermal development.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5PP26|PII2_ARATH Piriformospora indica-insensitive protein 2 OS=Arabidopsis thaliana GN=PII-2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|C0LGG8|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGG9|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=1 SV=2 Back     alignment and function description
>sp|C0LGH3|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query431
224128468481 predicted protein [Populus trichocarpa] 0.958 0.858 0.685 1e-175
225442935490 PREDICTED: protein TOO MANY MOUTHS-like 0.972 0.855 0.665 1e-168
255553211465 serine-threonine protein kinase, plant-t 0.935 0.866 0.658 1e-162
357455263499 Leucine-rich repeat receptor-like protei 0.955 0.825 0.615 1e-153
297839929485 hypothetical protein ARALYDRAFT_895990 [ 0.972 0.863 0.603 1e-153
15220050496 protein TOO MANY MOUTHS [Arabidopsis tha 0.972 0.844 0.594 1e-151
26452151496 GPI-anchored protein [Arabidopsis thalia 0.972 0.844 0.592 1e-151
449469256444 PREDICTED: protein TOO MANY MOUTHS-like 0.846 0.822 0.585 1e-125
357130526492 PREDICTED: protein TOO MANY MOUTHS-like 0.893 0.782 0.490 1e-112
242058077499 hypothetical protein SORBIDRAFT_03g02835 0.888 0.767 0.487 1e-111
>gi|224128468|ref|XP_002329011.1| predicted protein [Populus trichocarpa] gi|222839682|gb|EEE78005.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  620 bits (1600), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 308/449 (68%), Positives = 359/449 (79%), Gaps = 36/449 (8%)

Query: 18  VLPFARPFTVIMQDSGGSSGLVDGPQTGFSMNKDGARTEPKEQEAVYDIMRATGNDWATE 77
           +LP A+PFTVI+ DS   S LVDGPQ+GF+MNK+GART+ +EQEAVYDIMRATGNDWAT+
Sbjct: 4   LLPLAKPFTVIVSDSSNQSALVDGPQSGFTMNKNGARTDAREQEAVYDIMRATGNDWATD 63

Query: 78  IPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPTRSHISRSITKLPYLRT 137
           IPDVCRGRWHGIECMPDK+NVYHVVSL FG LSDDTAFPTCDP RS+IS SI KLP+L+T
Sbjct: 64  IPDVCRGRWHGIECMPDKDNVYHVVSLSFGTLSDDTAFPTCDPARSYISESIMKLPHLKT 123

Query: 138 LFFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLN 197
           LFFYRCF+ NPQPIP+FLGQL  TLQTLVLRENG+VG +P+ELGNLTRLKVLDLHKNNLN
Sbjct: 124 LFFYRCFSDNPQPIPSFLGQLSPTLQTLVLRENGHVGLVPAELGNLTRLKVLDLHKNNLN 183

Query: 198 GSIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLM-------------- 243
           GSIPVSLGR+ GL+SLDLSGNKLTGSI S+SFPVLNVLDL+QN+L               
Sbjct: 184 GSIPVSLGRLAGLKSLDLSGNKLTGSIFSLSFPVLNVLDLSQNMLTGSIPSSLGFCHSLI 243

Query: 244 ---------------------DLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPI 282
                                +LIL+DLSYN LS P P SIR+LNSLQALILK N MG  
Sbjct: 244 KIDFSRNRLSGSIPESIGSLKELILMDLSYNRLSKPLPTSIRSLNSLQALILKGNPMGST 303

Query: 283 TIPNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKH 342
           T+ +  F GM++LM+LILSN NL GPIPESLG+L NL V+HLD NHLNGSIP +FK+LK+
Sbjct: 304 TLASKEFDGMKSLMVLILSNTNLHGPIPESLGRLTNLRVIHLDGNHLNGSIPINFKDLKN 363

Query: 343 VSELRLNNNGLTGPLPFEREMVWKMKSKLRLHNNSGLCYNAGSDFEDGLDSSIDSGIGLC 402
           + ELRLN+N LTGP+PF REMVWKM+ KL+L+NN+GLCY+A S FEDGLDS+ DSGIGLC
Sbjct: 364 LGELRLNDNQLTGPVPFGREMVWKMRRKLKLYNNTGLCYDANSGFEDGLDSTFDSGIGLC 423

Query: 403 ESGKPGSANSVQHLGTLE-ENITGTINTS 430
            + +PGSA +VQHL  ++ E +  T N S
Sbjct: 424 NTPEPGSARTVQHLSAIDGETMPSTTNKS 452

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225442935|ref|XP_002265327.1| PREDICTED: protein TOO MANY MOUTHS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255553211|ref|XP_002517648.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223543280|gb|EEF44812.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357455263|ref|XP_003597912.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula] gi|355486960|gb|AES68163.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297839929|ref|XP_002887846.1| hypothetical protein ARALYDRAFT_895990 [Arabidopsis lyrata subsp. lyrata] gi|297333687|gb|EFH64105.1| hypothetical protein ARALYDRAFT_895990 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15220050|ref|NP_178125.1| protein TOO MANY MOUTHS [Arabidopsis thaliana] gi|22096215|sp|Q9SSD1.1|TMM_ARATH RecName: Full=Protein TOO MANY MOUTHS; AltName: Full=Receptor-like protein 17; Short=AtRLP17; Flags: Precursor gi|5902366|gb|AAD55468.1|AC009322_8 Hypothetical protein [Arabidopsis thaliana] gi|332198233|gb|AEE36354.1| protein TOO MANY MOUTHS [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|26452151|dbj|BAC43164.1| GPI-anchored protein [Arabidopsis thaliana] gi|29028896|gb|AAO64827.1| At1g80080 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449469256|ref|XP_004152337.1| PREDICTED: protein TOO MANY MOUTHS-like [Cucumis sativus] gi|449525656|ref|XP_004169832.1| PREDICTED: protein TOO MANY MOUTHS-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357130526|ref|XP_003566899.1| PREDICTED: protein TOO MANY MOUTHS-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|242058077|ref|XP_002458184.1| hypothetical protein SORBIDRAFT_03g028355 [Sorghum bicolor] gi|241930159|gb|EES03304.1| hypothetical protein SORBIDRAFT_03g028355 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query431
TAIR|locus:2016319496 TMM "TOO MANY MOUTHS" [Arabido 0.860 0.747 0.517 3.9e-92
TAIR|locus:2052367462 RLP29 "receptor like protein 2 0.742 0.692 0.306 1e-29
TAIR|locus:2139880450 RIC7 "ROP-interactive CRIB mot 0.716 0.686 0.295 3e-25
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.786 0.344 0.284 2.4e-21
TAIR|locus:2005507 976 ER "ERECTA" [Arabidopsis thali 0.470 0.207 0.340 8.9e-21
TAIR|locus:2012433432 AT1G68780 [Arabidopsis thalian 0.709 0.708 0.274 3e-20
TAIR|locus:2167948 966 ERL1 "ERECTA-like 1" [Arabidop 0.445 0.198 0.357 4e-20
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.573 0.220 0.335 2.8e-19
TAIR|locus:2182855 967 ERL2 "ERECTA-like 2" [Arabidop 0.452 0.201 0.355 1.6e-18
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.566 0.195 0.328 2.3e-18
TAIR|locus:2016319 TMM "TOO MANY MOUTHS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 918 (328.2 bits), Expect = 3.9e-92, P = 3.9e-92
 Identities = 203/392 (51%), Positives = 240/392 (61%)

Query:     1 MAQH-FSKRTPLVLAFICVLPFARPFTVIMQDSGGSSGLVDGPQTGFSMNKDGARTEPKE 59
             MA++ F ++  +VL+ +   P  R FTVI  DS   S L+DGPQTGF+M  DGARTEP E
Sbjct:     1 MARYEFFRQIFIVLSIVS--PLVRSFTVITSDSTAPSALIDGPQTGFTMTNDGARTEPDE 58

Query:    60 QEAVYDIMRATGNDWATEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCD 119
             Q+AVYDIMRATGNDWA  IPDVCRGRWHGIECMPD++NVYHVVSL FGALSDDTAFPTCD
Sbjct:    59 QDAVYDIMRATGNDWAAAIPDVCRGRWHGIECMPDQDNVYHVVSLSFGALSDDTAFPTCD 118

Query:   120 PTRSHISRSITKLPYLRTLFFYRCFTHNPQPIPAFXXXXXXXXXXXVLRENGNVGPIPSE 179
             P RS++S S+T+L +L+ LFFYRC    PQ IPAF           VLRENG +GPIP E
Sbjct:   119 PQRSYVSESLTRLKHLKALFFYRCLGRAPQRIPAFLGRLGSSLQTLVLRENGFLGPIPDE 178

Query:   180 LGNLTRLKVLDLHKNNLNGSIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVXXXXXX-- 237
             LGNLT LKVLDLHKN+LNGSIP+S  R +GLRSLDLSGN+LTGSIP    P         
Sbjct:   179 LGNLTNLKVLDLHKNHLNGSIPLSFNRFSGLRSLDLSGNRLTGSIPGFVLPALSVLDLNQ 238

Query:   238 ---------XXXXXXXXXXXXXSYNHLSGPFPISIRNLNSLQALILKSNSM-GPITIPNY 287
                                   S N ++GP P SI  LN L  L L  N + GP   P+ 
Sbjct:   239 NLLTGPVPPTLTSCGSLIKIDLSRNRVTGPIPESINRLNQLVLLDLSYNRLSGPF--PS- 295

Query:   288 SFIGXXXXXXXXXXXXXXXGP-IPESLGQ-LPNLHVLHLDENHLNGSIPNSFKNLKHVSE 345
             S  G                  IPE+  + L NL +L L   ++ GSIP S   L  +  
Sbjct:   296 SLQGLNSLQALMLKGNTKFSTTIPENAFKGLKNLMILVLSNTNIQGSIPKSLTRLNSLRV 355

Query:   346 LRLNNNGLTGPLPFEREMVWKMKSKLRLHNNS 377
             L L  N LTG +P E   V K  S+LRL++NS
Sbjct:   356 LHLEGNNLTGEIPLEFRDV-KHLSELRLNDNS 386
GO:0005739 "mitochondrion" evidence=ISM
GO:0010103 "stomatal complex morphogenesis" evidence=RCA;IMP
GO:0007165 "signal transduction" evidence=IC;RCA
GO:0004872 "receptor activity" evidence=ISS
GO:0031225 "anchored to membrane" evidence=TAS
GO:0009737 "response to abscisic acid stimulus" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0016020 "membrane" evidence=IDA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0042127 "regulation of cell proliferation" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
GO:0008356 "asymmetric cell division" evidence=IMP
TAIR|locus:2052367 RLP29 "receptor like protein 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139880 RIC7 "ROP-interactive CRIB motif-containing protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005507 ER "ERECTA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012433 AT1G68780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167948 ERL1 "ERECTA-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182855 ERL2 "ERECTA-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SSD1TMM_ARATHNo assigned EC number0.59470.97210.8447yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00970008
hypothetical protein (481 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_2110009
hypothetical protein (338 aa)
  •     0.425
eugene3.00180747
hypothetical protein (336 aa)
  •     0.414

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-30
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-28
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-27
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-21
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  122 bits (308), Expect = 6e-30
 Identities = 82/209 (39%), Positives = 115/209 (55%), Gaps = 16/209 (7%)

Query: 151 IPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRINGL 210
           IP  +G    +L+ L L  N  VG IP+ L NLT L+ L L  N L G IP  LG++  L
Sbjct: 156 IPNDIGSF-SSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSL 214

Query: 211 RSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLMDLILLDLSYNHLSGPFPISIRNLNSLQ 270
           + + L  N L+G IP   + +  +  LN         LDL YN+L+GP P S+ NL +LQ
Sbjct: 215 KWIYLGYNNLSGEIP---YEIGGLTSLNH--------LDLVYNNLTGPIPSSLGNLKNLQ 263

Query: 271 ALILKSNSM-GPITIPNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHL 329
            L L  N + GP  IP  S   ++ L+ L LS+ +L G IPE + QL NL +LHL  N+ 
Sbjct: 264 YLFLYQNKLSGP--IPP-SIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNF 320

Query: 330 NGSIPNSFKNLKHVSELRLNNNGLTGPLP 358
            G IP +  +L  +  L+L +N  +G +P
Sbjct: 321 TGKIPVALTSLPRLQVLQLWSNKFSGEIP 349

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 431
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.82
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.75
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.74
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.7
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.6
PLN03150623 hypothetical protein; Provisional 99.59
KOG4237498 consensus Extracellular matrix protein slit, conta 99.41
PLN03150623 hypothetical protein; Provisional 99.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.09
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.07
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.03
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.03
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.97
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.85
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.83
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.69
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.67
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.57
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.54
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.43
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.38
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.31
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.18
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.09
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.92
PRK15386 426 type III secretion protein GogB; Provisional 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
PRK15386426 type III secretion protein GogB; Provisional 97.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.54
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 97.51
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.45
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.4
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.11
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.98
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.71
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 96.61
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.03
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.89
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.85
KOG4341483 consensus F-box protein containing LRR [General fu 95.13
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.07
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.92
KOG4341483 consensus F-box protein containing LRR [General fu 94.69
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.62
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.3
KOG4308478 consensus LRR-containing protein [Function unknown 93.35
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 90.78
KOG1947482 consensus Leucine rich repeat proteins, some prote 90.37
KOG4308478 consensus LRR-containing protein [Function unknown 88.31
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.16
KOG0473 326 consensus Leucine-rich repeat protein [Function un 87.25
smart0037026 LRR Leucine-rich repeats, outliers. 86.72
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.72
smart0037026 LRR Leucine-rich repeats, outliers. 86.53
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.53
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.99
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.05
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.3
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4e-34  Score=313.84  Aligned_cols=348  Identities=31%  Similarity=0.490  Sum_probs=272.6

Q ss_pred             CCHHHHHHHHHHHHhcC------CCCCCCCCCCCCCCccceEeCCCCCCeeEEEEEecCCCCCCCCCCCCCCCCcccccc
Q 036865           55 TEPKEQEAVYDIMRATG------NDWATEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPTRSHISRS  128 (431)
Q Consensus        55 ~~~~e~~~l~~~~~~~~------~~w~~~~~~~C~~~w~gv~C~~~~~~~~~v~~l~l~~~~~~~~~~~~~~~~~~l~~~  128 (431)
                      .++.|..|++++++...      .+|.. ..++|  .|.||+|+..    .+|+.|++.+..          +.+.+++.
T Consensus        26 ~~~~~~~~l~~~~~~~~~~~~~~~~w~~-~~~~c--~w~gv~c~~~----~~v~~L~L~~~~----------i~~~~~~~   88 (968)
T PLN00113         26 LHAEELELLLSFKSSINDPLKYLSNWNS-SADVC--LWQGITCNNS----SRVVSIDLSGKN----------ISGKISSA   88 (968)
T ss_pred             CCHHHHHHHHHHHHhCCCCcccCCCCCC-CCCCC--cCcceecCCC----CcEEEEEecCCC----------ccccCChH
Confidence            45678999999988764      25754 34788  8999999743    279999998654          66777888


Q ss_pred             ccCCCCCcEEEcCcccCCCCCCCChhhh-cccccccEEEeecCCCCCCCchhhcCCCCCCEEEeecccCCccCcccccCC
Q 036865          129 ITKLPYLRTLFFYRCFTHNPQPIPAFLG-QLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRI  207 (431)
Q Consensus       129 l~~l~~L~~L~l~~~~~~~~~~ip~~i~-~l~~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l  207 (431)
                      +..+++|++|++++|...  +.+|..+. .+ ++|++|++++|.+.+.+|.  +.+++|++|+|++|.+.+.+|..++++
T Consensus        89 ~~~l~~L~~L~Ls~n~~~--~~ip~~~~~~l-~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l  163 (968)
T PLN00113         89 IFRLPYIQTINLSNNQLS--GPIPDDIFTTS-SSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSF  163 (968)
T ss_pred             HhCCCCCCEEECCCCccC--CcCChHHhccC-CCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcC
Confidence            999999999999988653  57888777 66 8999999999998888875  468899999999999988899999999


Q ss_pred             CCCcEEEecCCcCCCCCCCC--CCCCcCEEEcCCCCCC-----------CCcEEEccCCCCCCCCcccccCCCCcceeec
Q 036865          208 NGLRSLDLSGNKLTGSIPSI--SFPVLNVLDLNQNLLM-----------DLILLDLSYNHLSGPFPISIRNLNSLQALIL  274 (431)
Q Consensus       208 ~~L~~L~L~~n~l~~~~~~~--~l~~L~~L~l~~n~l~-----------~L~~L~ls~n~l~~~~p~~l~~l~~L~~L~L  274 (431)
                      ++|++|++++|.+.+.+|..  .+++|+.|++++|.+.           +|++|++++|.+.+.+|..++++++|++|++
T Consensus       164 ~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L  243 (968)
T PLN00113        164 SSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDL  243 (968)
T ss_pred             CCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEEC
Confidence            99999999999988777765  7889999999888643           7889999999999889999999999999999


Q ss_pred             CCCCCCCCCCChhhhcCCCCCcEEEeeCCcCCCCCchhcCCCCCCcEeecccccCCCCcchhhcCCcCCcEEEccCCCCC
Q 036865          275 KSNSMGPITIPNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSELRLNNNGLT  354 (431)
Q Consensus       275 ~~n~l~~~~i~~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~  354 (431)
                      ++|.+ .+.+|. .+..+++|++|++++|++.+.+|..+..+++|++|++++|.+.+.+|..+.++++|+.|++++|.+.
T Consensus       244 ~~n~l-~~~~p~-~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~  321 (968)
T PLN00113        244 VYNNL-TGPIPS-SLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFT  321 (968)
T ss_pred             cCcee-ccccCh-hHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccC
Confidence            99988 445555 6888999999999999998888988889999999999999999889998999999999999999999


Q ss_pred             CCCccchHHHhhccceEEcccCCCcccCCCCCCCCccccccCCCCCCCCC--CCCC---CCCcccccccccccccccccC
Q 036865          355 GPLPFEREMVWKMKSKLRLHNNSGLCYNAGSDFEDGLDSSIDSGIGLCES--GKPG---SANSVQHLGTLEENITGTINT  429 (431)
Q Consensus       355 g~ip~~~~~l~~l~~~l~l~~Np~~c~~~~~~~~~~~~~~~~~~~~~C~~--~~~~---~~~~l~~l~~~~~~~~~~~~~  429 (431)
                      +.+|..+..+..++ .+++++|.... .....+... ..........|..  ..|.   ....++.+....+++.+.+|.
T Consensus       322 ~~~~~~~~~l~~L~-~L~L~~n~l~~-~~p~~l~~~-~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~  398 (968)
T PLN00113        322 GKIPVALTSLPRLQ-VLQLWSNKFSG-EIPKNLGKH-NNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPK  398 (968)
T ss_pred             CcCChhHhcCCCCC-EEECcCCCCcC-cCChHHhCC-CCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCH
Confidence            98888888887776 89998887541 111111111 1101112222211  1111   234567777777778777774

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 6e-11
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-06
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-11
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-06
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 7e-10
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 79/192 (41%), Gaps = 37/192 (19%)
Query: 167 LRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRINGLRSLDLSGNKLTGSIPS 226
           L+ NG  G IP  L N + L  L L  N L+G+IP SLG ++ LR L L  N L G IP 
Sbjct: 401 LQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ 460
Query: 227 ISFPVXXXXXXXXXXXXXXXXXXXSYNHLSGPFPISIRNLNSLQALILKSNSMGPITIPN 286
               V                    +N L+G  P  + N  +L  + L +N +       
Sbjct: 461 ELMYV-----------KTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRL------- 502
Query: 287 YSFIGXXXXXXXXXXXXXXXGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSEL 346
                               G IP+ +G+L NL +L L  N  +G+IP    + + +  L
Sbjct: 503 -------------------TGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWL 543
Query: 347 RLNNNGLTGPLP 358
            LN N   G +P
Sbjct: 544 DLNTNLFNGTIP 555
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query431
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-46
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-46
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-45
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-44
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-44
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-42
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-32
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-33
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-31
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-27
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-29
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-35
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-33
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-26
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-22
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-27
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-27
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-24
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-15
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  195 bits (499), Expect = 2e-59
 Identities = 84/298 (28%), Positives = 124/298 (41%), Gaps = 38/298 (12%)

Query: 80  DVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPTRSHISRSITKLPYLRTLF 139
           D C   W G+ C       Y V +L    L+    +P        I  S+  LPYL  L+
Sbjct: 32  DCCNRTWLGVLC-DTDTQTYRVNNLDLSGLNLPKPYP--------IPSSLANLPYLNFLY 82

Query: 140 FYRCFTHNPQ---PIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNL 196
                        PIP  + +L   L  L +      G IP  L  +  L  LD   N L
Sbjct: 83  IG----GINNLVGPIPPAIAKL-TQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNAL 137

Query: 197 NGSIPVSLGRINGLRSLDLSGNKLTGSIPS--ISFPVL-NVLDLNQNLL----------M 243
           +G++P S+  +  L  +   GN+++G+IP    SF  L   + +++N L          +
Sbjct: 138 SGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL 197

Query: 244 DLILLDLSYNHLSGPFPISIRNLNSLQALILKSNS-MGPITIPNYSFIGMRNLMILILSN 302
           +L  +DLS N L G   +   +  + Q + L  NS    +          +NL  L L N
Sbjct: 198 NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG----KVGLSKNLNGLDLRN 253

Query: 303 MNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSELRL-NNNGLTG-PLP 358
             + G +P+ L QL  LH L++  N+L G IP    NL+        NN  L G PLP
Sbjct: 254 NRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGG-NLQRFDVSAYANNKCLCGSPLP 310
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query431
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.98
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.98
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.83
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.82
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.58
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.58
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.52
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.4
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.34
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.32
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.29
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.14
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.13
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.62
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.53
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.37
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.17
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.14
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.01
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.96
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.84
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.66
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.64
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.55
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=1.7e-39  Score=310.35  Aligned_cols=297  Identities=27%  Similarity=0.467  Sum_probs=254.7

Q ss_pred             CCHHHHHHHHHHHHhcCC-----CCCCCCCCCCCCCccceEeCCCCCCeeEEEEEecCCCCCCCCCCCCCCCCc--cccc
Q 036865           55 TEPKEQEAVYDIMRATGN-----DWATEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPTRS--HISR  127 (431)
Q Consensus        55 ~~~~e~~~l~~~~~~~~~-----~w~~~~~~~C~~~w~gv~C~~~~~~~~~v~~l~l~~~~~~~~~~~~~~~~~--~l~~  127 (431)
                      |.++|++|+++++++.+.     +|.. ..+||.+.|.||+|+... ...+|+.|++.+..          +.+  .+|+
T Consensus         3 c~~~~~~aL~~~k~~~~~~~~l~~W~~-~~~~C~~~w~gv~C~~~~-~~~~l~~L~L~~~~----------l~~~~~~~~   70 (313)
T 1ogq_A            3 CNPQDKQALLQIKKDLGNPTTLSSWLP-TTDCCNRTWLGVLCDTDT-QTYRVNNLDLSGLN----------LPKPYPIPS   70 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCGGGTTCCT-TSCTTTTCSTTEEECCSS-SCCCEEEEEEECCC----------CSSCEECCG
T ss_pred             CCHHHHHHHHHHHHhcCCcccccCCCC-CCCCCcCCCcceEeCCCC-CCceEEEEECCCCC----------ccCCcccCh
Confidence            788999999999998753     6865 357895569999997532 12379999998754          667  8899


Q ss_pred             cccCCCCCcEEEcCc-ccCCCCCCCChhhhcccccccEEEeecCCCCCCCchhhcCCCCCCEEEeecccCCccCcccccC
Q 036865          128 SITKLPYLRTLFFYR-CFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGR  206 (431)
Q Consensus       128 ~l~~l~~L~~L~l~~-~~~~~~~~ip~~i~~l~~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~  206 (431)
                      .+.++++|++|++++ |...  +.+|..++.+ ++|++|++++|.+.+.+|..|.++++|++|++++|.+++.+|..+.+
T Consensus        71 ~l~~l~~L~~L~L~~~n~l~--~~~p~~l~~l-~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~  147 (313)
T 1ogq_A           71 SLANLPYLNFLYIGGINNLV--GPIPPAIAKL-TQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISS  147 (313)
T ss_dssp             GGGGCTTCSEEEEEEETTEE--SCCCGGGGGC-TTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGG
T ss_pred             hHhCCCCCCeeeCCCCCccc--ccCChhHhcC-CCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhc
Confidence            999999999999985 5442  6789999999 89999999999999899999999999999999999999999999999


Q ss_pred             CCCCcEEEecCCcCCCCCCCCCCCCcCEEEcCCCCCC-CCcEEEccCCCCCCCCcccccCCCCcceeecCCCCCCCCCCC
Q 036865          207 INGLRSLDLSGNKLTGSIPSISFPVLNVLDLNQNLLM-DLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPITIP  285 (431)
Q Consensus       207 l~~L~~L~L~~n~l~~~~~~~~l~~L~~L~l~~n~l~-~L~~L~ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~i~  285 (431)
                      +++|++|++++|.+++.+|...           ..+. .|++|++++|.+++.+|..+..++ |++|++++|.++ + ..
T Consensus       148 l~~L~~L~L~~N~l~~~~p~~l-----------~~l~~~L~~L~L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~-~-~~  213 (313)
T 1ogq_A          148 LPNLVGITFDGNRISGAIPDSY-----------GSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLE-G-DA  213 (313)
T ss_dssp             CTTCCEEECCSSCCEEECCGGG-----------GCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEEE-E-CC
T ss_pred             CCCCCeEECcCCcccCcCCHHH-----------hhhhhcCcEEECcCCeeeccCChHHhCCc-ccEEECcCCccc-C-cC
Confidence            9999999999999987777541           1122 567777888888888899999887 999999999984 3 34


Q ss_pred             hhhhcCCCCCcEEEeeCCcCCCCCchhcCCCCCCcEeecccccCCCCcchhhcCCcCCcEEEccCCCCCCCCccchHHHh
Q 036865          286 NYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSELRLNNNGLTGPLPFEREMVW  365 (431)
Q Consensus       286 ~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~g~ip~~~~~l~  365 (431)
                      ...+..+++|++|++++|++++.+|. +..+++|++|++++|++++.+|..+..+++|++|++++|+++|.+|.. ..+.
T Consensus       214 ~~~~~~l~~L~~L~L~~N~l~~~~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~-~~l~  291 (313)
T 1ogq_A          214 SVLFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQ  291 (313)
T ss_dssp             GGGCCTTSCCSEEECCSSEECCBGGG-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGG
T ss_pred             CHHHhcCCCCCEEECCCCceeeecCc-ccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCCC-cccc
Confidence            44788999999999999999977666 888999999999999999999999999999999999999999999987 6677


Q ss_pred             hccceEEcccCCCcccCC
Q 036865          366 KMKSKLRLHNNSGLCYNA  383 (431)
Q Consensus       366 ~l~~~l~l~~Np~~c~~~  383 (431)
                      .+. .+++++|++.|+..
T Consensus       292 ~L~-~l~l~~N~~lc~~p  308 (313)
T 1ogq_A          292 RFD-VSAYANNKCLCGSP  308 (313)
T ss_dssp             GSC-GGGTCSSSEEESTT
T ss_pred             ccC-hHHhcCCCCccCCC
Confidence            776 89999999999853
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 431
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 84.0 bits (206), Expect = 1e-18
 Identities = 76/318 (23%), Positives = 114/318 (35%), Gaps = 28/318 (8%)

Query: 57  PKEQEAVYDIMRATGNDWA----TEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDD 112
           P++++A+  I +  GN           D C   W G+ C  D    Y V +L    L+  
Sbjct: 5   PQDKQALLQIKKDLGNPTTLSSWLPTTDCCNRTWLGVLCDTDT-QTYRVNNLDLSGLNLP 63

Query: 113 TAFPTCDPTRSHISRSITKLPYLRTLFFYRCFTHNPQPIPAFLGQLGQTLQTLVLRENGN 172
             +P        I  S+  LPYL  L+            PA        L  L +     
Sbjct: 64  KPYP--------IPSSLANLPYLNFLYIGGINNLVGPIPPAI--AKLTQLHYLYITHTNV 113

Query: 173 VGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGRINGLRSLDLSGNKLTGSIPSISFPVL 232
            G IP  L  +  L  LD   N L+G++P S+  +  L  +   GN+++G+IP       
Sbjct: 114 SGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFS 173

Query: 233 ----------NVLDLNQNLLMDLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPI 282
                     N L          + L       +     +     S +       +   +
Sbjct: 174 KLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSL 233

Query: 283 TIPNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKH 342
                     +NL  L L N  + G +P+ L QL  LH L++  N+L G IP    NL+ 
Sbjct: 234 AFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQR 292

Query: 343 VSELRL-NNNGLTG-PLP 358
                  NN  L G PLP
Sbjct: 293 FDVSAYANNKCLCGSPLP 310
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query431
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.95
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.64
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.54
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.51
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.41
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.25
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.05
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.9
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.58
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.38
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.77
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.25
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=1.2e-37  Score=295.13  Aligned_cols=296  Identities=27%  Similarity=0.470  Sum_probs=249.8

Q ss_pred             CCHHHHHHHHHHHHhcC-----CCCCCCCCCCCCCCccceEeCCCCCCeeEEEEEecCCCCCCCCCCCCCCCCc--cccc
Q 036865           55 TEPKEQEAVYDIMRATG-----NDWATEIPDVCRGRWHGIECMPDKENVYHVVSLMFGALSDDTAFPTCDPTRS--HISR  127 (431)
Q Consensus        55 ~~~~e~~~l~~~~~~~~-----~~w~~~~~~~C~~~w~gv~C~~~~~~~~~v~~l~l~~~~~~~~~~~~~~~~~--~l~~  127 (431)
                      |.++|++||++|+++..     .+|.. ..|||.+.|.||+|+.. .++.||+.|++.+..          +.|  .+|+
T Consensus         3 c~~~e~~aLl~~k~~~~~~~~l~sW~~-~~d~C~~~w~gv~C~~~-~~~~~v~~L~L~~~~----------l~g~~~lp~   70 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPTTLSSWLP-TTDCCNRTWLGVLCDTD-TQTYRVNNLDLSGLN----------LPKPYPIPS   70 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCGGGTTCCT-TSCTTTTCSTTEEECCS-SSCCCEEEEEEECCC----------CSSCEECCG
T ss_pred             CCHHHHHHHHHHHHHCCCCCcCCCCCC-CCCCCCCcCCCeEEeCC-CCcEEEEEEECCCCC----------CCCCCCCCh
Confidence            78999999999998875     37865 36999767999999854 355689999998754          444  6889


Q ss_pred             cccCCCCCcEEEcCc-ccCCCCCCCChhhhcccccccEEEeecCCCCCCCchhhcCCCCCCEEEeecccCCccCcccccC
Q 036865          128 SITKLPYLRTLFFYR-CFTHNPQPIPAFLGQLGQTLQTLVLRENGNVGPIPSELGNLTRLKVLDLHKNNLNGSIPVSLGR  206 (431)
Q Consensus       128 ~l~~l~~L~~L~l~~-~~~~~~~~ip~~i~~l~~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~  206 (431)
                      +++++++|++|++++ |..  .+.+|..++++ ++|++|++++|.+.+..+..+..+.+|+++++++|.+.+.+|..+.+
T Consensus        71 ~l~~L~~L~~L~Ls~~N~l--~g~iP~~i~~L-~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~  147 (313)
T d1ogqa_          71 SLANLPYLNFLYIGGINNL--VGPIPPAIAKL-TQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISS  147 (313)
T ss_dssp             GGGGCTTCSEEEEEEETTE--ESCCCGGGGGC-TTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGG
T ss_pred             HHhcCcccccccccccccc--ccccccccccc-cccchhhhccccccccccccccchhhhcccccccccccccCchhhcc
Confidence            999999999999986 333  26899999999 89999999999999988888999999999999999999999999999


Q ss_pred             CCCCcEEEecCCcCCCCCCCC--CCCCcCEEEcCCCCCCCCcEEEccCCCCCCCCcccccCCCCcceeecCCCCCCCCCC
Q 036865          207 INGLRSLDLSGNKLTGSIPSI--SFPVLNVLDLNQNLLMDLILLDLSYNHLSGPFPISIRNLNSLQALILKSNSMGPITI  284 (431)
Q Consensus       207 l~~L~~L~L~~n~l~~~~~~~--~l~~L~~L~l~~n~l~~L~~L~ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~i  284 (431)
                      +++|+++++++|.+.+.+|..  .+..            .++.+++++|++++..|..+..+..+ .+++..+.. .+.+
T Consensus       148 l~~L~~l~l~~n~l~~~ip~~~~~l~~------------l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~-~~~~  213 (313)
T d1ogqa_         148 LPNLVGITFDGNRISGAIPDSYGSFSK------------LFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNML-EGDA  213 (313)
T ss_dssp             CTTCCEEECCSSCCEEECCGGGGCCCT------------TCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEE-EECC
T ss_pred             Ccccceeeccccccccccccccccccc------------cccccccccccccccccccccccccc-ccccccccc-cccc
Confidence            999999999999998887764  2222            23567788888888888888777554 688888887 4455


Q ss_pred             ChhhhcCCCCCcEEEeeCCcCCCCCchhcCCCCCCcEeecccccCCCCcchhhcCCcCCcEEEccCCCCCCCCccchHHH
Q 036865          285 PNYSFIGMRNLMILILSNMNLRGPIPESLGQLPNLHVLHLDENHLNGSIPNSFKNLKHVSELRLNNNGLTGPLPFEREMV  364 (431)
Q Consensus       285 ~~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~g~ip~~~~~l  364 (431)
                      +. .+..+++++.+++++|.+.+.+| .++.+++|+.|+|++|+++|.+|..++++++|++|+|++|+++|.+|. ++.+
T Consensus       214 ~~-~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L  290 (313)
T d1ogqa_         214 SV-LFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNL  290 (313)
T ss_dssp             GG-GCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTG
T ss_pred             cc-ccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccC
Confidence            54 67788999999999999997665 588899999999999999999999999999999999999999999995 3566


Q ss_pred             hhccceEEcccCCCcccCC
Q 036865          365 WKMKSKLRLHNNSGLCYNA  383 (431)
Q Consensus       365 ~~l~~~l~l~~Np~~c~~~  383 (431)
                      ..+. .+++++|+..|+..
T Consensus       291 ~~L~-~l~l~~N~~l~g~p  308 (313)
T d1ogqa_         291 QRFD-VSAYANNKCLCGSP  308 (313)
T ss_dssp             GGSC-GGGTCSSSEEESTT
T ss_pred             CCCC-HHHhCCCccccCCC
Confidence            6665 88999999888753
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure