Citrus Sinensis ID: 036911

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36

MEVQQVLCMNGGRGDTSYANNSKIQKRAMLTAKPILQDSIKKLYCNRLPECLKIADLGCSSGPNTLSLLWEIIDTIDGTCKRLNREAPMYQVFLNDLPGNDFNTIFKSLPGFYEKLKEVKGSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSLHWLSQVPEGLVSESGVPLNKGHICMAKTSPVGRDFTLFLTSRSEEILSGGHVLLSIIGNDRKPGDPRCTGWELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDIHTVDWDANKDDGSKSLTSGRHTRGKNIAKSIRAVSESMLASHFGEEIMDDLFERLAKKISEYLEFAPGHSTTMVISMTKS

cccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHccHHHHHHHHHHHccccccEEEEcccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEEccccccccccccHHHHHHHHHHHHHHccccHHHHHcccccccccccHHHHHHHHHccccEEEEEEEEEEEccccccccccccccccHHccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEc

ccEEEEEEcccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHcHHHHHHHHHHcccccccEEEEEccccccccccccccEEEEEcHHHHHHHHccccHHccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHcccccHHHHcccccccccccHHHHHHHHHHcccEEEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcc

MEVQQVLcmnggrgdtsyanNSKIQKRAMLTAKPILQDSIKKLYCnrlpeclkiadlgcssgpntLSLLWEIIDTIDGTckrlnreapmYQVFLndlpgndfntifKSLPGFYEKLKevkgsnfgpcfiagipgsfygrlfpnkslhfvhssyslhwlsqvpeglvsesgvplnkghicmaktspvgrdFTLFLTSRSEEILSGGHVLLSIigndrkpgdprctgweLLGVTLNDMVLEGLVEEAkvdwfnlpyyapspeeVRHVIQTegsfnirrfdihtvdwdankddgsksltsgrhtrgKNIAKSIRAVSESMLASHFGEEIMDDLFERLAKKISEYlefapghstTMVISMTKS

MEVQQVlcmnggrgdtsyaNNSKIQKRAMLTAKPILQDSIKKLYCNRLPECLKIADLGCSSGPNTLSLLWEIIDTIDGTCKRLNREAPMYQVFLNDLPGNDFNTIFKSLPGFYEKLKEVKGSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSLHWLSQVPEGLVSESGVPLNKGHICMAKTSPVGRDFTLFLTSRSEEILSGGHVLLSIIGNDRKPGDPRCTGWELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDihtvdwdankddgsksltsgrhtrgkniAKSIRAVSESMLASHFGEEIMDDLFERLAKKISEYlefapghsttmvismtks

***************************AMLTAKPILQDSIKKLYCNRLPECLKIADLGCSSGPNTLSLLWEIIDTIDGTCKRLNREAPMYQVFLNDLPGNDFNTIFKSLPGFYEKLKEVKGSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSLHWLSQVPEGLVSESGVPLNKGHICMAKTSPVGRDFTLFLTSRSEEILSGGHVLLSIIGNDRKPGDPRCTGWELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDIHTVDWD********************************LASHFGEEIMDDLFERLAKKISEYLEFAPG************

***QQVLCMNGGRGDTSYANNSKIQKRAMLTAKPILQDSIKKLYCNRLPECLKIADLGCSSGPNTLSLLWEIIDTIDGTCK****EAPMYQVFLNDLPGNDFNTIFKSLPGFYEK******SNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSLHWLSQVPEGLVSESGVPLNKGHICMAKTSPVGRDFTLFLTSRSEEILSGGHVLLSIIGNDRKPGDPRCTGWELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDIHTVDWDANKDDGSKSLTSGRHTRGKNIAKSIRAVSESMLASHFGEEIMDDLFERLAKKISEYLEFAPGHSTTMVISMTKS

*EVQQVLCMNGGRGDTSYANNSKIQKRAMLTAKPILQDSIKKLYCNRLPECLKIADLGCSSGPNTLSLLWEIIDTIDGTCKRLNREAPMYQVFLNDLPGNDFNTIFKSLPGFYEKLKEVKGSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSLHWLSQVPEGLVSESGVPLNKGHICMAKTSPVGRDFTLFLTSRSEEILSGGHVLLSIIGNDRKPGDPRCTGWELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDIHTVDWDAN*****KSLTSGRHTRGKNIAKSIRAVSESMLASHFGEEIMDDLFERLAKKISEYLEFAPGHSTTMVISMTKS

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		359	2.2.26 [Sep-21-2011]
Q8H0D2		384	3,7-dimethylxanthine N-me	N/A	no	0.988	0.924	0.45	5e-85
Q9AVK0		372	7-methylxanthosine syntha	N/A	no	0.969	0.935	0.456	8e-85
A4GE69		372	7-methylxanthosine syntha	N/A	no	0.969	0.935	0.456	2e-84
A4GE70		384	3,7-dimethylxanthine N-me	N/A	no	0.988	0.924	0.436	2e-83
Q8H0G0		384	Theobromine synthase 2 OS	N/A	no	0.988	0.924	0.447	2e-83
Q8H0D3		384	Caffeine synthase 1 OS=Co	N/A	no	0.988	0.924	0.436	6e-83
Q9AVJ9		378	Monomethylxanthine methyl	N/A	no	0.988	0.939	0.443	6e-82
Q84PP7		384	Monomethylxanthine methyl	N/A	no	0.988	0.924	0.442	7e-82
Q9AVL9		385	Probable caffeine synthas	N/A	no	0.983	0.916	0.430	1e-81
Q9AVK1		385	Probable caffeine synthas	N/A	no	0.991	0.924	0.426	2e-81

>sp\|Q8H0D2\|DXMT1_COFAR 3,7-dimethylxanthine N-methyltransferase OS=Coffea arabica GN=DXMT1 PE=1 SV=1	Back alignment and function desciption

 Score =  314 bits (805), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 171/380 (45%), Positives = 242/380 (63%), Gaps = 25/380 (6%)

Query: 1   MEVQQVLCMNGGRGDTSYANNSKIQKRAMLTAKPILQDSIKKLYCNRLP---ECLKIADL 57
           ME+Q+VL MNGG GDTSYA NS      ++  KPIL+  I++L    LP   +C+K+ADL
Sbjct: 1   MELQEVLHMNGGEGDTSYAKNS-FYNLFLIRVKPILEQCIQELLRANLPNINKCIKVADL 59

Query: 58  GCSSGPNTLSLLWEIIDTID--GTCKRLNREAPMYQVFLNDLPGNDFNTIFKSLPGFYEK 115
           GC+SGPNTL  + +I+ +ID  G  K+   E P  Q+FLNDL  NDFN++FKSLP FY K
Sbjct: 60  GCASGPNTLLTVRDIVQSIDKVGQEKKNELERPTIQIFLNDLFQNDFNSVFKSLPSFYRK 119

Query: 116 LKEVKGSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSLHWLSQVPEGLVSESGVPLNK 175
           L++  G   G C I  +PGSFYGRLFP +S+HF+HS Y LHWLSQVP GLV+E G+  NK
Sbjct: 120 LEKENGCKIGSCLIGAMPGSFYGRLFPEESMHFLHSCYCLHWLSQVPSGLVTELGISANK 179

Query: 176 GHICMAKTS--PVG--------RDFTLFLTSRSEEILSGGHVLLSIIGNDRKPGDPRCTG 225
           G I  +K S  P+         +DFT FL   SEE++S G +LL+ I  + +  +P    
Sbjct: 180 GCIYSSKASRPPIQKAYLDQFTKDFTTFLRIHSEELISRGRMLLTWICKEDEFENP--NS 237

Query: 226 WELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDIHTVDWD 285
            +LL +++ND+V+EG +EE K+D FN+P YAPS EEV+ +++ EGSF I   +   V +D
Sbjct: 238 IDLLEMSINDLVIEGHLEEEKLDSFNVPIYAPSTEEVKCIVEEEGSFEILYLETFKVPYD 297

Query: 286 A--NKDDGSKS-----LTSGRHTRGKNIAKSIRAVSESMLASHFGEEIMDDLFERLAKKI 338
           A  + DD  +      ++   H R  ++A  +R++ E ++ASHFGE I+ DL  R+AK  
Sbjct: 298 AGFSIDDDYQGRSHSPVSCDEHARAAHVASVVRSIFEPIVASHFGEAILPDLSHRIAKNA 357

Query: 339 SEYLEFAPGHSTTMVISMTK 358
           ++ L    G   +++IS+ K
Sbjct: 358 AKVLRSGKGFYDSVIISLAK 377

Involved in the biosynthesis of caffeine. Catalyzes the conversion of paraxanthine to caffeine. Can also convert 7-methylxanthine to theobromine and theobromine to caffeine, but no sequential conversion of 7-methylxanthine to caffeine was detected.
Coffea arabica (taxid: 13443)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 6EC: 0

>sp\|Q9AVK0\|XMT1_COFAR 7-methylxanthosine synthase 1 OS=Coffea arabica GN=XMT1 PE=1 SV=1	Back alignment and function description

>sp\|A4GE69\|XMT1_COFCA 7-methylxanthosine synthase 1 OS=Coffea canephora GN=XMT1 PE=1 SV=1	Back alignment and function description

>sp\|A4GE70\|DXMT1_COFCA 3,7-dimethylxanthine N-methyltransferase OS=Coffea canephora GN=DXMT1 PE=1 SV=1	Back alignment and function description

>sp\|Q8H0G0\|CTS2_COFAR Theobromine synthase 2 OS=Coffea arabica GN=CTS2 PE=1 SV=1	Back alignment and function description

>sp\|Q8H0D3\|CCS1_COFAR Caffeine synthase 1 OS=Coffea arabica GN=CCS1 PE=1 SV=1	Back alignment and function description

>sp\|Q9AVJ9\|MXMT1_COFAR Monomethylxanthine methyltransferase 1 OS=Coffea arabica GN=MXMT1 PE=1 SV=1	Back alignment and function description

>sp\|Q84PP7\|MXMT2_COFAR Monomethylxanthine methyltransferase 2 OS=Coffea arabica GN=MXMT2 PE=1 SV=1	Back alignment and function description

>sp\|Q9AVL9\|CS4_COFAR Probable caffeine synthase 4 OS=Coffea arabica GN=CS4 PE=2 SV=1	Back alignment and function description

>sp\|Q9AVK1\|CS3_COFAR Probable caffeine synthase 3 OS=Coffea arabica GN=CS3 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		359
225447527		383	PREDICTED: probable caffeine synthase 4-	1.0	0.937	0.536	1e-111
296085033		549	unnamed protein product [Vitis vinifera]	1.0	0.653	0.536	1e-111
255587606		375	Jasmonate O-methyltransferase, putative	0.991	0.949	0.530	1e-105
224144626		367	predicted protein [Populus trichocarpa]	0.974	0.953	0.522	1e-104
209956793		380	S-adenosyl-L-methionine:salicylic acid c	0.991	0.936	0.523	1e-104
359475119		376	PREDICTED: LOW QUALITY PROTEIN: salicyla	0.969	0.925	0.527	1e-101
388516431		369	unknown [Medicago truncatula]	0.991	0.964	0.501	1e-101
357467353		369	Salicylic acid/benzoic acid carboxyl met	0.991	0.964	0.501	1e-101
440550959		367	salicylic acid carboxyl methyltransferas	0.980	0.959	0.505	1e-100
225430676		364	PREDICTED: salicylate O-methyltransferas	0.969	0.956	0.502	2e-99

>gi\|225447527\|ref\|XP_002267308.1\| PREDICTED: probable caffeine synthase 4-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 200/373 (53%), Positives = 257/373 (68%), Gaps = 14/373 (3%)

Query: 1   MEVQQVLCMNGGRGDTSYANNSKIQKRAMLTAKPILQDSIKKLYCNRLPECLKIADLGCS 60
           MEVQQVLCM GG G+ SYANNS +QK+ +L  KPIL++SI +LYC    ECLKIADLGCS
Sbjct: 1   MEVQQVLCMKGGDGEASYANNSLLQKKVILEVKPILEESITELYCKTFSECLKIADLGCS 60

Query: 61  SGPNTLSLLWEIIDTIDGTCKRLNREAPMYQVFLNDLPGNDFNTIFKSLPGFYEKLKEVK 120
           SGPNT   LWEIID I  TC R +RE P +Q+FLNDLP NDFN IF+SL  FYE++++ K
Sbjct: 61  SGPNTFLPLWEIIDCIGATCSRFSREPPAFQIFLNDLPQNDFNAIFESLARFYERIEKEK 120

Query: 121 GSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSLHWLSQVPEGLVSESGVPLNKGHICM 180
                 CFIAG+PGSF+ RLFP++S+HF HSSYSLHWLSQVPEGLVSESG PLNKG+I +
Sbjct: 121 EGMSRQCFIAGVPGSFHRRLFPDRSIHFFHSSYSLHWLSQVPEGLVSESGTPLNKGNIHL 180

Query: 181 AKTSP----------VGRDFTLFLTSRSEEILSGGHVLLSIIGNDRKPGDPRCTGW---- 226
             T+P            RDFT FL  RS+EI+ GGH+LL+++G+D    +    G     
Sbjct: 181 TVTTPPSVHKAYLNQFERDFTAFLRLRSQEIIPGGHMLLTLLGSDGNGQNSSTDGLYKIC 240

Query: 227 ELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDIHTVDWDA 286
           EL+ +TL DMV EG ++E+++D  N+P + PSPE+VR VIQ E SF + R +   +DW  
Sbjct: 241 ELISMTLKDMVTEGSIQESELDSLNIPLFMPSPEQVRSVIQRESSFTLLRLETFKLDWAD 300

Query: 287 NKDDGSKSLTSGRHTRGKNIAKSIRAVSESMLASHFGEEIMDDLFERLAKKISEYLEFAP 346
           N DDG+K     ++ R K +   IRAV E +LASHFG  +MD LF R   K+ E +E   
Sbjct: 301 NIDDGNKDQVFDKYGRAKYVVMYIRAVGEPILASHFGGAVMDSLFHRFFMKVVENIETGK 360

Query: 347 GHSTTMVISMTKS 359
           G  T +VIS++++
Sbjct: 361 GIYTNLVISLSRN 373

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|296085033\|emb\|CBI28448.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255587606\|ref\|XP_002534327.1\| Jasmonate O-methyltransferase, putative [Ricinus communis] gi\|223525486\|gb\|EEF28055.1\| Jasmonate O-methyltransferase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224144626\|ref\|XP_002325354.1\| predicted protein [Populus trichocarpa] gi\|222862229\|gb\|EEE99735.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|209956793\|gb\|ABU88887.2\| S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase [Chimonanthus praecox]	Back alignment and taxonomy information

>gi\|359475119\|ref\|XP_003631590.1\| PREDICTED: LOW QUALITY PROTEIN: salicylate O-methyltransferase-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|388516431\|gb\|AFK46277.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357467353\|ref\|XP_003603961.1\| Salicylic acid/benzoic acid carboxyl methyltransferase [Medicago truncatula] gi\|355493009\|gb\|AES74212.1\| Salicylic acid/benzoic acid carboxyl methyltransferase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|440550959\|gb\|AGC11863.1\| salicylic acid carboxyl methyltransferase [Camellia japonica]	Back alignment and taxonomy information

>gi\|225430676\|ref\|XP_002262676.1\| PREDICTED: salicylate O-methyltransferase [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		359
TAIR\|locus:2013149		389	JMT "jasmonic acid carboxyl me	0.515	0.475	0.492	7.5e-76
TAIR\|locus:2154845		354	AT5G66430 [Arabidopsis thalian	0.958	0.971	0.440	1.1e-71
TAIR\|locus:2080747		379	BSMT1 [Arabidopsis thaliana (t	0.938	0.889	0.422	6.1e-71
TAIR\|locus:2115400		371	AT4G36470 [Arabidopsis thalian	0.969	0.938	0.425	1.3e-70
TAIR\|locus:2179969		385	AT5G04380 "AT5G04380" [Arabido	0.952	0.888	0.421	2.4e-69
TAIR\|locus:2179929		415	NAMT1 [Arabidopsis thaliana (t	0.955	0.826	0.433	3e-69
TAIR\|locus:2144466		368	AT5G38020 [Arabidopsis thalian	0.966	0.942	0.423	8.2e-67
TAIR\|locus:2095572		368	AT3G21950 [Arabidopsis thalian	0.896	0.875	0.428	1.4e-64
TAIR\|locus:2053458		359	AT2G14060 [Arabidopsis thalian	0.944	0.944	0.395	1e-61
TAIR\|locus:2161680		386	IAMT1 "AT5G55250" [Arabidopsis	0.924	0.860	0.327	7.9e-46

TAIR\|locus:2013149 JMT "jasmonic acid carboxyl methyltransferase" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 442 (160.7 bits), Expect = 7.5e-76, Sum P(2) = 7.5e-76
 Identities = 97/197 (49%), Positives = 123/197 (62%)

Query:     1 MEVQQVLCMNGGRGDTSYANNSKIQKRAMLTAKPILQDSIKKLYC-NRLPECLKIADLGC 59
             MEV +VL MN G G+TSYA NS  Q   +   + ++ +++KKL   N     + IADLGC
Sbjct:     1 MEVMRVLHMNKGNGETSYAKNSTAQSNIISLGRRVMDEALKKLMMSNSEISSIGIADLGC 60

Query:    60 SSGPNTLSLLWEIIDTIDGTCKRLNREAPMYQVFLNDLPGNDFNTIFKSLPGFYEKLKEV 119
             SSGPN+L  +  I+DTI   C  L+R  P  +V LNDLP NDFN I  SLP FY+++   
Sbjct:    61 SSGPNSLLSISNIVDTIHNLCPDLDRPVPELRVSLNDLPSNDFNYICASLPEFYDRVNNN 120

Query:   120 K-GSNFG-----PCFIAGIPGSFYGRLFPNKSLHFVHSSYSLHWLSQVP--EGLVSESGV 171
             K G  FG      CF++ +PGSFYGRLFP +SLHFVHSS SLHWLSQVP  E    +  +
Sbjct:   121 KEGLGFGRGGGESCFVSAVPGSFYGRLFPRRSLHFVHSSSSLHWLSQVPCREAEKEDRTI 180

Query:   172 PL---NKGHICMAKTSP 185
                  N G I ++KTSP
Sbjct:   181 TADLENMGKIYISKTSP 197

GO:0005634 "nucleus" evidence=ISM

GO:0008168 "methyltransferase activity" evidence=IEA

GO:0005737 "cytoplasm" evidence=NAS

GO:0009611 "response to wounding" evidence=IEP;RCA

GO:0009694 "jasmonic acid metabolic process" evidence=IDA

GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA;IDA

GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA;IMP

GO:0030795 "jasmonate O-methyltransferase activity" evidence=IMP;IDA

GO:0006612 "protein targeting to membrane" evidence=RCA

GO:0007165 "signal transduction" evidence=RCA

GO:0009414 "response to water deprivation" evidence=RCA

GO:0009620 "response to fungus" evidence=RCA

GO:0009723 "response to ethylene stimulus" evidence=RCA

GO:0009733 "response to auxin stimulus" evidence=RCA

GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA

GO:0009753 "response to jasmonic acid stimulus" evidence=RCA

GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA

GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA

GO:0042538 "hyperosmotic salinity response" evidence=RCA

TAIR\|locus:2154845 AT5G66430 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2080747 BSMT1 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2115400 AT4G36470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2179969 AT5G04380 "AT5G04380" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2179929 NAMT1 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2144466 AT5G38020 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2095572 AT3G21950 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2053458 AT2G14060 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2161680 IAMT1 "AT5G55250" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.1.1	0.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		359
pfam03492		331	pfam03492, Methyltransf_7, SAM dependent carboxyl	1e-134
PLN02668		386	PLN02668, PLN02668, indole-3-acetate carboxyl meth	1e-74

>gnl\|CDD\|217591 pfam03492, Methyltransf_7, SAM dependent carboxyl methyltransferase	Back alignment and domain information

 Score =  384 bits (988), Expect = e-134
 Identities = 160/342 (46%), Positives = 216/342 (63%), Gaps = 31/342 (9%)

Query: 36  LQDSIKKLYCNRL-PECLKIADLGCSSGPNTLSLLWEIIDTIDGTCKRLNREA-PMYQVF 93
           L+++I +L    L P  +KIADLGCSSGPNT   +  IIDT++   ++ N    P +QVF
Sbjct: 1   LEEAISELLLRNLFPNSIKIADLGCSSGPNTFLAVSNIIDTVEKKYQKENILEPPEFQVF 60

Query: 94  LNDLPGNDFNTIFKSLPGFYEKLKEVKGSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSY 153
            NDLP NDFNT+FK LP F +K            F++G+PGSFYGRLFP  SLHFVHSSY
Sbjct: 61  FNDLPSNDFNTLFKLLPPFQKK--------KRSYFVSGVPGSFYGRLFPRNSLHFVHSSY 112

Query: 154 SLHWLSQVPEGLVSESGVPLNKGHICMAKTSP----------VGRDFTLFLTSRSEEILS 203
           SLHWLSQVP+GL  +     NKG+I ++  SP            +DF+LFL +R+EE++S
Sbjct: 113 SLHWLSQVPKGLEDKESPAWNKGNIYISGASPEEVYKAYLDQFKKDFSLFLRARAEELVS 172

Query: 204 GGHVLLSIIGNDRKPGDP----RCTGWELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSP 259
           GG ++L+ +G  R   DP        W+LLG  LND+V EGL+EE K+D FN+P YAPSP
Sbjct: 173 GGLMVLTFLG--RPSVDPSETECGIFWDLLGDALNDLVSEGLIEEEKLDSFNIPIYAPSP 230

Query: 260 EEVRHVIQTEGSFNIRRFDIHTVDWDANKDDGSKSLTSGRHTRGKNIAKSIRAVSESMLA 319
           EEV+ +I+ EGSF I R +I        +    +S +  +   G+ +A S+RAV E ML 
Sbjct: 231 EEVKEIIEKEGSFTIERLEII--KHPNGEVPWDESDSEDKVEDGRFVASSVRAVVEPMLV 288

Query: 320 SHFGEEIMDDLFERLAKKISEYL--EFAPGHSTTM-VISMTK 358
           +HFGE+IMD LF+R AKK+SE+L  E      T   V+S+++
Sbjct: 289 AHFGEDIMDKLFDRYAKKLSEHLSKELQNAKKTINVVVSLSR 330

This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesised through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyzes the second step to produce theobromine. Length = 331

>gnl\|CDD\|178273 PLN02668, PLN02668, indole-3-acetate carboxyl methyltransferase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		359
PLN02668		386	indole-3-acetate carboxyl methyltransferase	100.0
PF03492		334	Methyltransf_7: SAM dependent carboxyl methyltrans	100.0
PRK01683		258	trans-aconitate 2-methyltransferase; Provisional	99.67
PRK14103		255	trans-aconitate 2-methyltransferase; Provisional	99.66
PRK10258		251	biotin biosynthesis protein BioC; Provisional	99.64
TIGR02072		240	BioC biotin biosynthesis protein BioC. This enzyme	99.55
COG4106		257	Tam Trans-aconitate methyltransferase [General fun	99.39
PLN02233		261	ubiquinone biosynthesis methyltransferase	99.31
COG2226		238	UbiE Methylase involved in ubiquinone/menaquinone	99.23
TIGR02752		231	MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me	99.23
PLN02336		475	phosphoethanolamine N-methyltransferase	99.22
PTZ00098		263	phosphoethanolamine N-methyltransferase; Provision	99.2
TIGR00740		239	methyltransferase, putative. A simple BLAST search	99.19
PRK15068		322	tRNA mo(5)U34 methyltransferase; Provisional	99.15
PRK08317		241	hypothetical protein; Provisional	99.15
PRK11036		255	putative S-adenosyl-L-methionine-dependent methylt	99.14
PF01209		233	Ubie_methyltran: ubiE/COQ5 methyltransferase famil	99.13
PLN02396		322	hexaprenyldihydroxybenzoate methyltransferase	99.12
PLN02244		340	tocopherol O-methyltransferase	99.09
PF13489		161	Methyltransf_23: Methyltransferase domain; PDB: 3J	99.08
PRK15451		247	tRNA cmo(5)U34 methyltransferase; Provisional	99.03
PRK11705		383	cyclopropane fatty acyl phospholipid synthase; Pro	99.03
TIGR01934		223	MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis	99.02
PF08241		95	Methyltransf_11: Methyltransferase domain; InterPr	99.01
TIGR00452		314	methyltransferase, putative. Known examples to dat	98.99
PRK00216		239	ubiE ubiquinone/menaquinone biosynthesis methyltra	98.99
PLN02490		340	MPBQ/MSBQ methyltransferase	98.97
smart00828		224	PKS_MT Methyltransferase in polyketide synthase (P	98.95
PRK06202		232	hypothetical protein; Provisional	98.81
PRK11207		197	tellurite resistance protein TehB; Provisional	98.8
PRK11873		272	arsM arsenite S-adenosylmethyltransferase; Reviewe	98.76
KOG2940		325	consensus Predicted methyltransferase [General fun	98.74
PF02353		273	CMAS: Mycolic acid cyclopropane synthetase; InterP	98.73
TIGR00477		195	tehB tellurite resistance protein TehB. Part of a	98.72
PRK11088		272	rrmA 23S rRNA methyltransferase A; Provisional	98.71
KOG1540		296	consensus Ubiquinone biosynthesis methyltransferas	98.71
PRK05785		226	hypothetical protein; Provisional	98.69
PLN02336		475	phosphoethanolamine N-methyltransferase	98.68
PF08242		99	Methyltransf_12: Methyltransferase domain; InterPr	98.68
TIGR02716		306	C20_methyl_CrtF C-20 methyltransferase BchU. Membe	98.67
PRK12335		287	tellurite resistance protein TehB; Provisional	98.67
KOG1541		270	consensus Predicted protein carboxyl methylase [Ge	98.65
PF12847		112	Methyltransf_18: Methyltransferase domain; PDB: 3G	98.63
PF13847		152	Methyltransf_31: Methyltransferase domain; PDB: 3T	98.57
PRK06922		677	hypothetical protein; Provisional	98.56
PRK00121		202	trmB tRNA (guanine-N(7)-)-methyltransferase; Revie	98.54
TIGR01983		224	UbiG ubiquinone biosynthesis O-methyltransferase.	98.53
TIGR02021		219	BchM-ChlM magnesium protoporphyrin O-methyltransfe	98.53
TIGR00138		181	gidB 16S rRNA methyltransferase GidB. GidB (glucos	98.47
TIGR03438		301	probable methyltransferase. This model represents	98.44
TIGR02081		194	metW methionine biosynthesis protein MetW. This pr	98.43
PF08003		315	Methyltransf_9: Protein of unknown function (DUF16	98.42
TIGR03840		213	TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d	98.41
KOG2361		264	consensus Predicted methyltransferase [General fun	98.4
PRK05134		233	bifunctional 3-demethylubiquinone-9 3-methyltransf	98.38
PRK11188		209	rrmJ 23S rRNA methyltransferase J; Provisional	98.36
TIGR00091		194	tRNA (guanine-N(7)-)-methyltransferase. In E. coli	98.35
COG2230		283	Cfa Cyclopropane fatty acid synthase and related m	98.35
PRK13255		218	thiopurine S-methyltransferase; Reviewed	98.34
PF03848		192	TehB: Tellurite resistance protein TehB; InterPro:	98.33
PF00891		241	Methyltransf_2: O-methyltransferase; InterPro: IPR	98.33
TIGR00537		179	hemK_rel_arch HemK-related putative methylase. The	98.31
KOG3010		261	consensus Methyltransferase [General function pred	98.3
smart00138		264	MeTrc Methyltransferase, chemotaxis proteins. Meth	98.3
PRK07580		230	Mg-protoporphyrin IX methyl transferase; Validated	98.29
PF13649		101	Methyltransf_25: Methyltransferase domain; PDB: 3B	98.28
TIGR03587		204	Pse_Me-ase pseudaminic acid biosynthesis-associate	98.25
KOG1270		282	consensus Methyltransferases [Coenzyme transport a	98.2
PRK15001		378	SAM-dependent 23S ribosomal RNA mG1835 methyltrans	98.18
PRK08287		187	cobalt-precorrin-6Y C(15)-methyltransferase; Valid	98.17
PRK04266		226	fibrillarin; Provisional	98.17
TIGR02469		124	CbiT precorrin-6Y C5,15-methyltransferase (decarbo	98.15
PRK00107		187	gidB 16S rRNA methyltransferase GidB; Reviewed	98.14
PRK13944		205	protein-L-isoaspartate O-methyltransferase; Provis	98.12
PTZ00146		293	fibrillarin; Provisional	98.11
PLN02585		315	magnesium protoporphyrin IX methyltransferase	98.07
PRK09489		342	rsmC 16S ribosomal RNA m2G1207 methyltransferase;	98.05
PF05401		201	NodS: Nodulation protein S (NodS); InterPro: IPR00	98.05
PF05175		170	MTS: Methyltransferase small domain; InterPro: IPR	98.03
PF05148		219	Methyltransf_8: Hypothetical methyltransferase; In	98.02
PRK14121		390	tRNA (guanine-N(7)-)-methyltransferase; Provisiona	98.01
PRK14967		223	putative methyltransferase; Provisional	98.0
PLN02232		160	ubiquinone biosynthesis methyltransferase	97.97
TIGR00080		215	pimt protein-L-isoaspartate(D-aspartate) O-methylt	97.93
COG2227		243	UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-	97.92
TIGR03533		284	L3_gln_methyl protein-(glutamine-N5) methyltransfe	97.91
PRK13942		212	protein-L-isoaspartate O-methyltransferase; Provis	97.91
PHA03411		279	putative methyltransferase; Provisional	97.91
TIGR03534		251	RF_mod_PrmC protein-(glutamine-N5) methyltransfera	97.85
TIGR00536		284	hemK_fam HemK family putative methylases. The gene	97.82
PRK11805		307	N5-glutamine S-adenosyl-L-methionine-dependent met	97.82
PF06080		204	DUF938: Protein of unknown function (DUF938); Inte	97.8
PRK00312		212	pcm protein-L-isoaspartate O-methyltransferase; Re	97.78
PF05891		218	Methyltransf_PK: AdoMet dependent proline di-methy	97.78
PRK00517		250	prmA ribosomal protein L11 methyltransferase; Revi	97.76
KOG4300		252	consensus Predicted methyltransferase [General fun	97.76
TIGR00438		188	rrmJ cell division protein FtsJ.	97.74
cd02440		107	AdoMet_MTases S-adenosylmethionine-dependent methy	97.73
TIGR00406		288	prmA ribosomal protein L11 methyltransferase. Ribo	97.69
PRK14966		423	unknown domain/N5-glutamine S-adenosyl-L-methionin	97.67
PF07021		193	MetW: Methionine biosynthesis protein MetW; InterP	97.67
PRK00377		198	cbiT cobalt-precorrin-6Y C(15)-methyltransferase;	97.63
PF03141		506	Methyltransf_29: Putative S-adenosyl-L-methionine-	97.62
PRK09328		275	N5-glutamine S-adenosyl-L-methionine-dependent met	97.62
COG4123		248	Predicted O-methyltransferase [General function pr	97.57
PLN03075		296	nicotianamine synthase; Provisional	97.52
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	97.52
KOG3178		342	consensus Hydroxyindole-O-methyltransferase and re	97.5
PRK14968		188	putative methyltransferase; Provisional	97.46
KOG3045		325	consensus Predicted RNA methylase involved in rRNA	97.4
PF13659		117	Methyltransf_26: Methyltransferase domain; PDB: 3G	97.4
PRK13256		226	thiopurine S-methyltransferase; Reviewed	97.36
PRK00811		283	spermidine synthase; Provisional	97.33
TIGR03704		251	PrmC_rel_meth putative protein-(glutamine-N5) meth	97.25
COG2813		300	RsmC 16S RNA G1207 methylase RsmC [Translation, ri	97.19
TIGR01177		329	conserved hypothetical protein TIGR01177. This fam	97.18
TIGR00563		426	rsmB ribosomal RNA small subunit methyltransferase	97.14
COG2264		300	PrmA Ribosomal protein L11 methylase [Translation,	97.12
COG2890		280	HemK Methylase of polypeptide chain release factor	97.07
PRK14903		431	16S rRNA methyltransferase B; Provisional	97.07
COG4976		287	Predicted methyltransferase (contains TPR repeat)	97.06
KOG2904		328	consensus Predicted methyltransferase [General fun	97.04
PRK04457		262	spermidine synthase; Provisional	97.01
PRK10901		427	16S rRNA methyltransferase B; Provisional	96.94
PF03291		331	Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971	96.9
PF06325		295	PrmA: Ribosomal protein L11 methyltransferase (Prm	96.9
PF02390		195	Methyltransf_4: Putative methyltransferase ; Inter	96.89
PF05724		218	TPMT: Thiopurine S-methyltransferase (TPMT); Inter	96.82
PRK13943		322	protein-L-isoaspartate O-methyltransferase; Provis	96.81
KOG3191		209	consensus Predicted N6-DNA-methyltransferase [Tran	96.81
PRK07402		196	precorrin-6B methylase; Provisional	96.79
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	96.79
PRK14904		445	16S rRNA methyltransferase B; Provisional	96.79
PRK14902		444	16S rRNA methyltransferase B; Provisional	96.78
TIGR03439		319	methyl_EasF probable methyltransferase domain, Eas	96.78
PRK01581		374	speE spermidine synthase; Validated	96.7
COG2242		187	CobL Precorrin-6B methylase 2 [Coenzyme metabolism	96.67
TIGR00417		270	speE spermidine synthase. the SpeE subunit of sper	96.65
PF01135		209	PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl	96.62
PHA03412		241	putative methyltransferase; Provisional	96.62
PRK14901		434	16S rRNA methyltransferase B; Provisional	96.6
PLN02366		308	spermidine synthase	96.57
COG2518		209	Pcm Protein-L-isoaspartate carboxylmethyltransfera	96.52
PF12147		311	Methyltransf_20: Putative methyltransferase; Inter	96.48
KOG1331		293	consensus Predicted methyltransferase [General fun	96.46
PRK03612		521	spermidine synthase; Provisional	96.42
smart00650		169	rADc Ribosomal RNA adenine dimethylases.	96.42
KOG1271		227	consensus Methyltransferases [General function pre	96.24
PLN02781		234	Probable caffeoyl-CoA O-methyltransferase	96.19
COG0220		227	Predicted S-adenosylmethionine-dependent methyltra	96.08
PLN02672		1082	methionine S-methyltransferase	96.07
TIGR00446		264	nop2p NOL1/NOP2/sun family putative RNA methylase.	95.97
PF11968		219	DUF3321: Putative methyltransferase (DUF3321); Int	95.74
KOG1499		346	consensus Protein arginine N-methyltransferase PRM	95.58
COG2519		256	GCD14 tRNA(1-methyladenosine) methyltransferase an	95.54
PF05185		448	PRMT5: PRMT5 arginine-N-methyltransferase; InterPr	95.51
PF10294		173	Methyltransf_16: Putative methyltransferase; Inter	95.48
KOG1500		517	consensus Protein arginine N-methyltransferase CAR	95.34
PF04672		267	Methyltransf_19: S-adenosyl methyltransferase; Int	95.3
PRK11783		702	rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi	95.26
PRK13168		443	rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe	95.06
PF07942		270	N2227: N2227-like protein; InterPro: IPR012901 Thi	94.98
PF08704		247	GCD14: tRNA methyltransferase complex GCD14 subuni	94.92
PRK00274		272	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	94.61
PF01728		181	FtsJ: FtsJ-like methyltransferase; InterPro: IPR00	94.56
PRK14896		258	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	94.45
KOG2899		288	consensus Predicted methyltransferase [General fun	94.33
KOG1975		389	consensus mRNA cap methyltransferase [RNA processi	94.32
COG1352		268	CheR Methylase of chemotaxis methyl-accepting prot	94.21
TIGR00755		253	ksgA dimethyladenosine transferase. Alternate name	94.12
PF01596		205	Methyltransf_3: O-methyltransferase; InterPro: IPR	94.08
PRK15128		396	23S rRNA m(5)C1962 methyltransferase; Provisional	94.0
PF01739		196	CheR: CheR methyltransferase, SAM binding domain;	93.82
COG4122		219	Predicted O-methyltransferase [General function pr	93.39
PLN02476		278	O-methyltransferase	93.35
PF01234		256	NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I	93.13
PF02384		311	N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T	93.11
PLN02589		247	caffeoyl-CoA O-methyltransferase	93.01
PF05219		265	DREV: DREV methyltransferase; InterPro: IPR007884	92.86
PRK10611		287	chemotaxis methyltransferase CheR; Provisional	92.46
PLN02823		336	spermine synthase	92.29
COG0500		257	SmtA SAM-dependent methyltransferases [Secondary m	92.07
PRK11727		321	23S rRNA mA1618 methyltransferase; Provisional	91.89
PRK04338		382	N(2),N(2)-dimethylguanosine tRNA methyltransferase	91.13
PTZ00338		294	dimethyladenosine transferase-like protein; Provis	90.64
PF13679		141	Methyltransf_32: Methyltransferase domain	90.1
KOG2798		369	consensus Putative trehalase [Carbohydrate transpo	90.04
PRK03522		315	rumB 23S rRNA methyluridine methyltransferase; Rev	89.91
TIGR00478		228	tly hemolysin TlyA family protein. Hemolysins are	89.49
COG2263		198	Predicted RNA methylase [Translation, ribosomal st	88.19
PRK11933		470	yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF;	87.95
PRK04148		134	hypothetical protein; Provisional	85.23
PF09243		274	Rsm22: Mitochondrial small ribosomal subunit Rsm22	84.12
PRK10909		199	rsmD 16S rRNA m(2)G966-methyltransferase; Provisio	83.82
KOG1269		364	consensus SAM-dependent methyltransferases [Lipid	82.22
PF02527		184	GidB: rRNA small subunit methyltransferase G; Inte	81.72
KOG1661		237	consensus Protein-L-isoaspartate(D-aspartate) O-me	80.48

>PLN02668 indole-3-acetate carboxyl methyltransferase	Back alignment and domain information

Probab=100.00  E-value=4.5e-95  Score=711.76  Aligned_cols=350  Identities=33%  Similarity=0.589  Sum_probs=317.3

Q ss_pred             CcccceeeccCCCCcchHHHhhHHHHHHHHHhHHHHHHHHHHhhhcCCC-CcceEEeecCCCCcchHHHHHHHHHHHHHH
Q 036911            1 MEVQQVLCMNGGRGDTSYANNSKIQKRAMLTAKPILQDSIKKLYCNRLP-ECLKIADLGCSSGPNTLSLLWEIIDTIDGT   79 (359)
Q Consensus         1 ~~~~~~l~M~gG~g~~sY~~ns~~Q~~~~~~~~~~l~~ai~~~~~~~~~-~~~~IaDlGCs~G~nt~~l~~~ii~~i~~~   79 (359)
                      |+++++|||+||+|++||++||.+|+.++..++|+|+++|++++....+ ++++|||||||+|+||+.+++.||++|+++
T Consensus        13 m~~~~~l~M~gG~g~~SYa~nS~~Q~~~~~~~k~~leeai~~~~~~~~p~~~~~iaDlGcs~G~ntl~~vs~iI~~i~~~   92 (386)
T PLN02668         13 MKLEKLLCMKGGKGEGSYANNSQAQALHARSMLHLLEETLDNVHLNSSPEVPFTAVDLGCSSGSNTIHIIDVIVKHMSKR   92 (386)
T ss_pred             ceeccccccCCCCccccHHHHHHHHHHHHHHHHHHHHHHHHHhccccCCCcceeEEEecCCCCccHHHHHHHHHHHHHHH
Confidence            7899999999999999999999999999999999999999988654334 689999999999999999999999999999


Q ss_pred             hhhccCCCCcceEEecCCCCCchhhhhhcccchHHHHH--Hhh--CCCCCCeEEecccCCcccCCCCCCceeEEEecccc
Q 036911           80 CKRLNREAPMYQVFLNDLPGNDFNTIFKSLPGFYEKLK--EVK--GSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSL  155 (359)
Q Consensus        80 ~~~~~~~~p~~~v~~nDLp~NDFn~lF~~l~~~~~~~~--~~~--~~~~~~~f~~~v~gsFy~~lfp~~S~d~~~S~~al  155 (359)
                      |.+.+.++|++||||||||+||||+||++|+.+...+.  ...  ....++||++|||||||+||||++|+||+||++||
T Consensus        93 ~~~~~~~~pe~qv~~nDLP~NDFNtlF~~L~~~~~~~~~~~~~~~~~~~~~~f~~gvpGSFY~RLfP~~Slh~~~Ss~sl  172 (386)
T PLN02668         93 YESAGLDPPEFSAFFSDLPSNDFNTLFQLLPPLANYGGSMEECLAASGHRSYFAAGVPGSFYRRLFPARSIDVFHSAFSL  172 (386)
T ss_pred             hhhcCCCCCcceEEecCCCCCCHHHHHhhchhhhhhhcchhhhccccCCCceEEEecCccccccccCCCceEEEEeeccc
Confidence            98877778899999999999999999999998765431  110  01113699999999999999999999999999999


Q ss_pred             cccccCCCCccccCCCCCCCcceeecCCCCc---------cccHHHHHHHHHHhhccCceEEEEEecCCCCCCCCc----
Q 036911          156 HWLSQVPEGLVSESGVPLNKGHICMAKTSPV---------GRDFTLFLTSRSEEILSGGHVLLSIIGNDRKPGDPR----  222 (359)
Q Consensus       156 hWls~~p~~~~~~~~~~~n~g~i~~~~~~~~---------~~d~~~fL~~Ra~EL~pGG~l~~~~~g~~~~~~~~~----  222 (359)
                      ||||++|+.+.+..++.||||+||+.++++.         ++||..||++||+||+|||+|+++++||++  .+++    
T Consensus       173 HWLS~vP~~l~d~~s~~~Nkg~iyi~~~s~~v~~aY~~Qf~~D~~~FL~~Ra~ELvpGG~mvl~~~Gr~~--~~~~~~~~  250 (386)
T PLN02668        173 HWLSQVPESVTDKRSAAYNKGRVFIHGASESTANAYKRQFQADLAGFLRARAQEMKRGGAMFLVCLGRTS--VDPTDQGG  250 (386)
T ss_pred             eecccCchhhccCCcccccCCceEecCCCHHHHHHHHHHHHHHHHHHHHHHHHHhccCcEEEEEEecCCC--CCcccCCc
Confidence            9999999999999999999999999999964         899999999999999999999999999987  5554    


Q ss_pred             -hhHHHH-HHHHHHHHHHhccchhhhhccCCcCccCCCHHHHHHHHhcCCceEEeEEEEEeecCCCCCCCCCcccccccc
Q 036911          223 -CTGWEL-LGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDIHTVDWDANKDDGSKSLTSGRH  300 (359)
Q Consensus       223 -~~~~~~-l~~al~~mv~eGli~~e~~d~f~~P~y~~s~~E~~~~i~~~Gsf~i~~~e~~~~~~~~~~~~~~~~~~~d~~  300 (359)
                       +.+|+. ++++|++||.||+|++||+|+||+|+|+||++|++++|+++|+|+|+++|.++..|+. ..+..+    |..
T Consensus       251 ~~~~~~~~l~~al~dlv~eGlI~eek~dsFniP~Y~ps~eEv~~~Ie~~gsF~I~~le~~~~~~~~-~~~~~~----d~~  325 (386)
T PLN02668        251 AGLLFGTHFQDAWDDLVQEGLVTSEKRDSFNIPVYAPSLQDFKEVVEANGSFAIDKLEVFKGGSPL-VVNEPD----DAA  325 (386)
T ss_pred             hhHHHHHHHHHHHHHHHHcCCCCHHHHhcccCcccCCCHHHHHHHHhhcCCEEeeeeEEeeccCcc-cccCcc----cHH
Confidence             456776 9999999999999999999999999999999999999999999999999999999886 332221    556


Q ss_pred             cchhHHHHHHHHHhHHHHHhhcChhHHHHHHHHHHHHHHHHHhh--CCCCEEEEEEEEe
Q 036911          301 TRGKNIAKSIRAVSESMLASHFGEEIMDDLFERLAKKISEYLEF--APGHSTTMVISMT  357 (359)
Q Consensus       301 ~~~~~~~~~~Ra~~ep~l~~h~~~~i~delf~r~~~~~~~~~~~--~~~~~~~~~~~l~  357 (359)
                      ..++.+++++||++||+|.+|||++|+|+||+||+++++++++.  ++.++.+++++|+
T Consensus       326 ~~g~~~a~~~RA~~E~ll~~HFG~~i~D~lF~r~~~~v~~~~~~~~~~~~~~~~~~sL~  384 (386)
T PLN02668        326 EVGRAMANSCRSVAGVLVDAHIGEELSNELFLRVERRATSHAKELLEKLQFFHIVASLS  384 (386)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHhhcccCceEEEEEEEe
Confidence            78899999999999999999999999999999999999999988  8999999999986

>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine	Back alignment and domain information

>PRK01683 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK14103 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK10258 biotin biosynthesis protein BioC; Provisional	Back alignment and domain information

>TIGR02072 BioC biotin biosynthesis protein BioC	Back alignment and domain information

>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only]	Back alignment and domain information

>PLN02233 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional	Back alignment and domain information

>TIGR00740 methyltransferase, putative	Back alignment and domain information

>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PRK08317 hypothetical protein; Provisional	Back alignment and domain information

>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []	Back alignment and domain information

>PLN02396 hexaprenyldihydroxybenzoate methyltransferase	Back alignment and domain information

>PLN02244 tocopherol O-methyltransferase	Back alignment and domain information

>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C	Back alignment and domain information

>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional	Back alignment and domain information

>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases	Back alignment and domain information

>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>TIGR00452 methyltransferase, putative	Back alignment and domain information

>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed	Back alignment and domain information

>PLN02490 MPBQ/MSBQ methyltransferase	Back alignment and domain information

>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes	Back alignment and domain information

>PRK06202 hypothetical protein; Provisional	Back alignment and domain information

>PRK11207 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed	Back alignment and domain information

>KOG2940 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4)	Back alignment and domain information

>TIGR00477 tehB tellurite resistance protein TehB	Back alignment and domain information

>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional	Back alignment and domain information

>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK05785 hypothetical protein; Provisional	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU	Back alignment and domain information

>PRK12335 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only]	Back alignment and domain information

>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A	Back alignment and domain information

>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A	Back alignment and domain information

>PRK06922 hypothetical protein; Provisional	Back alignment and domain information

>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed	Back alignment and domain information

>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase	Back alignment and domain information

>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase	Back alignment and domain information

>TIGR00138 gidB 16S rRNA methyltransferase GidB	Back alignment and domain information

>TIGR03438 probable methyltransferase	Back alignment and domain information

>TIGR02081 metW methionine biosynthesis protein MetW	Back alignment and domain information

>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family	Back alignment and domain information

>KOG2361 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional	Back alignment and domain information

>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional	Back alignment and domain information

>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase	Back alignment and domain information

>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK13255 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB	Back alignment and domain information

>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>TIGR00537 hemK_rel_arch HemK-related putative methylase	Back alignment and domain information

>KOG3010 consensus Methyltransferase [General function prediction only]	Back alignment and domain information

>smart00138 MeTrc Methyltransferase, chemotaxis proteins	Back alignment and domain information

>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated	Back alignment and domain information

>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A	Back alignment and domain information

>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase	Back alignment and domain information

>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional	Back alignment and domain information

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated	Back alignment and domain information

>PRK04266 fibrillarin; Provisional	Back alignment and domain information

>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit	Back alignment and domain information

>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed	Back alignment and domain information

>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PTZ00146 fibrillarin; Provisional	Back alignment and domain information

>PLN02585 magnesium protoporphyrin IX methyltransferase	Back alignment and domain information

>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional	Back alignment and domain information

>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins	Back alignment and domain information

>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases	Back alignment and domain information

>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases	Back alignment and domain information

>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional	Back alignment and domain information

>PRK14967 putative methyltransferase; Provisional	Back alignment and domain information

>PLN02232 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase	Back alignment and domain information

>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]	Back alignment and domain information

>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific	Back alignment and domain information

>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PHA03411 putative methyltransferase; Provisional	Back alignment and domain information

>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific	Back alignment and domain information

>TIGR00536 hemK_fam HemK family putative methylases	Back alignment and domain information

>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes	Back alignment and domain information

>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed	Back alignment and domain information

>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like	Back alignment and domain information

>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed	Back alignment and domain information

>KOG4300 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR00438 rrmJ cell division protein FtsJ	Back alignment and domain information

>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy)	Back alignment and domain information

>TIGR00406 prmA ribosomal protein L11 methyltransferase	Back alignment and domain information

>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional	Back alignment and domain information

>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins	Back alignment and domain information

>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional	Back alignment and domain information

>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases	Back alignment and domain information

>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>COG4123 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PLN03075 nicotianamine synthase; Provisional	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only]	Back alignment and domain information

>PRK14968 putative methyltransferase; Provisional	Back alignment and domain information

>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification]	Back alignment and domain information

>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A	Back alignment and domain information

>PRK13256 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>PRK00811 spermidine synthase; Provisional	Back alignment and domain information

>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific	Back alignment and domain information

>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01177 conserved hypothetical protein TIGR01177	Back alignment and domain information

>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB	Back alignment and domain information

>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14903 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only]	Back alignment and domain information

>KOG2904 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PRK04457 spermidine synthase; Provisional	Back alignment and domain information

>PRK10901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes	Back alignment and domain information

>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences	Back alignment and domain information

>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2	Back alignment and domain information

>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes	Back alignment and domain information

>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK07402 precorrin-6B methylase; Provisional	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>PRK14904 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK14902 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family	Back alignment and domain information

>PRK01581 speE spermidine synthase; Validated	Back alignment and domain information

>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]	Back alignment and domain information

>TIGR00417 speE spermidine synthase	Back alignment and domain information

>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2	Back alignment and domain information

>PHA03412 putative methyltransferase; Provisional	Back alignment and domain information

>PRK14901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PLN02366 spermidine synthase	Back alignment and domain information

>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length	Back alignment and domain information

>KOG1331 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PRK03612 spermidine synthase; Provisional	Back alignment and domain information

>smart00650 rADc Ribosomal RNA adenine dimethylases	Back alignment and domain information

>KOG1271 consensus Methyltransferases [General function prediction only]	Back alignment and domain information

>PLN02781 Probable caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only]	Back alignment and domain information

>PLN02672 methionine S-methyltransferase	Back alignment and domain information

>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase	Back alignment and domain information

>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein	Back alignment and domain information

>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms]	Back alignment and domain information

>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase []	Back alignment and domain information

>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases	Back alignment and domain information

>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription]	Back alignment and domain information

>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins	Back alignment and domain information

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional	Back alignment and domain information

>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed	Back alignment and domain information

>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT)	Back alignment and domain information

>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA []	Back alignment and domain information

>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed	Back alignment and domain information

>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes	Back alignment and domain information

>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional	Back alignment and domain information

>KOG2899 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification]	Back alignment and domain information

>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms]	Back alignment and domain information

>TIGR00755 ksgA dimethyladenosine transferase	Back alignment and domain information

>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases	Back alignment and domain information

>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional	Back alignment and domain information

>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>COG4122 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PLN02476 O-methyltransferase	Back alignment and domain information

>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2	Back alignment and domain information

>PLN02589 caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes	Back alignment and domain information

>PRK10611 chemotaxis methyltransferase CheR; Provisional	Back alignment and domain information

>PLN02823 spermine synthase	Back alignment and domain information

>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]	Back alignment and domain information

>PRK11727 23S rRNA mA1618 methyltransferase; Provisional	Back alignment and domain information

>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional	Back alignment and domain information

>PTZ00338 dimethyladenosine transferase-like protein; Provisional	Back alignment and domain information

>PF13679 Methyltransf_32: Methyltransferase domain	Back alignment and domain information

>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed	Back alignment and domain information

>TIGR00478 tly hemolysin TlyA family protein	Back alignment and domain information

>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional	Back alignment and domain information

>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only]	Back alignment and domain information

>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G	Back alignment and domain information

>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		359
2eg5_A		372	The Structure Of Xanthosine Methyltransferase Lengt		2e-85
2efj_A		384	The Structure Of 1,7 Dimethylxanthine Methyltransfe		1e-84
1m6e_X		359	Crystal Structure Of Salicylic Acid Carboxyl Methyl		2e-80
3b5i_A		374	Crystal Structure Of Indole-3-Acetic Acid Methyltra		8e-50

>pdb|2EG5|A Chain A, The Structure Of Xanthosine Methyltransferase Length = 372

Back alignment and structure

Iteration: 1

Score = 312 bits (800), Expect = 2e-85, Method: Compositional matrix adjust. Identities = 171/375 (45%), Positives = 232/375 (61%), Gaps = 27/375 (7%) Query: 1 MEVQQVLCMNGGRGDTSYANNSKIQKRAMLTAKPILQDSIKKLYCNRLP---ECLKIADL 57 ME+Q+VL MNGG GDTSYA NS + + KP+L+ +++L LP +C+K+ADL Sbjct: 1 MELQEVLRMNGGEGDTSYAKNSAYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADL 60 Query: 58 GCSSGPNTLSLLWEIIDTID--GTCKRLNREAPMYQVFLNDLPGNDFNTIFKSLPGFYEK 115 GC+SGPNTL + +I+ +ID G K+ E P Q+FLNDL NDFN++FK LP FY K Sbjct: 61 GCASGPNTLLTVRDIVQSIDKVGQEKKNELERPTIQIFLNDLFPNDFNSVFKLLPSFYRK 120 Query: 116 LKEVKGSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSLHWLSQVPEGLVSESGVPLNK 175 L++ G G C I +PGSFY RLFP +S+HF+HS Y L WLSQVP GLV+E G+ NK Sbjct: 121 LEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTELGIGTNK 180 Query: 176 GHICMAKTS--PVG--------RDFTLFLTSRSEEILSGGHVLLSIIGNDRKPGDPRCTG 225 G I +K S PV +DFT FL SEE+ S G +LL+ I + D R Sbjct: 181 GSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVEL-DAR-NA 238 Query: 226 WELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDIHTVDWD 285 +LL + +ND+V+EG +EE K+D FNLP Y PS EEV+ +++ EGSF I + V +D Sbjct: 239 IDLLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLYD 298 Query: 286 A--NKDDGSKSLTSGRHTRGKNIAKSIRAVSESMLASHFGEEIMDDLFERLAKKISEYLE 343 A + DD H + + +A S+RAV E +LASHFGE I+ D+F R AK ++ L Sbjct: 299 AGFSIDD--------EHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLP 350 Query: 344 FAPGHSTTMVISMTK 358 G ++IS+ K Sbjct: 351 LGKGFYNNLIISLAK 365

PyMOL of 2eg5

>pdb|2EFJ|A Chain A, The Structure Of 1,7 Dimethylxanthine Methyltransferase Length = 384

Back alignment and structure

>pdb|1M6E|X Chain X, Crystal Structure Of Salicylic Acid Carboxyl Methyltransferase (Samt) Length = 359

Back alignment and structure

>pdb|3B5I|A Chain A, Crystal Structure Of Indole-3-Acetic Acid Methyltransferase Length = 374

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		359
2efj_A		384	3,7-dimethylxanthine methyltransferase; SAM-depend	1e-132
3b5i_A		374	S-adenosyl-L-methionine:salicylic acid carboxyl me	1e-129
1m6e_X		359	S-adenosyl-L-methionnine:salicylic acid carboxyl m	1e-124
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-10

>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Length = 384	Back alignment and structure

 Score =  381 bits (978), Expect = e-132
 Identities = 160/380 (42%), Positives = 228/380 (60%), Gaps = 25/380 (6%)

Query: 1   MEVQQVLCMNGGRGDTSYANNSKIQKRAMLTAKPILQDSIKKLYCNRLP---ECLKIADL 57
           ME+Q+VL MNGG GDTSYA NS      ++  KP+L+  I++L    LP   +C K+ DL
Sbjct: 1   MELQEVLHMNGGEGDTSYAKNSSYN-LFLIRVKPVLEQCIQELLRANLPNINKCFKVGDL 59

Query: 58  GCSSGPNTLSLLWEIIDTIDGTCKRL--NREAPMYQVFLNDLPGNDFNTIFKSLPGFYEK 115
           GC+SGPNT S + +I+ +ID   +      E P  Q+FLNDL  NDFN++FK LP FY  
Sbjct: 60  GCASGPNTFSTVRDIVQSIDKVGQEKKNELERPTIQIFLNDLFQNDFNSVFKLLPSFYRN 119

Query: 116 LKEVKGSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSLHWLSQVPEGLVSESGVPLNK 175
           L++  G   G C I  +PGSFY RLFP +S+HF+HS Y LHWLSQVP GLV+E G+ +NK
Sbjct: 120 LEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLHWLSQVPSGLVTELGISVNK 179

Query: 176 GHICMAKTSPVG----------RDFTLFLTSRSEEILSGGHVLLSIIGNDRKPGDPRCTG 225
           G I  +K S             +DFT FL   SEE++S G +LL+ I   ++        
Sbjct: 180 GCIYSSKASRPPIQKAYLDQFTKDFTTFLRIHSEELISRGRMLLTFIC--KEDEFDHPNS 237

Query: 226 WELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDIHTVDWD 285
            +LL +++ND+V+EG +EE K+D FN+P YAPS EEV+ +++ EGSF I   +     +D
Sbjct: 238 MDLLEMSINDLVIEGHLEEEKLDSFNVPIYAPSTEEVKRIVEEEGSFEILYLETFNAPYD 297

Query: 286 AN-------KDDGSKSLTSGRHTRGKNIAKSIRAVSESMLASHFGEEIMDDLFERLAKKI 338
           A        +      ++   H R  ++A  +R++ E +LASHFGE I+ DL  R+AK  
Sbjct: 298 AGFSIDDDYQGRSHSPVSCDEHARAAHVASVVRSIYEPILASHFGEAILPDLSHRIAKNA 357

Query: 339 SEYLEFAPGHSTTMVISMTK 358
           ++ L    G   +++IS+ K
Sbjct: 358 AKVLRSGKGFYDSVIISLAK 377

PyMOL of 2efj

>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Length = 374	Back alignment and structure

>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Length = 359	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		359
2efj_A		384	3,7-dimethylxanthine methyltransferase; SAM-depend	100.0
1m6e_X		359	S-adenosyl-L-methionnine:salicylic acid carboxyl m	100.0
3b5i_A		374	S-adenosyl-L-methionine:salicylic acid carboxyl me	100.0
3ccf_A		279	Cyclopropane-fatty-acyl-phospholipid synthase; YP_	99.7
2p35_A		259	Trans-aconitate 2-methyltransferase; SAM dependent	99.68
2yqz_A		263	Hypothetical protein TTHA0223; RNA methyltransfera	99.59
3bus_A		273	REBM, methyltransferase; rebeccamycin synthesis; H	99.44
3dtn_A		234	Putative methyltransferase MM_2633; structural gen	99.44
3hem_A		302	Cyclopropane-fatty-acyl-phospholipid synthase 2; p	99.41
3f4k_A		257	Putative methyltransferase; structural genomics, P	99.39
1vl5_A		260	Unknown conserved protein BH2331; putative methylt	99.36
2o57_A		297	Putative sarcosine dimethylglycine methyltransfera	99.34
3kkz_A		267	Uncharacterized protein Q5LES9; putative methyltra	99.34
3ujc_A		266	Phosphoethanolamine N-methyltransferase; parasite;	99.31
4hg2_A		257	Methyltransferase type 11; structural genomics, PS	99.3
1xxl_A		239	YCGJ protein; structural genomics, protein structu	99.3
4htf_A		285	S-adenosylmethionine-dependent methyltransferase;	99.3
2aot_A		292	HMT, histamine N-methyltransferase; classic methyl	99.29
4gek_A		261	TRNA (CMO5U34)-methyltransferase; structural genom	99.29
3hnr_A		220	Probable methyltransferase BT9727_4108; structural	99.29
3ege_A		261	Putative methyltransferase from antibiotic biosyn	99.26
1kpg_A		287	CFA synthase;, cyclopropane-fatty-acyl-phospholipi	99.26
3mgg_A		276	Methyltransferase; NYSGXRC, PSI-II, protein struct	99.24
1pjz_A		203	Thiopurine S-methyltransferase; polymorphism, S-ad	99.24
3dli_A		240	Methyltransferase; PSI-II, NYSGXRC, structural gen	99.23
3h2b_A		203	SAM-dependent methyltransferase; alpha-beta protei	99.23
3lcc_A		235	Putative methyl chloride transferase; halide methy	99.22
3l8d_A		242	Methyltransferase; structural genomics, PSI, nysgr	99.22
1nkv_A		256	Hypothetical protein YJHP; structural genomics, PS	99.22
3ou2_A		218	SAM-dependent methyltransferase; O-methyltransfera	99.21
3sm3_A		235	SAM-dependent methyltransferases; NESG, structural	99.19
1xtp_A		254	LMAJ004091AAA; SGPP, structural genomics, PSI, pro	99.18
2fk8_A		318	Methoxy mycolic acid synthase 4; S-adenosylmethion	99.17
3g5l_A		253	Putative S-adenosylmethionine dependent methyltran	99.16
2p7i_A		250	Hypothetical protein; putative methyltransferase,	99.16
3e8s_A		227	Putative SAM dependent methyltransferase; NP_74470	99.16
3dlc_A		219	Putative S-adenosyl-L-methionine-dependent methylt	99.15
3dh0_A		219	SAM dependent methyltransferase; cystal structure,	99.13
2gb4_A		252	Thiopurine S-methyltransferase; 18204406, thiopuri	99.13
3vc1_A		312	Geranyl diphosphate 2-C-methyltransferase; rossman	99.13
3e23_A		211	Uncharacterized protein RPA2492; alpha-beta protei	99.12
3bkx_A		275	SAM-dependent methyltransferase; YP_807781.1, cycl	99.11
3g5t_A		299	Trans-aconitate 3-methyltransferase; structural ge	99.1
2qe6_A		274	Uncharacterized protein TFU_2867; putative methylt	99.1
2a14_A		263	Indolethylamine N-methyltransferase; SGC,INMT, str	99.09
2g72_A		289	Phenylethanolamine N-methyltransferase; HET: SAM F	99.08
1ri5_A		298	MRNA capping enzyme; methyltransferase, M7G, messe	99.08
3bgv_A		313	MRNA CAP guanine-N7 methyltransferase; alternative	99.08
1vlm_A		219	SAM-dependent methyltransferase; possible histamin	99.08
3mcz_A		352	O-methyltransferase; adomet_mtases, S-adenosylmeth	99.06
3i53_A		332	O-methyltransferase; CO-complex, rossmann-like fol	99.05
3gwz_A		369	MMCR; methyltransferase, mitomycin, S-adenosyl met	99.05
3reo_A		368	(ISO)eugenol O-methyltransferase; directed evoluti	99.05
3cc8_A		230	Putative methyltransferase; structural genomics, j	99.04
3dp7_A		363	SAM-dependent methyltransferase; structural genomi	99.04
3p9c_A		364	Caffeic acid O-methyltransferase; S-adenosylmethio	99.03
3lst_A		348	CALO1 methyltransferase; calicheamicin, enediyne,	99.02
4fsd_A		383	Arsenic methyltransferase; rossmann fold; 1.75A {C	99.01
3bkw_A		243	MLL3908 protein, S-adenosylmethionine dependent me	98.99
2ex4_A		241	Adrenal gland protein AD-003; methyltransferase, s	98.99
3pfg_A		263	N-methyltransferase; N,N-dimethyltransferase, SAM	98.98
1y8c_A		246	S-adenosylmethionine-dependent methyltransferase;	98.97
3g2m_A		299	PCZA361.24; SAM-dependent methyltransferase, glyco	98.97
3giw_A		277	Protein of unknown function DUF574; rossmann-fold	98.97
4a6d_A		353	Hydroxyindole O-methyltransferase; melatonin, circ	98.96
3ocj_A		305	Putative exported protein; structural genomics, PS	98.95
2gs9_A		211	Hypothetical protein TT1324; methyl transferase, s	98.95
3jwh_A		217	HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena	98.95
2r3s_A		335	Uncharacterized protein; methyltransferase domain,	98.94
4e2x_A		416	TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s	98.93
3jwg_A		219	HEN1, methyltransferase type 12; 1.90A {Clostridiu	98.93
2kw5_A		202	SLR1183 protein; structural genomics, northeast st	98.93
3i9f_A		170	Putative type 11 methyltransferase; structural gen	98.92
1fp1_D		372	Isoliquiritigenin 2'-O-methyltransferase; protein-	98.91
2vdw_A		302	Vaccinia virus capping enzyme D1 subunit; nucleoti	98.9
1qzz_A		374	RDMB, aclacinomycin-10-hydroxylase; anthracycline,	98.88
1x19_A		359	CRTF-related protein; methyltransferase, bacterioc	98.88
3bxo_A		239	N,N-dimethyltransferase; desosamine, sugar, carboh	98.87
2ip2_A		334	Probable phenazine-specific methyltransferase; pyo	98.86
3gu3_A		284	Methyltransferase; alpha-beta protein, structural	98.84
2i62_A		265	Nicotinamide N-methyltransferase; structural genom	98.84
2zfu_A		215	Nucleomethylin, cerebral protein 1; nucleolar prot	98.83
2avn_A		260	Ubiquinone/menaquinone biosynthesis methyltransfe	98.83
3ofk_A		216	Nodulation protein S; NODS, N-methyltransferase, S	98.82
1zg3_A		358	Isoflavanone 4'-O-methyltransferase; rossman fold,	98.8
1tw3_A		360	COMT, carminomycin 4-O-methyltransferase; anthracy	98.8
2p8j_A		209	S-adenosylmethionine-dependent methyltransferase;	98.79
2xvm_A		199	Tellurite resistance protein TEHB; antibiotic resi	98.79
3ggd_A		245	SAM-dependent methyltransferase; YP_325210.1, stru	98.78
1ve3_A		227	Hypothetical protein PH0226; dimer, riken structur	98.78
3g07_A		292	7SK snRNA methylphosphate capping enzyme; structur	98.75
1fp2_A		352	Isoflavone O-methyltransferase; protein-product co	98.72
3m70_A		286	Tellurite resistance protein TEHB homolog; structu	98.71
2ld4_A		176	Anamorsin; methyltransferase-like fold, alpha/beta	98.7
3cgg_A		195	SAM-dependent methyltransferase; NP_600671.1, meth	98.69
4df3_A		233	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	98.68
3mq2_A		218	16S rRNA methyltransferase; methyltranferase, ribo	98.67
3hp7_A		291	Hemolysin, putative; structural genomics, APC64019	98.65
3d2l_A		243	SAM-dependent methyltransferase; ZP_00538691.1, st	98.65
3q87_B		170	N6 adenine specific DNA methylase; SAM-methyltrans	98.63
1yzh_A		214	TRNA (guanine-N(7)-)-methyltransferase; alpha-beta	98.61
3thr_A		293	Glycine N-methyltransferase; GNMT, folate, methylt	98.58
3grz_A		205	L11 mtase, ribosomal protein L11 methyltransferase	98.57
3opn_A		232	Putative hemolysin; structural genomics, PSI-2, pr	98.56
3id6_C		232	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	98.53
2fca_A		213	TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac	98.51
3dxy_A		218	TRNA (guanine-N(7)-)-methyltransferase; rossmann f	98.5
2pxx_A		215	Uncharacterized protein MGC2408; structural genomi	98.5
3iv6_A		261	Putative Zn-dependent alcohol dehydrogenase; alpha	98.49
1wzn_A		252	SAM-dependent methyltransferase; structural genomi	98.46
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	98.45
3hm2_A		178	Precorrin-6Y C5,15-methyltransferase; alpha-beta-s	98.45
3p2e_A		225	16S rRNA methylase; methyltransferase, transferase	98.44
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	98.43
1fbn_A		230	MJ fibrillarin homologue; MJ proteins, ribosomal R	98.43
3eey_A		197	Putative rRNA methylase; rRNA methylation, S-adeno	98.42
3q7e_A		349	Protein arginine N-methyltransferase 1; HET: SAH;	98.41
3e05_A		204	Precorrin-6Y C5,15-methyltransferase (decarboxyla;	98.41
3mti_A		185	RRNA methylase; SAM-dependent, PSI, MCSG, structur	98.36
2nxc_A		254	L11 mtase, ribosomal protein L11 methyltransferase	98.35
3r0q_C		376	Probable protein arginine N-methyltransferase 4.2;	98.34
1zx0_A		236	Guanidinoacetate N-methyltransferase; structural g	98.33
3ckk_A		235	TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-	98.3
3dmg_A		381	Probable ribosomal RNA small subunit methyltransf;	98.29
1nt2_A		210	Fibrillarin-like PRE-rRNA processing protein; adeM	98.28
3m33_A		226	Uncharacterized protein; structural genomics, PSI-	98.27
3lbf_A		210	Protein-L-isoaspartate O-methyltransferase; modifi	98.27
1p91_A		269	Ribosomal RNA large subunit methyltransferase A; R	98.25
2fyt_A		340	Protein arginine N-methyltransferase 3; structural	98.24
1vbf_A		231	231AA long hypothetical protein-L-isoaspartate O-	98.23
3evz_A		230	Methyltransferase; NYSGXRC, NEW YORK SGX research	98.22
3fzg_A		200	16S rRNA methylase; methyltransferase, plasmid, tr	98.22
3orh_A		236	Guanidinoacetate N-methyltransferase; structura ge	98.21
4dcm_A		375	Ribosomal RNA large subunit methyltransferase G; 2	98.19
1xdz_A		240	Methyltransferase GIDB; MCSG, protein structure in	98.19
1l3i_A		192	Precorrin-6Y methyltransferase/putative decarboxyl	98.19
2yxe_A		215	Protein-L-isoaspartate O-methyltransferase; rossma	98.19
3p9n_A		189	Possible methyltransferase (methylase); RV2966C, a	98.18
1dus_A		194	MJ0882; hypothetical protein, methanococcus jannas	98.16
3mb5_A		255	SAM-dependent methyltransferase; RNA methyltransfe	98.15
1g6q_1		328	HnRNP arginine N-methyltransferase; SAM-binding do	98.15
2frn_A		278	Hypothetical protein PH0793; structural genomics,	98.13
4dzr_A		215	Protein-(glutamine-N5) methyltransferase, release	98.13
1af7_A		274	Chemotaxis receptor methyltransferase CHER; chemot	98.11
1yb2_A		275	Hypothetical protein TA0852; structural genomics,	98.1
1i1n_A		226	Protein-L-isoaspartate O-methyltransferase; S-aden	98.09
1jsx_A		207	Glucose-inhibited division protein B; methyltransf	98.09
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	98.09
1jg1_A		235	PIMT;, protein-L-isoaspartate O-methyltransferase;	98.09
2ipx_A		233	RRNA 2'-O-methyltransferase fibrillarin; FBL, stru	98.09
3lpm_A		259	Putative methyltransferase; structural genomics, p	98.09
1g8a_A		227	Fibrillarin-like PRE-rRNA processing protein; rRNA	98.09
2b25_A		336	Hypothetical protein; structural genomics, methyl	98.08
2pjd_A		343	Ribosomal RNA small subunit methyltransferase C; g	98.08
3njr_A		204	Precorrin-6Y methylase; methyltransferase, decarbo	98.07
1dl5_A		317	Protein-L-isoaspartate O-methyltransferase; isoasp	98.06
2ozv_A		260	Hypothetical protein ATU0636; structural genomics,	98.06
2pwy_A		258	TRNA (adenine-N(1)-)-methyltransferase; mtase, ado	98.06
3bwc_A		304	Spermidine synthase; SAM, SGPP, structura genomics	98.05
3g89_A		249	Ribosomal RNA small subunit methyltransferase G; 1	98.04
2pbf_A		227	Protein-L-isoaspartate O-methyltransferase beta-A	98.04
2yxd_A		183	Probable cobalt-precorrin-6Y C(15)-methyltransfer	98.03
1i9g_A		280	Hypothetical protein RV2118C; mtase, adoMet, cryst	98.02
3sso_A		419	Methyltransferase; macrolide, natural product, ros	98.02
1r18_A		227	Protein-L-isoaspartate(D-aspartate)-O-methyltrans;	98.02
3adn_A		294	Spermidine synthase; aminopropyltransferase, polya	97.98
3uwp_A		438	Histone-lysine N-methyltransferase, H3 lysine-79;	97.97
4hc4_A		376	Protein arginine N-methyltransferase 6; HRMT1L6, S	97.96
3htx_A		950	HEN1; HEN1, small RNA methyltransferase, protein-R	97.96
3gjy_A		317	Spermidine synthase; APC62791, structural genomics	97.96
1o54_A		277	SAM-dependent O-methyltransferase; TM0748, structu	97.95
2esr_A		177	Methyltransferase; structural genomics, hypothetic	97.93
2gpy_A		233	O-methyltransferase; structural genomics, PSI, pro	97.93
2b3t_A		276	Protein methyltransferase HEMK; translation termin	97.92
3fpf_A		298	Mtnas, putative uncharacterized protein; thermonic	97.91
3tfw_A		248	Putative O-methyltransferase; PSI-biology, nysgrc,	97.89
3ntv_A		232	MW1564 protein; rossmann fold, putative methyltran	97.89
3u81_A		221	Catechol O-methyltransferase; neurotransmitter deg	97.89
3gdh_A		241	Trimethylguanosine synthase homolog; M7G, CAP, dim	97.88
2h00_A		254	Methyltransferase 10 domain containing protein; st	97.88
1o9g_A		250	RRNA methyltransferase; antibiotic resistance, Se-	97.87
2vdv_E		246	TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl	97.85
2y1w_A		348	Histone-arginine methyltransferase CARM1; histone	97.84
3dr5_A		221	Putative O-methyltransferase; Q8NRD3, CGL1119, PF0	97.84
2xyq_A		290	Putative 2'-O-methyl transferase; transferase-vira	97.83
1uir_A		314	Polyamine aminopropyltransferase; spermidien synth	97.81
3bzb_A		281	Uncharacterized protein; RED ALGA, protein structu	97.76
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	97.75
1ws6_A		171	Methyltransferase; structural genomics, riken stru	97.75
2fhp_A		187	Methylase, putative; alpha-beta-alpha sandwich, st	97.75
2ift_A		201	Putative methylase HI0767; NESG, Y767_haein, struc	97.75
2fpo_A		202	Methylase YHHF; structural genomics, putative meth	97.74
3r3h_A		242	O-methyltransferase, SAM-dependent; structural gen	97.74
1u2z_A		433	Histone-lysine N-methyltransferase, H3 lysine-79 s	97.72
2bm8_A		236	Cephalosporin hydroxylase CMCI; cephamycin biosynt	97.71
2hnk_A		239	SAM-dependent O-methyltransferase; modified rossma	97.7
2o07_A		304	Spermidine synthase; structural genomics, structur	97.68
3duw_A		223	OMT, O-methyltransferase, putative; alternating of	97.68
1inl_A		296	Spermidine synthase; beta-barrel, rossman fold, st	97.66
3tma_A		354	Methyltransferase; thump domain; 2.05A {Thermus th	97.61
3tr6_A		225	O-methyltransferase; cellular processes; HET: SAH;	97.61
1xj5_A		334	Spermidine synthase 1; structural genomics, protei	97.59
2p41_A		305	Type II methyltransferase; vizier, viral enzymes i	97.59
2i7c_A		283	Spermidine synthase; transferase, structural genom	97.59
2b2c_A		314	Spermidine synthase; beta-alpha, transferase; 2.50	97.58
2oxt_A		265	Nucleoside-2'-O-methyltransferase; flavivirus, vir	97.57
2pt6_A		321	Spermidine synthase; transferase, structural genom	97.57
1iy9_A		275	Spermidine synthase; rossmann fold, structural gen	97.56
1mjf_A		281	Spermidine synthase; spermidine synthetase, struct	97.55
1ixk_A		315	Methyltransferase; open beta sheet; 1.90A {Pyrococ	97.53
2wa2_A		276	Non-structural protein 5; transferase, S-adenosyl-	97.52
1sui_A		247	Caffeoyl-COA O-methyltransferase; rossmann fold, p	97.51
3c3y_A		237	Pfomt, O-methyltransferase; plant secondary metabo	97.48
2yvl_A		248	TRMI protein, hypothetical protein; tRNA, methyltr	97.45
3c3p_A		210	Methyltransferase; NP_951602.1, structural genomic	97.45
3lec_A		230	NADB-rossmann superfamily protein; PSI, MCSG, stru	97.44
3kr9_A		225	SAM-dependent methyltransferase; class I rossmann-	97.4
1sqg_A		429	SUN protein, FMU protein; rossmann-fold, mixed bet	97.38
3a27_A		272	TYW2, uncharacterized protein MJ1557; wybutosine m	97.38
3lcv_B		281	Sisomicin-gentamicin resistance methylase SGM; ant	97.36
3frh_A		253	16S rRNA methylase; methyltransferase domain, heli	97.35
3ajd_A		274	Putative methyltransferase MJ0026; tRNA, M5C, ross	97.35
3gnl_A		244	Uncharacterized protein, DUF633, LMOF2365_1472; st	97.28
3b3j_A		480	Histone-arginine methyltransferase CARM1; protein	97.26
2avd_A		229	Catechol-O-methyltransferase; structural genomics,	97.26
3cbg_A		232	O-methyltransferase; cyanobacterium; HET: SAH FER	97.26
1nv8_A		284	HEMK protein; class I adoMet-dependent methyltrans	97.25
1ne2_A		200	Hypothetical protein TA1320; structural genomics,	97.23
2yxl_A		450	PH0851 protein, 450AA long hypothetical FMU protei	97.21
2frx_A		479	Hypothetical protein YEBU; rossmann-type S-adenosy	97.19
2igt_A		332	SAM dependent methyltransferase; alpha-beta sandwi	97.19
3m6w_A		464	RRNA methylase; rRNA methyltransferase, 5-methylcy	97.1
2cmg_A		262	Spermidine synthase; transferase, putrescine amino	97.08
1zq9_A		285	Probable dimethyladenosine transferase; SGC, struc	97.01
1wy7_A		207	Hypothetical protein PH1948; seven-stranded beta s	96.96
2f8l_A		344	Hypothetical protein LMO1582; structural genomics,	96.96
3gru_A		295	Dimethyladenosine transferase; rossman fold, ribos	96.82
3k6r_A		278	Putative transferase PH0793; structural genomics,	96.82
1wxx_A		382	TT1595, hypothetical protein TTHA1280; thermus the	96.82
1yub_A		245	Ermam, rRNA methyltransferase; MLS antibiotics; NM	96.79
3tm4_A		373	TRNA (guanine N2-)-methyltransferase TRM14; rossma	96.71
2yx1_A		336	Hypothetical protein MJ0883; methyl transferase, t	96.71
2ih2_A		421	Modification methylase TAQI; DNA, DNA methyltransf	96.67
4dmg_A		393	Putative uncharacterized protein TTHA1493; rRNA, m	96.65
2qm3_A		373	Predicted methyltransferase; putative methyltransf	96.63
3m4x_A		456	NOL1/NOP2/SUN family protein; mtase domain, PUA do	96.57
4azs_A		569	Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15	96.54
4gqb_A		637	Protein arginine N-methyltransferase 5; TIM barrel	96.49
2b78_A		385	Hypothetical protein SMU.776; structure genomics,	96.42
1qam_A		244	ERMC' methyltransferase; rRNA methyltransferase ER	96.36
2as0_A		396	Hypothetical protein PH1915; RNA methyltransferase	96.33
2h1r_A		299	Dimethyladenosine transferase, putative; SGC toron	96.17
3fut_A		271	Dimethyladenosine transferase; methyltransferase,	96.0
3c0k_A		396	UPF0064 protein YCCW; PUA domain, adoMet dependent	95.87
3khk_A		544	Type I restriction-modification system methylation	95.86
2okc_A		445	Type I restriction enzyme stysji M protein; NP_813	95.81
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	95.73
2qy6_A		257	UPF0209 protein YFCK; structural genomics, unknown	95.7
3evf_A		277	RNA-directed RNA polymerase NS5; NS5 methyltransfe	95.61
2jjq_A		425	Uncharacterized RNA methyltransferase pyrab10780;	95.48
3ua3_A		745	Protein arginine N-methyltransferase 5; TIM-barrel	95.31
2dul_A		378	N(2),N(2)-dimethylguanosine tRNA methyltransferas;	95.25
3tqs_A		255	Ribosomal RNA small subunit methyltransferase A; p	95.17
1uwv_A		433	23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m	95.04
2qfm_A		364	Spermine synthase; spermidine aminopropyltransfera	94.75
3lkd_A		542	Type I restriction-modification system methyltrans	94.72
3k0b_A		393	Predicted N6-adenine-specific DNA methylase; methy	94.29
3axs_A		392	Probable N(2),N(2)-dimethylguanosine tRNA methylt	93.79
1qyr_A		252	KSGA, high level kasugamycin resistance protein, S	93.69
3ldu_A		385	Putative methylase; structural genomics, PSI-2, pr	93.39
3ldg_A		384	Putative uncharacterized protein SMU.472; YPSC, me	93.19
2ar0_A		541	M.ecoki, type I restriction enzyme ecoki M protein	93.11
3uzu_A		279	Ribosomal RNA small subunit methyltransferase A; s	93.07
2b9e_A		309	NOL1/NOP2/SUN domain family, member 5 isoform 2; m	92.58
3gcz_A		282	Polyprotein; flavivirus, RNA capping, methyltransf	92.07
3s1s_A		878	Restriction endonuclease bpusi; PD--(D/E)XK cataly	92.04
3ftd_A		249	Dimethyladenosine transferase; KSGA, rossmann-like	91.8
3r24_A		344	NSP16, 2'-O-methyl transferase; methyltransferase,	90.95
3vyw_A		308	MNMC2; tRNA wobble uridine, modification enzyme, g	90.89
3eld_A		300	Methyltransferase; flavivirus, RNA capping, guanyl	89.45
1m6y_A		301	S-adenosyl-methyltransferase MRAW; SAM-dependent m	89.31
2k4m_A		153	TR8_protein, UPF0146 protein MTH_1000; alpha+beta,	88.66
4auk_A		375	Ribosomal RNA large subunit methyltransferase M; Y	87.8
2wk1_A		282	NOVP; transferase, O-methyltransferase, novobiocin	85.46
3o4f_A		294	Spermidine synthase; aminopropyltransferase, polya	85.38
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	81.43
3pvc_A		689	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	80.77
2r6z_A		258	UPF0341 protein in RSP 3' region; alpha-beta prote	80.37

>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A*	Back alignment and structure

Probab=100.00  E-value=2.1e-92  Score=697.36  Aligned_cols=353  Identities=46%  Similarity=0.827  Sum_probs=305.9

Q ss_pred             CcccceeeccCCCCcchHHHhhHHHHHHHHHhHHHHHHHHHHhhhcCCCC---cceEEeecCCCCcchHHHHHHHHHHHH
Q 036911            1 MEVQQVLCMNGGRGDTSYANNSKIQKRAMLTAKPILQDSIKKLYCNRLPE---CLKIADLGCSSGPNTLSLLWEIIDTID   77 (359)
Q Consensus         1 ~~~~~~l~M~gG~g~~sY~~ns~~Q~~~~~~~~~~l~~ai~~~~~~~~~~---~~~IaDlGCs~G~nt~~l~~~ii~~i~   77 (359)
                      |+++++|||+||+|++||++||. |++++..++|++++||++++....|+   +++|||||||+|+||+.+++.||++|+
T Consensus         1 m~~~~~~~M~gg~G~~sY~~nS~-Q~~~~~~~~~~~~~ai~~l~~~~~~~~~~~~~IaDlGCssG~NT~~~v~~ii~~i~   79 (384)
T 2efj_A            1 MELQEVLHMNGGEGDTSYAKNSS-YNLFLIRVKPVLEQCIQELLRANLPNINKCFKVGDLGCASGPNTFSTVRDIVQSID   79 (384)
T ss_dssp             --CTTTCCCCC----CCHHHHCC-TTTTHHHHHHHHHHHHHHHHHTTCTTTTTEEEEEEETCCSSHHHHHHHHHHHHHHT
T ss_pred             CCcccccccCCCCChhhHHHhHH-HHHHHHHHHHHHHHHHHHhhhcccCCcCCceEEEecCCCCCchHHHHHHHHHHHHH
Confidence            89999999999999999999999 99999999999999999998754565   899999999999999999999999999


Q ss_pred             HHhhh--ccCCCCcceEEecCCCCCchhhhhhcccchHHHHHHhhCCCCCCeEEecccCCcccCCCCCCceeEEEecccc
Q 036911           78 GTCKR--LNREAPMYQVFLNDLPGNDFNTIFKSLPGFYEKLKEVKGSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSL  155 (359)
Q Consensus        78 ~~~~~--~~~~~p~~~v~~nDLp~NDFn~lF~~l~~~~~~~~~~~~~~~~~~f~~~v~gsFy~~lfp~~S~d~~~S~~al  155 (359)
                      ++|.+  .+.++|++||++||||+||||+||++||.+.+++.+..|...++||++|||||||+||||++|+|++||++||
T Consensus        80 ~~~~~~~~~~~~pe~~v~~nDLp~NDFN~lF~~L~~~~~~~~~~~g~~~~~~f~~gvpgSFy~rlfp~~S~d~v~Ss~aL  159 (384)
T 2efj_A           80 KVGQEKKNELERPTIQIFLNDLFQNDFNSVFKLLPSFYRNLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCL  159 (384)
T ss_dssp             CC----------CEEEEEEECCTTSCHHHHHHHHHHHHHHHHHHTCCCTTSEEEEECCSCTTSCCSCTTCEEEEEEESCT
T ss_pred             HHhhhcccCCCCCceEEEecCCCccchHHHHhhhhhhHhhhhhhccCCCCceEEEecchhhhhccCCCCceEEEEeccee
Confidence            99865  4556789999999999999999999999998887666666557899999999999999999999999999999


Q ss_pred             cccccCCCCccccCCCCCCCcceeecCCCCc----------cccHHHHHHHHHHhhccCceEEEEEecCCCCCC--CCch
Q 036911          156 HWLSQVPEGLVSESGVPLNKGHICMAKTSPV----------GRDFTLFLTSRSEEILSGGHVLLSIIGNDRKPG--DPRC  223 (359)
Q Consensus       156 hWls~~p~~~~~~~~~~~n~g~i~~~~~~~~----------~~d~~~fL~~Ra~EL~pGG~l~~~~~g~~~~~~--~~~~  223 (359)
                      ||||++|..+.++.+++||||+||+++++|+          ++||..||++|++||||||+|+++++|+++  .  +++ 
T Consensus       160 HWls~~p~~l~~~~s~~~nkg~i~i~~~sp~~v~~ay~~Qf~~D~~~FL~~Ra~eL~pGG~mvl~~~gr~~--~~~~~~-  236 (384)
T 2efj_A          160 HWLSQVPSGLVTELGISVNKGCIYSSKASRPPIQKAYLDQFTKDFTTFLRIHSEELISRGRMLLTFICKED--EFDHPN-  236 (384)
T ss_dssp             TBCSSSCCC------CCCCTTCSSSCTTSCHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEECCCT--TTCCCC-
T ss_pred             eecCCCchhhhccccccccCCceEecCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhccCCeEEEEEecCCC--cccCcc-
Confidence            9999999999999999999999999999976          899999999999999999999999999998  5  554 


Q ss_pred             hHHHHHHHHHHHHHHhccchhhhhccCCcCccCCCHHHHHHHHhcCCceEEeEEEEEeecCCCCC---CCCC---ccc--
Q 036911          224 TGWELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDIHTVDWDANK---DDGS---KSL--  295 (359)
Q Consensus       224 ~~~~~l~~al~~mv~eGli~~e~~d~f~~P~y~~s~~E~~~~i~~~Gsf~i~~~e~~~~~~~~~~---~~~~---~~~--  295 (359)
                       ..+.+.++|++||.+|+|+++++|+|++|+|+||++|++++|+++|+|+|+++|.++.+|++ +   ++..   ...  
T Consensus       237 -~~~~l~~al~~lv~eGli~~ek~dsf~~P~y~ps~~E~~~~le~~g~F~i~~le~~~~~~~~-~~~~~~~~~~~~~~~~  314 (384)
T 2efj_A          237 -SMDLLEMSINDLVIEGHLEEEKLDSFNVPIYAPSTEEVKRIVEEEGSFEILYLETFNAPYDA-GFSIDDDYQGRSHSPV  314 (384)
T ss_dssp             -HHHHHHHHHHHHHHHTSSCHHHHHTCCCSBCCCCHHHHHHHHHHHCSEEEEEEEEEEEETTT-TCCC---------CCS
T ss_pred             -cHHHHHHHHHHHHHhCCcchhhhcccCCcccCCCHHHHHHHHHHcCCceEEEEEEEeecccc-cccccccccccccccc
Confidence             12389999999999999999999999999999999999999999999999999999999987 4   3210   000  


Q ss_pred             ccccccchhHHHHHHHHHhHHHHHhhcChhHHHHHHHHHHHHHHHHHhhCCCCEEEEEEEEeeC
Q 036911          296 TSGRHTRGKNIAKSIRAVSESMLASHFGEEIMDDLFERLAKKISEYLEFAPGHSTTMVISMTKS  359 (359)
Q Consensus       296 ~~d~~~~~~~~~~~~Ra~~ep~l~~h~~~~i~delf~r~~~~~~~~~~~~~~~~~~~~~~l~r~  359 (359)
                      ..|.+..|+.+++++||++||+|.+|||++++|+||+||++++++++..++++|++++++|+||
T Consensus       315 ~~d~~~~g~~~a~~iRa~~epll~~hfG~~i~d~lF~ry~~~~~~~~~~~~~~~~~~~~~L~k~  378 (384)
T 2efj_A          315 SCDEHARAAHVASVVRSIYEPILASHFGEAILPDLSHRIAKNAAKVLRSGKGFYDSVIISLAKK  378 (384)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHCSTTHHHHHHHHHHHHHHHHHHTCCEEEEEEEEEEEC
T ss_pred             cchHhHhHHHhhhhhHHhhhhhhHHhccHHHHHHHHHHHHHHHHHHHhhCCCceEEEEEEEEEc
Confidence            0023578999999999999999999999999999999999999999999999999999999997

PyMOL of 2efj

>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35	Back alignment and structure

>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana}	Back alignment and structure

>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str}	Back alignment and structure

>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A	Back alignment and structure

>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes}	Back alignment and structure

>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei}	Back alignment and structure

>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A*	Back alignment and structure

>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A*	Back alignment and structure

>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41	Back alignment and structure

>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18	Back alignment and structure

>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A*	Back alignment and structure

>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A*	Back alignment and structure

>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans}	Back alignment and structure

>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*	Back alignment and structure

>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli}	Back alignment and structure

>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A*	Back alignment and structure

>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A*	Back alignment and structure

>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian}	Back alignment and structure

>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413}	Back alignment and structure

>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A*	Back alignment and structure

>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei}	Back alignment and structure

>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36	Back alignment and structure

>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus}	Back alignment and structure

>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana}	Back alignment and structure

>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis}	Back alignment and structure

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21	Back alignment and structure

>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A*	Back alignment and structure

>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei}	Back alignment and structure

>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42	Back alignment and structure

>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A*	Back alignment and structure

>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}	Back alignment and structure

>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A	Back alignment and structure

>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440}	Back alignment and structure

>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}	Back alignment and structure

>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus}	Back alignment and structure

>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*	Back alignment and structure

>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A*	Back alignment and structure

>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris}	Back alignment and structure

>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei}	Back alignment and structure

>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae}	Back alignment and structure

>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca}	Back alignment and structure

>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15	Back alignment and structure

>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ...	Back alignment and structure

>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A*	Back alignment and structure

>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A*	Back alignment and structure

>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis}	Back alignment and structure

>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A*	Back alignment and structure

>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A*	Back alignment and structure

>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A*	Back alignment and structure

>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus}	Back alignment and structure

>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus}	Back alignment and structure

>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A*	Back alignment and structure

>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora}	Back alignment and structure

>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A	Back alignment and structure

>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42	Back alignment and structure

>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A*	Back alignment and structure

>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43	Back alignment and structure

>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A*	Back alignment and structure

>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A*	Back alignment and structure

>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A*	Back alignment and structure

>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis}	Back alignment and structure

>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus}	Back alignment and structure

>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A	Back alignment and structure

>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme}	Back alignment and structure

>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A*	Back alignment and structure

>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A	Back alignment and structure

>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A	Back alignment and structure

>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A*	Back alignment and structure

>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus}	Back alignment and structure

>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A*	Back alignment and structure

>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A*	Back alignment and structure

>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae}	Back alignment and structure

>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa}	Back alignment and structure

>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A	Back alignment and structure

>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A*	Back alignment and structure

>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens}	Back alignment and structure

>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A*	Back alignment and structure

>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A*	Back alignment and structure

>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A*	Back alignment and structure

>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}	Back alignment and structure

>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A*	Back alignment and structure

>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413}	Back alignment and structure

>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens}	Back alignment and structure

>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A*	Back alignment and structure

>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae}	Back alignment and structure

>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A	Back alignment and structure

>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix}	Back alignment and structure

>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP}	Back alignment and structure

>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus}	Back alignment and structure

>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}	Back alignment and structure

>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53	Back alignment and structure

>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A*	Back alignment and structure

>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp}	Back alignment and structure

>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp}	Back alignment and structure

>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E*	Back alignment and structure

>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53	Back alignment and structure

>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A*	Back alignment and structure

>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}	Back alignment and structure

>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides}	Back alignment and structure

>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*	Back alignment and structure

>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae}	Back alignment and structure

>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A*	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum}	Back alignment and structure

>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A	Back alignment and structure

>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A*	Back alignment and structure

>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0	Back alignment and structure

>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A*	Back alignment and structure

>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A*	Back alignment and structure

>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana}	Back alignment and structure

>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens}	Back alignment and structure

>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A*	Back alignment and structure

>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3	Back alignment and structure

>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans}	Back alignment and structure

>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli}	Back alignment and structure

>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33	Back alignment and structure

>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A*	Back alignment and structure

>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7	Back alignment and structure

>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus}	Back alignment and structure

>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli}	Back alignment and structure

>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli}	Back alignment and structure

>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20	Back alignment and structure

>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*	Back alignment and structure

>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4	Back alignment and structure

>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*	Back alignment and structure

>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6	Back alignment and structure

>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A*	Back alignment and structure

>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A*	Back alignment and structure

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13	Back alignment and structure

>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*	Back alignment and structure

>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens}	Back alignment and structure

>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A*	Back alignment and structure

>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens}	Back alignment and structure

>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes}	Back alignment and structure

>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A	Back alignment and structure

>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13	Back alignment and structure

>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli}	Back alignment and structure

>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus}	Back alignment and structure

>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1	Back alignment and structure

>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str}	Back alignment and structure

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus}	Back alignment and structure

>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A*	Back alignment and structure

>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A*	Back alignment and structure

>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum}	Back alignment and structure

>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii}	Back alignment and structure

>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13	Back alignment and structure

>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A*	Back alignment and structure

>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7	Back alignment and structure

>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A*	Back alignment and structure

>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens}	Back alignment and structure

>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana}	Back alignment and structure

>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13	Back alignment and structure

>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46	Back alignment and structure

>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans}	Back alignment and structure

>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*	Back alignment and structure

>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A*	Back alignment and structure

>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus}	Back alignment and structure

>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ...	Back alignment and structure

>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A*	Back alignment and structure

>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54	Back alignment and structure

>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A	Back alignment and structure

>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E	Back alignment and structure

>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A	Back alignment and structure

>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum}	Back alignment and structure

>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A*	Back alignment and structure

>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A*	Back alignment and structure

>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae}	Back alignment and structure

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0	Back alignment and structure

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46	Back alignment and structure

>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46	Back alignment and structure

>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46	Back alignment and structure

>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46	Back alignment and structure

>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp}	Back alignment and structure

>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31	Back alignment and structure

>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A*	Back alignment and structure

>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans}	Back alignment and structure

>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A*	Back alignment and structure

>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A*	Back alignment and structure

>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A*	Back alignment and structure

>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus}	Back alignment and structure

>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A	Back alignment and structure

>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A*	Back alignment and structure

>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A*	Back alignment and structure

>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17	Back alignment and structure

>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus}	Back alignment and structure

>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A*	Back alignment and structure

>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17	Back alignment and structure

>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A*	Back alignment and structure

>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38	Back alignment and structure

>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A*	Back alignment and structure

>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A*	Back alignment and structure

>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum}	Back alignment and structure

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus}	Back alignment and structure

>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca}	Back alignment and structure

>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae}	Back alignment and structure

>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A*	Back alignment and structure

>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A	Back alignment and structure

>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A*	Back alignment and structure

>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A*	Back alignment and structure

>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A	Back alignment and structure

>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus}	Back alignment and structure

>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1	Back alignment and structure

>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP}	Back alignment and structure

>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A*	Back alignment and structure

>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32	Back alignment and structure

>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii}	Back alignment and structure

>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli}	Back alignment and structure

>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51	Back alignment and structure

>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A*	Back alignment and structure

>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A	Back alignment and structure

>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24	Back alignment and structure

>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32	Back alignment and structure

>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45	Back alignment and structure

>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A*	Back alignment and structure

>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A*	Back alignment and structure

>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A*	Back alignment and structure

>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24	Back alignment and structure

>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A*	Back alignment and structure

>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A*	Back alignment and structure

>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A*	Back alignment and structure

>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus}	Back alignment and structure

>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}	Back alignment and structure

>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium}	Back alignment and structure

>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A*	Back alignment and structure

>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A*	Back alignment and structure

>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A*	Back alignment and structure

>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A	Back alignment and structure

>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51	Back alignment and structure

>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum}	Back alignment and structure

>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A*	Back alignment and structure

>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12}	Back alignment and structure

>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei}	Back alignment and structure

>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli}	Back alignment and structure

>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A*	Back alignment and structure

>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A*	Back alignment and structure

>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A	Back alignment and structure

>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A*	Back alignment and structure

>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A*	Back alignment and structure

>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus}	Back alignment and structure

>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A*	Back alignment and structure

>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A	Back alignment and structure

>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile}	Back alignment and structure

>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans}	Back alignment and structure

>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B*	Back alignment and structure

>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei}	Back alignment and structure

>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38	Back alignment and structure

>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus}	Back alignment and structure

>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus}	Back alignment and structure

>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B*	Back alignment and structure

>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus}	Back alignment and structure

>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A*	Back alignment and structure

>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A*	Back alignment and structure

>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A*	Back alignment and structure

>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str}	Back alignment and structure

>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A*	Back alignment and structure

>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus}	Back alignment and structure

>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli}	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A*	Back alignment and structure

>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		359
d1m6ex_		359	c.66.1.35 (X:) Salicylic acid carboxyl methyltrans	1e-141

>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Length = 359	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

 Score =  401 bits (1032), Expect = e-141
 Identities = 164/374 (43%), Positives = 218/374 (58%), Gaps = 34/374 (9%)

Query: 1   MEVQQVLCMNGGRGDTSYANNSKIQKRAMLTAKPILQDSIKKLYCNRL-PECLKIADLGC 59
           M+V+QVL M GG G+ SYA NS IQ++ +   KPI + +I  LY        L IADLGC
Sbjct: 1   MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTVTTRLAIADLGC 60

Query: 60  SSGPNTLSLLWEIIDTIDGTCKRLNRE-APMYQVFLNDLPGNDFNTIFKSLPGFYEKLKE 118
           SSGPN L  + E+I T++   K++ RE +P YQ+FLNDLPGNDFN IF+SLP   +    
Sbjct: 61  SSGPNALFAVTELIKTVEELRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIENDV--- 117

Query: 119 VKGSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSLHWLSQVPEGLVSESGVPLNKGHI 178
                 G CFI G+PGSFYGRLFP  +LHF+HSSYSL WLSQVP G+        NKG+I
Sbjct: 118 -----DGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGI------ESNKGNI 166

Query: 179 CMAKTSP----------VGRDFTLFLTSRSEEILSGGHVLLSIIGNDRKPGDPRCTG--- 225
            MA T P             D  LFL  R++E++ GG ++L+I+G  R+  D   T    
Sbjct: 167 YMANTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILG--RRSEDRASTECCL 224

Query: 226 -WELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDIHTVDW 284
            W+LL + LN MV EGL+EE K+D FN+P Y PSP EV   I  EGSF I   +   + W
Sbjct: 225 IWQLLAMALNQMVSEGLIEEEKMDKFNIPQYTPSPTEVEAEILKEGSFLIDHIEASEIYW 284

Query: 285 DANKDDGSKSLTSGRHTRGKNIAKSIRAVSESMLASHFGEEIMDDLFERLAKKISEYLEF 344
            +   DG           G N+A+ +RAV+E +L  HFGE I++D+F R    I E +  
Sbjct: 285 SSCTKDGDG--GGSVEEEGYNVARCMRAVAEPLLLDHFGEAIIEDVFHRYKLLIIERMSK 342

Query: 345 APGHSTTMVISMTK 358
                  +++S+ +
Sbjct: 343 EKTKFINVIVSLIR 356

PyMOL of d1m6ex_

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		359
d1m6ex_		359	Salicylic acid carboxyl methyltransferase (SAMT) {	100.0
d1vl5a_		231	Hypothetical protein BH2331 {Bacillus halodurans [	99.47
d1xxla_		234	Hypothetical protein YcgJ {Bacillus subtilis [TaxI	99.42
d1xtpa_		254	Hypothetical protein Lmaj004091aaa (LmjF30.0810) {	99.41
d1im8a_		225	Hypothetical protein HI0319 (YecO) {Haemophilus in	99.4
d2o57a1		282	Putative sarcosine dimethylglycine methyltransfera	99.39
d2a14a1		257	Indolethylamine N-methyltransferase, INMT {Human (	99.37
d1vlma_		208	Possible histamine N-methyltransferase TM1293 {The	99.36
d1ve3a1		226	Hypothetical protein PH0226 {Archaeon Pyrococcus h	99.34
d1tw3a2		253	Carminomycin 4-O-methyltransferase {Streptomyces p	99.3
d1nkva_		245	Hypothetical Protein YjhP {Escherichia coli [TaxId	99.3
d2ex4a1		222	Adrenal gland protein AD-003 (C9orf32) {Human (Hom	99.29
d2fk8a1		280	Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri	99.28
d1jqea_		280	Histamine methyltransferase {Human (Homo sapiens)	99.26
d1kpia_		291	CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	99.21
d2g72a1		263	Phenylethanolamine N-methyltransferase, PNMTase {H	99.21
d1pjza_		201	Thiopurine S-methyltransferase {Pseudomonas syring	99.19
d1qzza2		256	Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu	99.15
d2avna1		246	Hypothetical methyltransferase TM1389 {Thermotoga	99.1
d2bzga1		229	Thiopurine S-methyltransferase {Human (Homo sapien	99.08
d2p7ia1		225	Hypothetical protein ECA1738 {Erwinia carotovora [	99.06
d1p91a_		268	rRNA methyltransferase RlmA {Escherichia coli [Tax	99.05
d1kpga_		285	CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	99.03
d1fp1d2		244	Chalcone O-methyltransferase {Alfalfa (Medicago sa	98.99
d2i6ga1		198	Putative methyltransferase TehB {Salmonella typhim	98.96
d1y8ca_		246	Putative methyltransferase CAC2371 {Clostridium ac	98.95
d1wzna1		251	Hypothetical methyltransferase PH1305 {Archaeon Py	98.92
d1ri5a_		252	mRNA cap (Guanine N-7) methyltransferase {Fungus (	98.84
d2gh1a1		281	Methyltransferase BC2162 {Bacillus cereus [TaxId:	98.77
d1fp2a2		244	Isoflavone O-methyltransferase {Alfalfa (Medicago	98.77
d1g8sa_		230	Fibrillarin homologue {Archaeon Methanococcus jann	98.75
d1kyza2		243	Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra	98.66
d2fcaa1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil	98.6
d1yb2a1		250	Hypothetical protein Ta0852 {Thermoplasma acidophi	98.46
d1oria_		316	Protein arginine N-methyltransferase 1, PRMT1 {Rat	98.45
d1yzha1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep	98.44
d1dl5a1		213	Protein-L-isoaspartyl O-methyltransferase {Thermot	98.44
d1g6q1_		328	Arginine methyltransferase, HMT1 {Baker's yeast (S	98.43
d2nxca1		254	PrmA-like protein TTHA0656 (TT0836) {Thermus therm	98.42
d1i9ga_		264	Probable methyltransferase Rv2118c {Mycobacterium	98.36
d1nt2a_		209	Fibrillarin homologue {Archaeon Archaeoglobus fulg	98.34
d1xvaa_		292	Glycine N-methyltransferase {Rat (Rattus norvegicu	98.34
d1i1na_		224	Protein-L-isoaspartyl O-methyltransferase {Human (	98.31
d2fyta1		311	Protein arginine N-methyltransferase 3, PRMT3 {Hum	98.29
d1dusa_		194	Hypothetical protein MJ0882 {Archaeon Methanococcu	98.26
d1zx0a1		229	Guanidinoacetate methyltransferase {Human (Homo sa	98.23
d1g8aa_		227	Fibrillarin homologue {Archaeon Pyrococcus horikos	98.2
d1l3ia_		186	Precorrin-6Y methyltransferase (CbiT) {Archaeon Me	98.19
d1vbfa_		224	Protein-L-isoaspartyl O-methyltransferase {Sulfolo	97.86
d1o54a_		266	Hypothetical protein TM0748 {Thermotoga maritima [	97.85
d1nw3a_		328	Catalytic, N-terminal domain of histone methyltran	97.77
d2b3ta1		274	N5-glutamine methyltransferase, HemK {Escherichia	97.76
d2b25a1		324	Hypothetical protein FLJ20628 {Human (Homo sapiens	97.59
d1u2za_		406	Catalytic, N-terminal domain of histone methyltran	97.56
d1r18a_		223	Protein-L-isoaspartyl O-methyltransferase {Fruit f	97.55
d1af7a2		193	Chemotaxis receptor methyltransferase CheR, C-term	97.23
d1jg1a_		215	Protein-L-isoaspartyl O-methyltransferase {Archaeo	97.09
d2frna1		260	Hypothetical protein PH0793 {Pyrococcus horikoshii	96.81
d1wxxa2		318	Hypothetical protein TTHA1280, middle and C-termin	96.7
d1nv8a_		271	N5-glutamine methyltransferase, HemK {Thermotoga m	96.53
d2h00a1		250	Methyltransferase 10 domain containing protein MET	96.41
d2esra1		152	Putative methyltransferase SPy1538 {Streptococcus	96.06
d1m6ya2		192	TM0872, methyltransferase domain {Thermotoga marit	95.9
d2as0a2		324	Hypothetical protein PH1915, middle and C-terminal	95.74
d2f8la1		328	Hypothetical protein Lmo1582 {Listeria monocytogen	95.55
d2ih2a1		223	DNA methylase TaqI, N-terminal domain {Thermus aqu	95.15
d2igta1		309	Putative methyltransferase Atu0340 {Agrobacterium	94.93
d2avda1		219	COMT domain-containing protein 1, COMTD1 {Human (H	94.81
d1susa1		227	Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag	94.35
d2b78a2		317	Hypothetical protein SMu776, middle and C-terminal	94.08
d2cl5a1		214	Catechol O-methyltransferase, COMT {Rat (Rattus no	93.9
d1ej0a_		180	RNA methyltransferase FtsJ {Escherichia coli [TaxI	93.12
d1yuba_		245	rRNA adenine dimethylase {Streptococcus pneumoniae	92.14
d1ws6a1		171	Methyltransferase TTHA0928 {Thermus thermophilus [	91.43
d1qama_		235	rRNA adenine dimethylase {Bacillus subtilis, Ermc'	91.39
d1uira_		312	Spermidine synthase {Thermus thermophilus [TaxId:	91.25
d1ne2a_		197	Hypothetical protein Ta1320 {Archaeon Thermoplasma	90.67
d1wy7a1		201	Hypothetical protein PH1948 {Archaeon Pyrococcus h	89.9
d2ifta1		183	Putative methylase HI0767 {Haemophilus influenzae	88.86
d1mjfa_		276	Putative spermidine synthetase PF0127 (SpeE) {Arch	87.85
d1eg2a_		279	m.RsrI N6 adenosine-specific DNA methyltransferase	83.15
d2okca1		425	Type I restriction enzyme StySJI M protein {Bacter	82.89
d1inla_		295	Spermidine synthase {Thermotoga maritima [TaxId: 2	82.55
d1g60a_		256	Methyltransferase mboII {Moraxella bovis [TaxId: 4	82.36
d2fpoa1		183	Methylase YhhF {Escherichia coli [TaxId: 562]}	82.07
d1sqga2		284	Ribosomal RNA small subunit methyltransferase B, R	81.53

>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

Probab=100.00  E-value=2.8e-99  Score=736.48  Aligned_cols=341  Identities=47%  Similarity=0.819  Sum_probs=314.7

Q ss_pred             CcccceeeccCCCCcchHHHhhHHHHHHHHHhHHHHHHHHHHhhhcC-CCCcceEEeecCCCCcchHHHHHHHHHHHHHH
Q 036911            1 MEVQQVLCMNGGRGDTSYANNSKIQKRAMLTAKPILQDSIKKLYCNR-LPECLKIADLGCSSGPNTLSLLWEIIDTIDGT   79 (359)
Q Consensus         1 ~~~~~~l~M~gG~g~~sY~~ns~~Q~~~~~~~~~~l~~ai~~~~~~~-~~~~~~IaDlGCs~G~nt~~l~~~ii~~i~~~   79 (359)
                      |++++||||+||+|++||++||.+|+++++.++|+|++||.+++... .+++++|||||||+|+||+.+++.||++|+++
T Consensus         1 m~~~~~l~M~gG~G~~SYa~NS~~Q~~~i~~~kp~leeai~~~~~~~~~~~~~~IADlGCS~G~Ntl~~v~~iI~~i~~~   80 (359)
T d1m6ex_           1 MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTVTTRLAIADLGCSSGPNALFAVTELIKTVEEL   80 (359)
T ss_dssp             CCCHHHHCCCCCTTSTTTTSSCHHHHHHHHHTHHHHHHHHHHHHSSSSSSSEECCEEESCCSSTTTTTGGGTTHHHHHHH
T ss_pred             CCccEeeccCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCCceEEEEeCCCCCccHHHHHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999987543 56789999999999999999999999999999


Q ss_pred             hhhccC-CCCcceEEecCCCCCchhhhhhcccchHHHHHHhhCCCCCCeEEecccCCcccCCCCCCceeEEEeccccccc
Q 036911           80 CKRLNR-EAPMYQVFLNDLPGNDFNTIFKSLPGFYEKLKEVKGSNFGPCFIAGIPGSFYGRLFPNKSLHFVHSSYSLHWL  158 (359)
Q Consensus        80 ~~~~~~-~~p~~~v~~nDLp~NDFn~lF~~l~~~~~~~~~~~~~~~~~~f~~~v~gsFy~~lfp~~S~d~~~S~~alhWl  158 (359)
                      |++.+. ++|++||||||||+||||+||++||...        ...++||++|||||||+||||++|+||+||++|||||
T Consensus        81 ~~~~~~~~~pe~qvf~nDLP~NDFNtLF~~L~~~~--------~~~~~~f~~gvpGSFY~rLfP~~Slh~~~Ss~alHWL  152 (359)
T d1m6ex_          81 RKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIEN--------DVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWL  152 (359)
T ss_dssp             HHSSSCSSCCEEEEEEEECTTSCHHHHHTTTTTSC--------SCTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBC
T ss_pred             HHhcCCCCCCeEEEEeCCCCcchHHHHHHhccccc--------cCCCCeEEEecCCchhhhcCCCCceEEeeehhhhhhh
Confidence            987664 5789999999999999999999998542        2236899999999999999999999999999999999


Q ss_pred             ccCCCCccccCCCCCCCcceeecCCCCc----------cccHHHHHHHHHHhhccCceEEEEEecCCCCCCCCc----hh
Q 036911          159 SQVPEGLVSESGVPLNKGHICMAKTSPV----------GRDFTLFLTSRSEEILSGGHVLLSIIGNDRKPGDPR----CT  224 (359)
Q Consensus       159 s~~p~~~~~~~~~~~n~g~i~~~~~~~~----------~~d~~~fL~~Ra~EL~pGG~l~~~~~g~~~~~~~~~----~~  224 (359)
                      |++|..+.+      |+|+||+.+++++          ++||..||++||+||+|||+|+++++||++  .+++    +.
T Consensus       153 S~vP~~l~~------n~~~i~~~~~~~~~v~~ay~~Qf~~D~~~FL~~Ra~ELv~GG~mvl~~~gr~~--~~~~~~~~~~  224 (359)
T d1m6ex_         153 SQVPIGIES------NKGNIYMANTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRS--EDRASTECCL  224 (359)
T ss_dssp             SSCCSCCCC------CTTTTSSCSSSCCTTSCCSHHHHHHHHHHHHHHHHHHBCTTCEEEEEEEECSS--SSSSSTTTST
T ss_pred             hcCCccccC------CCCcEEEcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcEEEEEEeccCC--CCCCCCccch
Confidence            999998865      8899998887764          899999999999999999999999999988  5555    67


Q ss_pred             HHHHHHHHHHHHHHhccchhhhhccCCcCccCCCHHHHHHHHhcCCceEEeEEEEEeecCCCCCCCCCcccccccccchh
Q 036911          225 GWELLGVTLNDMVLEGLVEEAKVDWFNLPYYAPSPEEVRHVIQTEGSFNIRRFDIHTVDWDANKDDGSKSLTSGRHTRGK  304 (359)
Q Consensus       225 ~~~~l~~al~~mv~eGli~~e~~d~f~~P~y~~s~~E~~~~i~~~Gsf~i~~~e~~~~~~~~~~~~~~~~~~~d~~~~~~  304 (359)
                      +|++|.++|+|||.||+|++||+|+||+|+|+||++|++++|+++|+|+|+++|.++.+|++ +.+..+ ...|..++|+
T Consensus       225 ~~~~l~~al~dmv~eGlI~eek~dsfn~P~Y~ps~eEv~~~ie~~gsF~i~~~e~~~~~~~~-~~~~~~-~~~d~~~~~~  302 (359)
T d1m6ex_         225 IWQLLAMALNQMVSEGLIEEEKMDKFNIPQYTPSPTEVEAEILKEGSFLIDHIEASEIYWSS-CTKDGD-GGGSVEEEGY  302 (359)
T ss_dssp             TTHHHHHHHHHHHHTTCSCCSTTGGGCCCCBCCCSHHHHHHHHHTTTBCCEEEEEEEEETTC-CSSCTT-CCSSTTTTTT
T ss_pred             HHHHHHHHHHHHHHcCCCCHHHHHhccCccccCCHHHHHHHhccCCCeeeeeeEeeeccccc-cccccc-ccccHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999988 433221 2346778999


Q ss_pred             HHHHHHHHHhHHHHHhhcChhHHHHHHHHHHHHHHHHHhhCCCCEEEEEEEEeeC
Q 036911          305 NIAKSIRAVSESMLASHFGEEIMDDLFERLAKKISEYLEFAPGHSTTMVISMTKS  359 (359)
Q Consensus       305 ~~~~~~Ra~~ep~l~~h~~~~i~delf~r~~~~~~~~~~~~~~~~~~~~~~l~r~  359 (359)
                      .+++++|||+||+|.+|||++|+|+||+||++++++++.+++++|++++++|+||
T Consensus       303 ~~a~~~RA~~e~~l~~hfg~~i~D~lF~r~~~~v~~~~~~~~~~~~~~~~sL~rK  357 (359)
T d1m6ex_         303 NVARCMRAVAEPLLLDHFGEAIIEDVFHRYKLLIIERMSKEKTKFINVIVSLIRK  357 (359)
T ss_dssp             HHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHSSCCEEEEEEEEEEBC
T ss_pred             HHHHHHHHHHHHHHHHHcChHHHHHHHHHHHHHHHhhHhhcCCceEEEEEEEEec
Confidence            9999999999999999999999999999999999999999999999999999998

PyMOL of d1m6ex_

>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]}	Back information, alignment and structure

>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}	Back information, alignment and structure

>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]}	Back information, alignment and structure

>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]}	Back information, alignment and structure

>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}	Back information, alignment and structure

>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure

>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]}	Back information, alignment and structure

>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]}	Back information, alignment and structure

>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]}	Back information, alignment and structure

>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure