Citrus Sinensis ID: 036924

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN
ccHHHHHHHHHHHHHHHccccHHHHHHHcccccEEEEEEEEEcccccEEEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccEEEccccccccccccccccHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccEEEccccccHHHHHHHHHHccccccccccccccccccccccccEEEccccccccc
ccHHHHHHHHHHHHcccccccHHHHHHHHcccEEEEEEEEEEcccccEEEEEEEEEEEEcccccEEccEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEccHHHccHHHHHHHHHHHHHHHHHHcEcccEEccccccccHHHHHHHHHHHHHHHcccHHHcccccHHHccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHcccccEcEEEccccEEEccccccHHHHHHHHHHHcccccccccEEEcHHHHHcccccEEEEccccccEc
MNALVATNRNFKLAARLLGLDSkleksllipfreikvectipkddgtlasFVGFRiqhdnargpmkggiryhpevdpdEVNALAQLMTWKTAVanipyggakggigcnpvdlSISELERLTRVFTQKIHDLigihadvpapdmgtgpqTMAWILDEYskfhghspavvtgkpidlggslgrdaatgRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDIsgaiknskgidvpsLLKHVkehrgvkgfsggdsidsnsiliedcdvlipaalggvin
mnalvatnrnfKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISgaiknskgidvPSLLKHVKEhrgvkgfsggdsidsnsILIEDCDVLIPAALGGVIN
MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN
*****ATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGV**
MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN
MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN
MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGG*IN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query295 2.2.26 [Sep-21-2011]
Q43314 411 Glutamate dehydrogenase 1 yes no 1.0 0.717 0.905 1e-158
Q9LEC8 411 Glutamate dehydrogenase B N/A no 1.0 0.717 0.891 1e-156
P93541 412 Glutamate dehydrogenase O N/A no 1.0 0.716 0.898 1e-155
Q9S7A0 411 Probable glutamate dehydr no no 1.0 0.717 0.881 1e-155
Q43260 411 Glutamate dehydrogenase O N/A no 1.0 0.717 0.844 1e-148
P52596 411 Glutamate dehydrogenase O no no 1.0 0.717 0.8 1e-141
Q38946 411 Glutamate dehydrogenase 2 no no 1.0 0.717 0.796 1e-140
O04937 411 Glutamate dehydrogenase A N/A no 1.0 0.717 0.789 1e-137
P29051 435 NAD-specific glutamate de yes no 0.989 0.671 0.469 2e-70
P96110 416 Glutamate dehydrogenase O yes no 0.969 0.687 0.482 8e-69
>sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Back     alignment and function desciption
 Score =  556 bits (1434), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 267/295 (90%), Positives = 279/295 (94%)

Query: 1   MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDN 60
           MNAL ATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFR+QHDN
Sbjct: 1   MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN 60

Query: 61  ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERL 120
           ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVA IPYGGAKGGIGC+P  LSISELERL
Sbjct: 61  ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVAKIPYGGAKGGIGCDPSKLSISELERL 120

Query: 121 TRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG 180
           TRVFTQKIHDLIGIH DVPAPDMGTGPQTMAWILDEYSKFHG+SPAVVTGKPIDLGGSLG
Sbjct: 121 TRVFTQKIHDLIGIHTDVPAPDMGTGPQTMAWILDEYSKFHGYSPAVVTGKPIDLGGSLG 180

Query: 181 RDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISG 240
           RDAATGRGV+F  EALLNEHGK I+GQRFVIQGFGNVGSWAA+LI EKGGKIVAVSDI+G
Sbjct: 181 RDAATGRGVMFGTEALLNEHGKTISGQRFVIQGFGNVGSWAAKLISEKGGKIVAVSDITG 240

Query: 241 AIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN 295
           AIKN  GID+P+LLKH KEHRGVKGF G D ID NSIL+EDCD+L+PAALGGVIN
Sbjct: 241 AIKNKDGIDIPALLKHTKEHRGVKGFDGADPIDPNSILVEDCDILVPAALGGVIN 295

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 4EC: .EC: 1EC: .EC: 3
>sp|Q9LEC8|DHEB_NICPL Glutamate dehydrogenase B OS=Nicotiana plumbaginifolia GN=GDHB PE=2 SV=1 Back     alignment and function description
>sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7A0|DHE3_ARATH Probable glutamate dehydrogenase 3 OS=Arabidopsis thaliana GN=GSH3 PE=1 SV=1 Back     alignment and function description
>sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1 PE=1 SV=1 Back     alignment and function description
>sp|P52596|DHE3_VITVI Glutamate dehydrogenase OS=Vitis vinifera GN=GDH PE=2 SV=1 Back     alignment and function description
>sp|Q38946|DHE2_ARATH Glutamate dehydrogenase 2 OS=Arabidopsis thaliana GN=GDH2 PE=1 SV=1 Back     alignment and function description
>sp|O04937|DHEA_NICPL Glutamate dehydrogenase A OS=Nicotiana plumbaginifolia GN=GDHA PE=2 SV=1 Back     alignment and function description
>sp|P29051|DHE41_HALSI NAD-specific glutamate dehydrogenase A OS=Halobacterium salinarum GN=gdhA PE=1 SV=1 Back     alignment and function description
>sp|P96110|DHE3_THEMA Glutamate dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gdhA PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
255568914 411 glutamate dehydrogenase, putative [Ricin 1.0 0.717 0.918 1e-157
224123780 411 predicted protein [Populus trichocarpa] 1.0 0.717 0.911 1e-157
449459602 411 PREDICTED: glutamate dehydrogenase 1-lik 1.0 0.717 0.901 1e-156
15146204338 AT5g18170/MRG7_13 [Arabidopsis thaliana] 1.0 0.872 0.905 1e-156
15238762 411 glutamate dehydrogenase 1 [Arabidopsis t 1.0 0.717 0.905 1e-156
297807845 411 hypothetical protein ARALYDRAFT_488683 [ 1.0 0.717 0.898 1e-156
359482123 411 PREDICTED: glutamate dehydrogenase 1 [Vi 1.0 0.717 0.915 1e-156
224145986 411 predicted protein [Populus trichocarpa] 1.0 0.717 0.901 1e-155
358248552 411 uncharacterized protein LOC100789509 [Gl 1.0 0.717 0.891 1e-155
356559551 411 PREDICTED: glutamate dehydrogenase B-lik 1.0 0.717 0.874 1e-155
>gi|255568914|ref|XP_002525427.1| glutamate dehydrogenase, putative [Ricinus communis] gi|223535240|gb|EEF36917.1| glutamate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  561 bits (1446), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/295 (91%), Positives = 284/295 (96%)

Query: 1   MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDN 60
           MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFR+QHDN
Sbjct: 1   MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN 60

Query: 61  ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERL 120
           ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNP DLSISELERL
Sbjct: 61  ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPGDLSISELERL 120

Query: 121 TRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG 180
           TRVFTQKIHDLIGIH DVPAPDMGTGPQTMAWILDEYSKFHG+SPAVVTGKPIDLGGSLG
Sbjct: 121 TRVFTQKIHDLIGIHTDVPAPDMGTGPQTMAWILDEYSKFHGYSPAVVTGKPIDLGGSLG 180

Query: 181 RDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISG 240
           RDAATGRGVLFA EALLNE GK+I+GQRFVIQGFGNVGSWAA+LI E+GGK+VAVSDI+G
Sbjct: 181 RDAATGRGVLFATEALLNERGKSISGQRFVIQGFGNVGSWAAQLINEQGGKVVAVSDITG 240

Query: 241 AIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN 295
           AIKN  GID+PSLLKH KE++GVKGF GGD ID NSIL+EDCD+LIPAALGGVIN
Sbjct: 241 AIKNKNGIDIPSLLKHTKENKGVKGFHGGDPIDPNSILVEDCDILIPAALGGVIN 295

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224123780|ref|XP_002319162.1| predicted protein [Populus trichocarpa] gi|222857538|gb|EEE95085.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449459602|ref|XP_004147535.1| PREDICTED: glutamate dehydrogenase 1-like [Cucumis sativus] gi|449484900|ref|XP_004157012.1| PREDICTED: glutamate dehydrogenase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15146204|gb|AAK83585.1| AT5g18170/MRG7_13 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15238762|ref|NP_197318.1| glutamate dehydrogenase 1 [Arabidopsis thaliana] gi|12229807|sp|Q43314.1|DHE1_ARATH RecName: Full=Glutamate dehydrogenase 1; Short=GDH 1 gi|1098960|gb|AAA82615.1| glutamate dehydrogenase 1 [Arabidopsis thaliana] gi|1293095|gb|AAB08057.1| glutamate dehydrogenase 1 [Arabidopsis thaliana] gi|9758899|dbj|BAB09475.1| glutamate dehydrogenase (EC 1.4.1.-) 1 [Arabidopsis thaliana] gi|98960991|gb|ABF58979.1| At5g18170 [Arabidopsis thaliana] gi|332005132|gb|AED92515.1| glutamate dehydrogenase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297807845|ref|XP_002871806.1| hypothetical protein ARALYDRAFT_488683 [Arabidopsis lyrata subsp. lyrata] gi|297317643|gb|EFH48065.1| hypothetical protein ARALYDRAFT_488683 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359482123|ref|XP_003632715.1| PREDICTED: glutamate dehydrogenase 1 [Vitis vinifera] gi|297739760|emb|CBI29942.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224145986|ref|XP_002325838.1| predicted protein [Populus trichocarpa] gi|222862713|gb|EEF00220.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358248552|ref|NP_001239645.1| uncharacterized protein LOC100789509 [Glycine max] gi|255639495|gb|ACU20042.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356559551|ref|XP_003548062.1| PREDICTED: glutamate dehydrogenase B-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
TAIR|locus:2172309 411 GDH1 "glutamate dehydrogenase 1.0 0.717 0.905 6.6e-145
TAIR|locus:2079364 411 GDH3 "glutamate dehydrogenase 1.0 0.717 0.881 1.8e-142
TAIR|locus:2183379 411 GDH2 "glutamate dehydrogenase 1.0 0.717 0.796 5.2e-129
UNIPROTKB|Q5HHC7 414 gluD "NAD-specific glutamate d 0.986 0.702 0.433 5.5e-61
UNIPROTKB|Q6GAW8 414 gluD "NAD-specific glutamate d 0.986 0.702 0.433 5.5e-61
UNIPROTKB|Q6GID0 414 gluD "NAD-specific glutamate d 0.986 0.702 0.433 5.5e-61
UNIPROTKB|Q7A1B9 414 gluD "NAD-specific glutamate d 0.986 0.702 0.433 5.5e-61
UNIPROTKB|Q7A6H8 414 gluD "NAD-specific glutamate d 0.986 0.702 0.433 5.5e-61
UNIPROTKB|Q99VD0 414 gluD "NAD-specific glutamate d 0.986 0.702 0.433 5.5e-61
UNIPROTKB|P39633 424 rocG "Catabolic NAD-specific g 0.993 0.691 0.410 1.2e-60
TAIR|locus:2172309 GDH1 "glutamate dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1416 (503.5 bits), Expect = 6.6e-145, P = 6.6e-145
 Identities = 267/295 (90%), Positives = 279/295 (94%)

Query:     1 MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDN 60
             MNAL ATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFR+QHDN
Sbjct:     1 MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN 60

Query:    61 ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERL 120
             ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVA IPYGGAKGGIGC+P  LSISELERL
Sbjct:    61 ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVAKIPYGGAKGGIGCDPSKLSISELERL 120

Query:   121 TRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG 180
             TRVFTQKIHDLIGIH DVPAPDMGTGPQTMAWILDEYSKFHG+SPAVVTGKPIDLGGSLG
Sbjct:   121 TRVFTQKIHDLIGIHTDVPAPDMGTGPQTMAWILDEYSKFHGYSPAVVTGKPIDLGGSLG 180

Query:   181 RDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISG 240
             RDAATGRGV+F  EALLNEHGK I+GQRFVIQGFGNVGSWAA+LI EKGGKIVAVSDI+G
Sbjct:   181 RDAATGRGVMFGTEALLNEHGKTISGQRFVIQGFGNVGSWAAKLISEKGGKIVAVSDITG 240

Query:   241 AIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN 295
             AIKN  GID+P+LLKH KEHRGVKGF G D ID NSIL+EDCD+L+PAALGGVIN
Sbjct:   241 AIKNKDGIDIPALLKHTKEHRGVKGFDGADPIDPNSILVEDCDILVPAALGGVIN 295
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0016639 "oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005524 "ATP binding" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP
GO:0005507 "copper ion binding" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0050897 "cobalt ion binding" evidence=IDA
GO:0004353 "glutamate dehydrogenase [NAD(P)+
GO:0006807 "nitrogen compound metabolic process" evidence=IMP
GO:0009646 "response to absence of light" evidence=IEP
TAIR|locus:2079364 GDH3 "glutamate dehydrogenase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183379 GDH2 "glutamate dehydrogenase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5HHC7 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus COL (taxid:93062)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GAW8 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus MSSA476 (taxid:282459)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GID0 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus MRSA252 (taxid:282458)] Back     alignment and assigned GO terms
UNIPROTKB|Q7A1B9 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus MW2 (taxid:196620)] Back     alignment and assigned GO terms
UNIPROTKB|Q7A6H8 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus N315 (taxid:158879)] Back     alignment and assigned GO terms
UNIPROTKB|Q99VD0 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus Mu50 (taxid:158878)] Back     alignment and assigned GO terms
UNIPROTKB|P39633 rocG "Catabolic NAD-specific glutamate dehydrogenase RocG" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q43260DHE3_MAIZE1, ., 4, ., 1, ., 30.84401.00.7177N/Ano
P93541DHE3_SOLLC1, ., 4, ., 1, ., 30.89831.00.7160N/Ano
Q43314DHE1_ARATH1, ., 4, ., 1, ., 30.90501.00.7177yesno
Q9LEC8DHEB_NICPL1, ., 4, ., 1, ., 30.89151.00.7177N/Ano
O04937DHEA_NICPL1, ., 4, ., 1, ., 30.78981.00.7177N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.10.976
3rd Layer1.4.1.30.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
PLN02477 410 PLN02477, PLN02477, glutamate dehydrogenase 0.0
COG0334 411 COG0334, GdhA, Glutamate dehydrogenase/leucine deh 1e-113
pfam02812131 pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydr 2e-62
cd01076 227 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain 3e-54
PRK14031 444 PRK14031, PRK14031, glutamate dehydrogenase; Provi 2e-43
PRK09414 445 PRK09414, PRK09414, glutamate dehydrogenase; Provi 2e-43
pfam00208 237 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenyl 3e-41
PRK14030 445 PRK14030, PRK14030, glutamate dehydrogenase; Provi 1e-39
PTZ00079 454 PTZ00079, PTZ00079, NADP-specific glutamate dehydr 1e-36
cd05211 217 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding 2e-24
cd05313 254 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain 4e-17
cd01075 200 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding d 1e-10
PRK06270 341 PRK06270, PRK06270, homoserine dehydrogenase; Prov 4e-06
cd0519186 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding do 5e-05
PTZ00324 1002 PTZ00324, PTZ00324, glutamate dehydrogenase 2; Pro 0.003
>gnl|CDD|178095 PLN02477, PLN02477, glutamate dehydrogenase Back     alignment and domain information 
 Score =  584 bits (1506), Expect = 0.0
 Identities = 257/295 (87%), Positives = 272/295 (92%)

Query: 1   MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDN 60
           MNAL ATNRNF+ AARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFR+QHDN
Sbjct: 1   MNALAATNRNFREAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN 60

Query: 61  ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERL 120
           ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGC+P DLS SELERL
Sbjct: 61  ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCDPRDLSESELERL 120

Query: 121 TRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG 180
           TRVFTQKIHDLIGIH DVPAPDMGT  QTMAWILDEYSKFHG SPAVVTGKPIDLGGSLG
Sbjct: 121 TRVFTQKIHDLIGIHTDVPAPDMGTNAQTMAWILDEYSKFHGFSPAVVTGKPIDLGGSLG 180

Query: 181 RDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISG 240
           R+AATGRGV+FA EALL EHGK+IAGQ FVIQGFGNVGSWAA+LI EKGGKIVAVSDI+G
Sbjct: 181 REAATGRGVVFATEALLAEHGKSIAGQTFVIQGFGNVGSWAAQLIHEKGGKIVAVSDITG 240

Query: 241 AIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN 295
           A+KN  G+D+P+L KHV E  G+KGF GGD ID + IL+E CDVLIPAALGGVIN
Sbjct: 241 AVKNENGLDIPALRKHVAEGGGLKGFPGGDPIDPDDILVEPCDVLIPAALGGVIN 295

Length = 410
>gnl|CDD|223411 COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|202408 pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydrogenase, dimerisation domain Back     alignment and domain information
>gnl|CDD|133445 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>gnl|CDD|184464 PRK14031, PRK14031, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181834 PRK09414, PRK09414, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215789 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|184463 PRK14030, PRK14030, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185433 PTZ00079, PTZ00079, NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133450 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>gnl|CDD|133455 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>gnl|CDD|133444 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>gnl|CDD|235763 PRK06270, PRK06270, homoserine dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133449 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>gnl|CDD|240359 PTZ00324, PTZ00324, glutamate dehydrogenase 2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 295
PLN02477 410 glutamate dehydrogenase 100.0
COG0334 411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 100.0
PRK14030 445 glutamate dehydrogenase; Provisional 100.0
PRK09414 445 glutamate dehydrogenase; Provisional 100.0
PRK14031 444 glutamate dehydrogenase; Provisional 100.0
PTZ00079 454 NADP-specific glutamate dehydrogenase; Provisional 100.0
KOG2250 514 consensus Glutamate/leucine/phenylalanine/valine d 100.0
PTZ00324 1002 glutamate dehydrogenase 2; Provisional 100.0
PF02812131 ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, di 100.0
cd05313 254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 100.0
cd01076 227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 99.97
PF00208 244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 99.97
cd05211 217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 99.96
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 99.71
COG2902 1592 NAD-specific glutamate dehydrogenase [Amino acid t 99.46
PRK08374 336 homoserine dehydrogenase; Provisional 99.36
PF05088 1528 Bac_GDH: Bacterial NAD-glutamate dehydrogenase 99.34
PRK06392 326 homoserine dehydrogenase; Provisional 99.34
PRK06270 341 homoserine dehydrogenase; Provisional 98.88
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.56
PLN02700 377 homoserine dehydrogenase family protein 98.31
PRK06813 346 homoserine dehydrogenase; Validated 98.31
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 97.87
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 97.82
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.75
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 97.73
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.47
PRK13529 563 malate dehydrogenase; Provisional 97.37
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.35
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.31
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.25
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 97.21
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.18
PLN03129 581 NADP-dependent malic enzyme; Provisional 97.16
cd05312 279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 97.13
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.12
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.1
PRK12861 764 malic enzyme; Reviewed 96.98
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 96.91
PTZ00317 559 NADP-dependent malic enzyme; Provisional 96.88
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.88
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 96.84
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.82
PTZ00075 476 Adenosylhomocysteinase; Provisional 96.82
cd00762 254 NAD_bind_malic_enz NAD(P) binding domain of malic 96.82
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 96.79
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 96.79
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 96.72
PLN02494 477 adenosylhomocysteinase 96.63
COG0281 432 SfcA Malic enzyme [Energy production and conversio 96.59
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.57
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.55
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.52
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 96.5
PF03949 255 Malic_M: Malic enzyme, NAD binding domain; InterPr 96.46
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 96.38
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.37
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.37
PRK12862 763 malic enzyme; Reviewed 96.33
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.31
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.3
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 96.26
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.26
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.24
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 96.2
PRK06932314 glycerate dehydrogenase; Provisional 96.17
PLN03139386 formate dehydrogenase; Provisional 96.12
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.07
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.05
PRK06487317 glycerate dehydrogenase; Provisional 96.05
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.02
PRK13304 265 L-aspartate dehydrogenase; Reviewed 95.98
PRK07574 385 formate dehydrogenase; Provisional 95.98
PRK13243333 glyoxylate reductase; Reviewed 95.95
PRK12549284 shikimate 5-dehydrogenase; Reviewed 95.91
COG0499 420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 95.88
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 95.87
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 95.82
PRK13301 267 putative L-aspartate dehydrogenase; Provisional 95.75
PLN02928347 oxidoreductase family protein 95.73
PRK06436303 glycerate dehydrogenase; Provisional 95.64
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 95.63
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.62
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.59
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.58
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 95.55
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 95.51
PRK06349 426 homoserine dehydrogenase; Provisional 95.49
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.48
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 95.48
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 95.45
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 95.42
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.4
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 95.4
PRK12480330 D-lactate dehydrogenase; Provisional 95.36
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.34
COG0057 335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 95.34
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 95.31
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 95.28
COG1712 255 Predicted dinucleotide-utilizing enzyme [General f 95.25
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 95.19
COG2085 211 Predicted dinucleotide-binding enzymes [General fu 95.14
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 95.14
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 95.12
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 95.09
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 95.05
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 94.98
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 94.97
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 94.93
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 94.93
PRK00048 257 dihydrodipicolinate reductase; Provisional 94.93
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 94.89
PLN02306 386 hydroxypyruvate reductase 94.87
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 94.85
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 94.84
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 94.83
PRK13403 335 ketol-acid reductoisomerase; Provisional 94.8
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 94.78
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.74
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 94.72
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.69
PRK13940 414 glutamyl-tRNA reductase; Provisional 94.66
PRK08223 287 hypothetical protein; Validated 94.66
TIGR02355 240 moeB molybdopterin synthase sulfurylase MoeB. This 94.61
PRK05479 330 ketol-acid reductoisomerase; Provisional 94.59
PRK13303 265 L-aspartate dehydrogenase; Provisional 94.58
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.57
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.56
PRK15116 268 sulfur acceptor protein CsdL; Provisional 94.55
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 94.54
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 94.53
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 94.52
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.47
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.45
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 94.38
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 94.38
PLN00203 519 glutamyl-tRNA reductase 94.35
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 94.34
PRK06719157 precorrin-2 dehydrogenase; Validated 94.34
PRK14982340 acyl-ACP reductase; Provisional 94.34
TIGR00036 266 dapB dihydrodipicolinate reductase. 94.33
PRK07417 279 arogenate dehydrogenase; Reviewed 94.32
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.26
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.25
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 94.25
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 94.24
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.23
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.21
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.2
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 94.14
cd00755 231 YgdL_like Family of activating enzymes (E1) of ubi 94.05
PRK06718 202 precorrin-2 dehydrogenase; Reviewed 93.97
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 93.96
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 93.92
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 93.89
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 93.87
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.85
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 93.83
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.82
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.82
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.82
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.75
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 93.75
PRK08605332 D-lactate dehydrogenase; Validated 93.75
COG1648 210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 93.71
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 93.69
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.68
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 93.64
KOG0409 327 consensus Predicted dehydrogenase [General functio 93.64
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.63
PLN02688 266 pyrroline-5-carboxylate reductase 93.57
TIGR01470 205 cysG_Nterm siroheme synthase, N-terminal domain. T 93.56
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.55
COG1250 307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 93.51
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.41
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 93.38
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 93.31
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 93.25
PRK13535 336 erythrose 4-phosphate dehydrogenase; Provisional 93.25
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 93.19
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.16
COG2344211 AT-rich DNA-binding protein [General function pred 93.1
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 93.09
PRK07411 390 hypothetical protein; Validated 93.09
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 93.08
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 93.07
PRK06476 258 pyrroline-5-carboxylate reductase; Reviewed 93.06
PRK05225 487 ketol-acid reductoisomerase; Validated 93.05
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.04
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 93.03
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 92.99
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.98
KOG0455 364 consensus Homoserine dehydrogenase [Amino acid tra 92.95
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.92
KOG1370 434 consensus S-adenosylhomocysteine hydrolase [Coenzy 92.87
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 92.87
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 92.87
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 92.86
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.79
PLN02712 667 arogenate dehydrogenase 92.77
COG5322351 Predicted dehydrogenase [General function predicti 92.74
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 92.74
PRK12491 272 pyrroline-5-carboxylate reductase; Reviewed 92.73
PLN02712 667 arogenate dehydrogenase 92.7
PRK00676338 hemA glutamyl-tRNA reductase; Validated 92.66
KOG0068 406 consensus D-3-phosphoglycerate dehydrogenase, D-is 92.62
PRK07680 273 late competence protein ComER; Validated 92.56
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 92.54
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 92.53
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.47
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 92.41
PRK08300 302 acetaldehyde dehydrogenase; Validated 92.39
PTZ00082 321 L-lactate dehydrogenase; Provisional 92.3
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 92.28
PLN02272 421 glyceraldehyde-3-phosphate dehydrogenase 92.18
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.18
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 92.1
PLN03096 395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 92.07
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 92.05
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 92.03
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 92.01
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.96
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 91.93
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 91.93
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 91.88
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 91.84
PRK12548289 shikimate 5-dehydrogenase; Provisional 91.75
COG0345 266 ProC Pyrroline-5-carboxylate reductase [Amino acid 91.73
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 91.73
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 91.67
PRK08507 275 prephenate dehydrogenase; Validated 91.64
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 91.56
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 91.56
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 91.5
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.5
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 91.41
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.33
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 91.33
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 91.32
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.3
PRK11730 715 fadB multifunctional fatty acid oxidation complex 91.27
COG1179 263 Dinucleotide-utilizing enzymes involved in molybdo 91.26
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.11
PRK14851 679 hypothetical protein; Provisional 91.08
PRK08328 231 hypothetical protein; Provisional 91.07
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 91.03
PLN02256 304 arogenate dehydrogenase 90.9
PRK07877 722 hypothetical protein; Provisional 90.89
PRK14027283 quinate/shikimate dehydrogenase; Provisional 90.74
PRK07340 304 ornithine cyclodeaminase; Validated 90.61
PRK06153 393 hypothetical protein; Provisional 90.53
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.48
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 90.45
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 90.45
PRK12550272 shikimate 5-dehydrogenase; Reviewed 90.41
TIGR01915 219 npdG NADPH-dependent F420 reductase. This model re 90.35
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.27
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.19
PRK05717 255 oxidoreductase; Validated 90.18
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.18
TIGR03628114 arch_S11P archaeal ribosomal protein S11P. This mo 90.14
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 90.13
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.12
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 90.05
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 90.05
PRK06928 277 pyrroline-5-carboxylate reductase; Reviewed 90.03
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 89.99
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 89.89
PRK04148134 hypothetical protein; Provisional 89.75
PLN02358 338 glyceraldehyde-3-phosphate dehydrogenase 89.52
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 89.4
PRK09496 453 trkA potassium transporter peripheral membrane com 89.38
PRK09607132 rps11p 30S ribosomal protein S11P; Reviewed 89.35
PRK08289 477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 89.31
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 89.31
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.3
PTZ00117 319 malate dehydrogenase; Provisional 89.27
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 89.2
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 89.18
PRK06567 1028 putative bifunctional glutamate synthase subunit b 89.15
PRK07060 245 short chain dehydrogenase; Provisional 88.93
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 88.86
PRK08628 258 short chain dehydrogenase; Provisional 88.81
PLN02896 353 cinnamyl-alcohol dehydrogenase 88.78
PRK07634 245 pyrroline-5-carboxylate reductase; Reviewed 88.76
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 88.75
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 88.72
PRK07523 255 gluconate 5-dehydrogenase; Provisional 88.7
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.69
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 88.67
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 88.65
cd01483143 E1_enzyme_family Superfamily of activating enzymes 88.63
PLN02206 442 UDP-glucuronate decarboxylase 88.58
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 88.58
PRK06046 326 alanine dehydrogenase; Validated 88.5
PLN02586360 probable cinnamyl alcohol dehydrogenase 88.5
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 88.42
KOG2018 430 consensus Predicted dinucleotide-utilizing enzyme 88.37
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 88.27
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 88.22
PRK14852 989 hypothetical protein; Provisional 88.2
TIGR03215 285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 88.1
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 88.07
PRK12828 239 short chain dehydrogenase; Provisional 87.85
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 87.82
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 87.74
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 87.72
PRK15059 292 tartronate semialdehyde reductase; Provisional 87.72
PRK06141314 ornithine cyclodeaminase; Validated 87.7
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 87.53
PRK07236 386 hypothetical protein; Provisional 87.52
PRK06841 255 short chain dehydrogenase; Provisional 87.5
COG0300 265 DltE Short-chain dehydrogenases of various substra 87.45
PRK09291 257 short chain dehydrogenase; Provisional 87.44
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 87.42
CHL00041116 rps11 ribosomal protein S11 87.4
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 87.34
PRK05309128 30S ribosomal protein S11; Validated 87.19
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.09
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 86.99
PRK08618 325 ornithine cyclodeaminase; Validated 86.97
TIGR03632108 bact_S11 30S ribosomal protein S11. This model des 86.93
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.88
PRK12938 246 acetyacetyl-CoA reductase; Provisional 86.86
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 86.79
PF03853169 YjeF_N: YjeF-related protein N-terminus; InterPro: 86.77
PRK07774 250 short chain dehydrogenase; Provisional 86.77
COG0673 342 MviM Predicted dehydrogenases and related proteins 86.73
PLN02240 352 UDP-glucose 4-epimerase 86.65
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.58
PRK06949 258 short chain dehydrogenase; Provisional 86.54
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 86.4
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.39
PRK06138 252 short chain dehydrogenase; Provisional 86.33
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 86.26
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.26
PRK06223 307 malate dehydrogenase; Reviewed 86.23
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 86.19
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 86.12
PLN02695 370 GDP-D-mannose-3',5'-epimerase 86.07
TIGR03736 244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 86.03
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 86.02
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 85.92
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.9
PRK12742 237 oxidoreductase; Provisional 85.89
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 85.88
PRK09186 256 flagellin modification protein A; Provisional 85.82
PRK09496 453 trkA potassium transporter peripheral membrane com 85.81
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 85.76
PRK08339 263 short chain dehydrogenase; Provisional 85.71
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.68
PRK06125 259 short chain dehydrogenase; Provisional 85.66
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 85.65
PRK06057 255 short chain dehydrogenase; Provisional 85.63
PLN02427 386 UDP-apiose/xylose synthase 85.62
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 85.6
PRK06523 260 short chain dehydrogenase; Provisional 85.59
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 85.54
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.53
PLN02514357 cinnamyl-alcohol dehydrogenase 85.46
KOG0089309 consensus Methylenetetrahydrofolate dehydrogenase/ 85.42
PRK12829 264 short chain dehydrogenase; Provisional 85.42
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 85.33
PRK07806 248 short chain dehydrogenase; Provisional 85.31
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 85.3
PRK05867 253 short chain dehydrogenase; Provisional 85.3
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 85.28
PRK08703 239 short chain dehydrogenase; Provisional 85.23
PRK09072 263 short chain dehydrogenase; Provisional 85.21
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 85.17
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 85.14
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 85.13
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 85.11
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 85.09
PRK05875 276 short chain dehydrogenase; Provisional 85.08
PRK08818 370 prephenate dehydrogenase; Provisional 84.96
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 84.95
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 84.94
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 84.73
PRK05562 223 precorrin-2 dehydrogenase; Provisional 84.71
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.69
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 84.69
PRK03562 621 glutathione-regulated potassium-efflux system prot 84.64
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 84.62
PF00411110 Ribosomal_S11: Ribosomal protein S11; InterPro: IP 84.51
KOG1257 582 consensus NADP+-dependent malic enzyme [Energy pro 84.5
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 84.5
PRK07831 262 short chain dehydrogenase; Provisional 84.47
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 84.45
PRK06753 373 hypothetical protein; Provisional 84.36
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 84.35
PRK11891 429 aspartate carbamoyltransferase; Provisional 84.25
PRK12770352 putative glutamate synthase subunit beta; Provisio 84.24
COG0289 266 DapB Dihydrodipicolinate reductase [Amino acid tra 84.24
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 84.17
PRK05876 275 short chain dehydrogenase; Provisional 84.17
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 84.16
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 84.15
PLN00198 338 anthocyanidin reductase; Provisional 84.14
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 84.14
PLN02214 342 cinnamoyl-CoA reductase 84.13
PRK10669558 putative cation:proton antiport protein; Provision 84.05
PRK09880343 L-idonate 5-dehydrogenase; Provisional 84.03
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 83.91
PRK03815 401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.9
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 83.84
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 83.82
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 83.82
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 83.82
PRK08264 238 short chain dehydrogenase; Validated 83.8
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 83.73
PTZ00090233 40S ribosomal protein S11; Provisional 83.68
PRK06196 315 oxidoreductase; Provisional 83.62
PRK08265 261 short chain dehydrogenase; Provisional 83.59
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 83.59
PRK07890 258 short chain dehydrogenase; Provisional 83.58
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 83.58
cd01491 286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 83.57
PRK06194 287 hypothetical protein; Provisional 83.51
PRK06172 253 short chain dehydrogenase; Provisional 83.44
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 83.39
TIGR03570 201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 83.37
PRK12939 250 short chain dehydrogenase; Provisional 83.36
PLN02178 375 cinnamyl-alcohol dehydrogenase 83.35
PRK07326 237 short chain dehydrogenase; Provisional 83.3
PRK06124 256 gluconate 5-dehydrogenase; Provisional 83.19
PRK07576 264 short chain dehydrogenase; Provisional 83.19
PLN02653 340 GDP-mannose 4,6-dehydratase 83.16
PRK08013 400 oxidoreductase; Provisional 83.11
CHL00194 317 ycf39 Ycf39; Provisional 83.07
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 83.05
PRK08017 256 oxidoreductase; Provisional 83.05
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 82.9
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.88
PRK08936 261 glucose-1-dehydrogenase; Provisional 82.87
COG0100129 RpsK Ribosomal protein S11 [Translation, ribosomal 82.83
PRK08085 254 gluconate 5-dehydrogenase; Provisional 82.78
PRK07067 257 sorbitol dehydrogenase; Provisional 82.74
PRK05866 293 short chain dehydrogenase; Provisional 82.71
PRK12937 245 short chain dehydrogenase; Provisional 82.68
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 82.68
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 82.68
PRK12779 944 putative bifunctional glutamate synthase subunit b 82.68
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.66
PRK08291 330 ectoine utilization protein EutC; Validated 82.66
PTZ00434 361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 82.66
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 82.6
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 82.58
PRK12746 254 short chain dehydrogenase; Provisional 82.57
PRK14804311 ornithine carbamoyltransferase; Provisional 82.56
PRK06398 258 aldose dehydrogenase; Validated 82.53
PLN02166 436 dTDP-glucose 4,6-dehydratase 82.47
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 82.47
PRK12831 464 putative oxidoreductase; Provisional 82.41
PLN02852 491 ferredoxin-NADP+ reductase 82.37
PRK06197 306 short chain dehydrogenase; Provisional 82.35
PRK06182 273 short chain dehydrogenase; Validated 82.32
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 82.31
PRK09135 249 pteridine reductase; Provisional 82.17
PRK07814 263 short chain dehydrogenase; Provisional 82.11
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 82.1
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 82.1
PRK03659 601 glutathione-regulated potassium-efflux system prot 82.07
PRK07062 265 short chain dehydrogenase; Provisional 82.06
PRK07577 234 short chain dehydrogenase; Provisional 82.05
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 82.02
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 82.0
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 81.97
PRK06847 375 hypothetical protein; Provisional 81.95
TIGR01534 327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 81.93
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 81.91
PRK07035 252 short chain dehydrogenase; Provisional 81.86
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 81.86
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 81.83
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 81.82
PRK07856 252 short chain dehydrogenase; Provisional 81.79
PRK11579 346 putative oxidoreductase; Provisional 81.75
PLN02858 1378 fructose-bisphosphate aldolase 81.72
PRK08213 259 gluconate 5-dehydrogenase; Provisional 81.7
PRK06914 280 short chain dehydrogenase; Provisional 81.69
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 81.69
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 81.67
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 81.67
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 81.66
PRK05993 277 short chain dehydrogenase; Provisional 81.64
PRK06550 235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 81.62
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 81.61
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 81.6
PRK10637 457 cysG siroheme synthase; Provisional 81.58
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 81.57
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 81.53
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 81.51
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 81.5
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 81.49
PRK06500 249 short chain dehydrogenase; Provisional 81.46
PRK06545 359 prephenate dehydrogenase; Validated 81.45
PRK10206 344 putative oxidoreductase; Provisional 81.43
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate d 81.39
PRK08226 263 short chain dehydrogenase; Provisional 81.37
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 81.34
>PLN02477 glutamate dehydrogenase Back     alignment and domain information 
Probab=100.00  E-value=3.4e-101  Score=747.46  Aligned_cols=295  Identities=87%  Similarity=1.359  Sum_probs=291.5

Q ss_pred             CCHHHHHHHHHHHHHHHcCCCHHHHHHhcCCCceEEEEEEEEeCCCceeEEEEEEEeecCCCCCCCCCceeecCCCHHHH
Q 036924            1 MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNARGPMKGGIRYHPEVDPDEV   80 (295)
Q Consensus         1 ~~~~~~~~~~~~~a~~~~~~~~~~~~~l~~p~r~~~~~~p~~~d~g~~~~~~G~rv~h~~~~Gp~kGGiR~~~~~t~~Ev   80 (295)
                      |++|++++++|++|+++++++|++.++|++|+|+++|+|||+||||++++|+|||||||+++||+||||||||++|++|+
T Consensus         1 ~~~~~~~~~~~~~a~~~~~~~~~~~~~l~~p~r~~~v~~p~~~d~g~~~~~~gyRvqh~~~~GP~kGGiR~~p~v~~~ev   80 (410)
T PLN02477          1 MNALAATNRNFREAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDNARGPMKGGIRYHPEVDPDEV   80 (410)
T ss_pred             CCHHHHHHHHHHHHHHHcCCCHHHHHHHhcCceEEEEEEEEEECCCcEEEeeeeEeeecCccCCCCCCeeecCCCCHHHH
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhCCCCCCccceeccCCCCCCHHHHHHHHHHHHHHHHhhcCCCCcccCCCCCCCHHHHHHHHHHhchh
Q 036924           81 NALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKF  160 (295)
Q Consensus        81 ~~LA~~Mt~K~al~~lp~GGaKGgI~~dP~~~s~~e~erl~r~f~~~l~~~iG~~~dipapDvgt~~~~m~w~~d~~~~~  160 (295)
                      ++||+||||||||++||||||||||.+||+++|+.|+|+++|+|+++|.+++||++|||||||||++++|+||+|+|+++
T Consensus        81 ~~La~~MT~K~Al~~lP~GGgKggI~~dP~~~s~~e~e~l~r~f~~~l~~~iG~~~DipapDvgt~~~~M~w~~d~y~~~  160 (410)
T PLN02477         81 NALAQLMTWKTAVANIPYGGAKGGIGCDPRDLSESELERLTRVFTQKIHDLIGIHTDVPAPDMGTNAQTMAWILDEYSKF  160 (410)
T ss_pred             HHHHHHHHHHHHhcCCCCcCceeeeccCCccCCHHHHHHHHHHHHHHHHHhcCCCCCcccCCCCCCHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCccccCccccCCCCCCCCCchHHHHHHHHHHHHHHcCCCCCCCEEEEEcCcHHHHHHHHHHHHCCCEEEEEecCCc
Q 036924          161 HGHSPAVVTGKPIDLGGSLGRDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISG  240 (295)
Q Consensus       161 ~g~~~~~~tGkp~~~GG~~~r~~aTg~Gv~~~~~~~l~~~g~~l~g~~vaIqGfGnVG~~~a~~L~~~G~kvVaVsD~~G  240 (295)
                      .|++|+++||||+.+|||.+|.++|||||+++++++++++|.+++|+||+||||||||+++|++|.++|+|||||||++|
T Consensus       161 ~g~~~~~vtGkp~~~gGs~~r~~aTg~Gv~~~~~~~~~~~g~~l~g~~VaIqGfGnVG~~~A~~L~e~GakVVaVsD~~G  240 (410)
T PLN02477        161 HGFSPAVVTGKPIDLGGSLGREAATGRGVVFATEALLAEHGKSIAGQTFVIQGFGNVGSWAAQLIHEKGGKIVAVSDITG  240 (410)
T ss_pred             hCCCCceEeCCCcccCCCCCCCccchHHHHHHHHHHHHHcCCCccCCEEEEECCCHHHHHHHHHHHHcCCEEEEEECCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEECCCCCCHHHHHHHHHhcCCcccCCCCeeeCCCCccccCceEEecccccCCCC
Q 036924          241 AIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN  295 (295)
Q Consensus       241 ~iy~~~GlD~~~l~~~~~~~g~~~~~~~~~~~~~~~~l~~~~DvlipaA~~~~I~  295 (295)
                      ++|||+|||+++|++++++++++.+|++++.++++++|..+||||||||++|+||
T Consensus       241 ~iy~~~GLD~~~L~~~k~~~g~l~~~~~a~~i~~~e~l~~~~DvliP~Al~~~I~  295 (410)
T PLN02477        241 AVKNENGLDIPALRKHVAEGGGLKGFPGGDPIDPDDILVEPCDVLIPAALGGVIN  295 (410)
T ss_pred             eEECCCCCCHHHHHHHHHhcCchhccccceEecCccceeccccEEeeccccccCC
Confidence            9999999999999999999999999999888999999999999999999999997

>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>KOG2250 consensus Glutamate/leucine/phenylalanine/valine dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00324 glutamate dehydrogenase 2; Provisional Back     alignment and domain information
>PF02812 ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, dimerisation domain; InterPro: IPR006097 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG2902 NAD-specific glutamate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0455 consensus Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03628 arch_S11P archaeal ribosomal protein S11P Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK09607 rps11p 30S ribosomal protein S11P; Reviewed Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>CHL00041 rps11 ribosomal protein S11 Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK05309 30S ribosomal protein S11; Validated Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR03632 bact_S11 30S ribosomal protein S11 Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF03853 YjeF_N: YjeF-related protein N-terminus; InterPro: IPR004443 The YjeF N-terminal domains occur either as single proteins or fusions with other domains and are commonly associated with enzymes Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>KOG0089 consensus Methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF00411 Ribosomal_S11: Ribosomal protein S11; InterPro: IPR001971 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1257 consensus NADP+-dependent malic enzyme [Energy production and conversion] Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PTZ00090 40S ribosomal protein S11; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>COG0100 RpsK Ribosomal protein S11 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
1b26_A 416 Glutamate Dehydrogenase Length = 416 2e-69
1b3b_A 415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 1e-68
3k92_A 424 Crystal Structure Of A E93k Mutant Of The Majour Ba 4e-65
1euz_A 419 Glutamate Dehydrogenase From Thermococcus Profundus 2e-64
2tmg_A 415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 4e-64
1gtm_A 419 Structure Of Glutamate Dehydrogenase Length = 419 5e-62
3aog_A 440 Crystal Structure Of Glutamate Dehydrogenase (Gdhb) 5e-62
3aoe_A 424 Crystal Structure Of Hetero-Hexameric Glutamate Deh 5e-62
1bvu_A 418 Glutamate Dehydrogenase From Thermococcus Litoralis 2e-61
3k8z_A 423 Crystal Structure Of Gudb1 A Decryptified Secondary 5e-60
2yfq_A 421 Crystal Structure Of Glutamate Dehydrogenase From P 2e-53
1nqt_A 496 Crystal Structure Of Bovine Glutamate Dehydrogenase 4e-53
1nr1_A 496 Crystal Structure Of The R463a Mutant Of Human Glut 6e-53
1l1f_A 505 Structure Of Human Glutamate Dehydrogenase-Apo Form 7e-53
3etd_A 501 Structure Of Glutamate Dehydrogenase Complexed With 1e-52
3mw9_A 501 Bovine Glutamate Dehydrogenase Complexed With Nadh, 1e-52
1v9l_A 421 L-Glutamate Dehydrogenase From Pyrobaculum Islandic 4e-51
1hwy_A 501 Bovine Glutamate Dehydrogenase Complexed With Nad A 8e-51
3aoe_E 419 Crystal Structure Of Hetero-Hexameric Glutamate Deh 9e-46
2yfh_A 448 Structure Of A Chimeric Glutamate Dehydrogenase Len 3e-32
1hrd_A 449 Glutamate Dehydrogenase Length = 449 2e-31
1k89_A 449 K89l Mutant Of Glutamate Dehydrogenase Length = 449 8e-31
1aup_A 449 Glutamate Dehydrogenase Length = 449 1e-30
3sbo_A 447 Structure Of E.Coli Gdh From Native Source Length = 1e-30
4fcc_A 450 Glutamate Dehydrogenase From E. Coli Length = 450 2e-30
2yfg_E 447 Structural Determinants Of Cofactor Specificity And 2e-30
3r3j_A 456 Kinetic And Structural Characterization Of Plasmodi 7e-30
2bma_A 470 The Crystal Structure Of Plasmodium Falciparum Glut 2e-20
3vpx_A 364 Crystal Structure Of Leucine Dehydrogenase From A P 3e-12
1bxg_A 356 Phenylalanine Dehydrogenase Structure In Ternary Co 9e-11
1c1x_B 355 L-Phenylalanine Dehydrogenase Structure In Ternary 1e-10
1bw9_B 356 Phenylalanine Dehydrogenase Structure In Ternary Co 1e-10
1bxg_B 356 Phenylalanine Dehydrogenase Structure In Ternary Co 1e-10
1c1d_B 355 L-Phenylalanine Dehydrogenase Structure In Ternary 1e-10
1c1d_A 355 L-Phenylalanine Dehydrogenase Structure In Ternary 2e-10
1bw9_A 356 Phenylalanine Dehydrogenase Structure In Ternary Co 2e-10
1c1x_A 355 L-Phenylalanine Dehydrogenase Structure In Ternary 2e-10
1leh_A 364 Leucine Dehydrogenase From Bacillus Sphaericus Leng 7e-10
>pdb|1B26|A Chain A, Glutamate Dehydrogenase Length = 416 Back     alignment and structure 
Iteration: 1

 Score =  258 bits (660), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 138/288 (47%), Positives = 185/288 (64%), Gaps = 2/288 (0%)
Query: 10  NFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNARGPMKGGI 69
            F  AA L+ L+S L + L  P R + VE  +  DDG +  F G+R+QH+ ARGP KGGI
Sbjct: 13  QFNRAASLMDLESDLAEVLRRPKRVLIVEFPVRMDDGHVEVFTGYRVQHNVARGPAKGGI 72
Query: 70  RYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLTRVFTQKIH 129
           RYHP+V  DEV ALA  MTWKTAV N+P+GG KGG+  +P  LS +ELERL+R F  +I 
Sbjct: 73  RYHPDVTLDEVKALAFWMTWKTAVMNLPFGGGKGGVRVDPKKLSRNELERLSRRFFSEIQ 132
Query: 130 DLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSP-AVVTGKPIDLGGSLGRDAATGRG 188
            +IG + D+PAPD+ T    +AW +D YS   GH+   +VTGKP++LGGS GR+ ATGRG
Sbjct: 133 VIIGPYNDIPAPDVNTNADVIAWYMDTYSMNVGHTVLGIVTGKPVELGGSKGREEATGRG 192
Query: 189 VLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEK-GGKIVAVSDISGAIKNSKG 247
           V       ++  G +       +QGFGNVG +AA LI ++ G K+VAVSD  G I N +G
Sbjct: 193 VKVCAGLAMDVLGIDPKKATVAVQGFGNVGQFAALLISQELGSKVVAVSDSRGGIYNPEG 252
Query: 248 IDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN 295
            DV  L+++ KEH  V  +  G+ I +  +L  D D+L+PAAL G I+
Sbjct: 253 FDVEELIRYKKEHGTVVTYPKGERITNEELLELDVDILVPAALEGAIH 300
>pdb|1B3B|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant N97d, G376k Length = 415 Back     alignment and structure
>pdb|3K92|A Chain A, Crystal Structure Of A E93k Mutant Of The Majour Bacillus Su Glutamate Dehydrogenase Rocg Length = 424 Back     alignment and structure
>pdb|1EUZ|A Chain A, Glutamate Dehydrogenase From Thermococcus Profundus In The Unligated State Length = 419 Back     alignment and structure
>pdb|2TMG|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant S128r, T158e, N117r, S160e Length = 415 Back     alignment and structure
>pdb|1GTM|A Chain A, Structure Of Glutamate Dehydrogenase Length = 419 Back     alignment and structure
>pdb|3AOG|A Chain A, Crystal Structure Of Glutamate Dehydrogenase (Gdhb) From Thermus Thermophilus (Glu Bound Form) Length = 440 Back     alignment and structure
>pdb|3AOE|A Chain A, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 424 Back     alignment and structure
>pdb|1BVU|A Chain A, Glutamate Dehydrogenase From Thermococcus Litoralis Length = 418 Back     alignment and structure
>pdb|3K8Z|A Chain A, Crystal Structure Of Gudb1 A Decryptified Secondary Glutamate Dehydrogenase From B. Subtilis Length = 423 Back     alignment and structure
>pdb|2YFQ|A Chain A, Crystal Structure Of Glutamate Dehydrogenase From Peptoniphilus Asaccharolyticus Length = 421 Back     alignment and structure
>pdb|1NQT|A Chain A, Crystal Structure Of Bovine Glutamate Dehydrogenase-adp Complex Length = 496 Back     alignment and structure
>pdb|1NR1|A Chain A, Crystal Structure Of The R463a Mutant Of Human Glutamate Dehydrogenase Length = 496 Back     alignment and structure
>pdb|1L1F|A Chain A, Structure Of Human Glutamate Dehydrogenase-Apo Form Length = 505 Back     alignment and structure
>pdb|3ETD|A Chain A, Structure Of Glutamate Dehydrogenase Complexed With Bithionol Length = 501 Back     alignment and structure
>pdb|3MW9|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nadh, Gtp, Glu Length = 501 Back     alignment and structure
>pdb|1V9L|A Chain A, L-Glutamate Dehydrogenase From Pyrobaculum Islandicum Complexed With Nad Length = 421 Back     alignment and structure
>pdb|1HWY|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nad And 2-Oxoglutarate Length = 501 Back     alignment and structure
>pdb|3AOE|E Chain E, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 419 Back     alignment and structure
>pdb|2YFH|A Chain A, Structure Of A Chimeric Glutamate Dehydrogenase Length = 448 Back     alignment and structure
>pdb|1HRD|A Chain A, Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|1K89|A Chain A, K89l Mutant Of Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|1AUP|A Chain A, Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|3SBO|A Chain A, Structure Of E.Coli Gdh From Native Source Length = 447 Back     alignment and structure
>pdb|4FCC|A Chain A, Glutamate Dehydrogenase From E. Coli Length = 450 Back     alignment and structure
>pdb|2YFG|E Chain E, Structural Determinants Of Cofactor Specificity And Domain Flexibility In Bacterial Glutamate Dehydrogenases Length = 447 Back     alignment and structure
>pdb|3R3J|A Chain A, Kinetic And Structural Characterization Of Plasmodium Falciparum Glutamate Dehydrogenase 2 Length = 456 Back     alignment and structure
>pdb|2BMA|A Chain A, The Crystal Structure Of Plasmodium Falciparum Glutamate Dehydrogenase, A Putative Target For Novel Antimalarial Drugs Length = 470 Back     alignment and structure
>pdb|3VPX|A Chain A, Crystal Structure Of Leucine Dehydrogenase From A Psychrophilic Bacterium Sporosarcina Psychrophila. Length = 364 Back     alignment and structure
>pdb|1BXG|A Chain A, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Beta-Phenylpropionate Length = 356 Back     alignment and structure
>pdb|1C1X|B Chain B, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And L-3-Phenyllactate Length = 355 Back     alignment and structure
>pdb|1BW9|B Chain B, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Phenylpyruvate Length = 356 Back     alignment and structure
>pdb|1BXG|B Chain B, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Beta-Phenylpropionate Length = 356 Back     alignment and structure
>pdb|1C1D|B Chain B, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nadh And L-Phenylalanine Length = 355 Back     alignment and structure
>pdb|1C1D|A Chain A, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nadh And L-Phenylalanine Length = 355 Back     alignment and structure
>pdb|1BW9|A Chain A, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Phenylpyruvate Length = 356 Back     alignment and structure
>pdb|1C1X|A Chain A, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And L-3-Phenyllactate Length = 355 Back     alignment and structure
>pdb|1LEH|A Chain A, Leucine Dehydrogenase From Bacillus Sphaericus Length = 364 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
3aog_A 440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 1e-166
2yfq_A 421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 1e-165
2tmg_A 415 Protein (glutamate dehydrogenase); metabolic role, 1e-165
3k92_A 424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 1e-165
1gtm_A 419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 1e-160
1v9l_A 421 Glutamate dehydrogenase; protein-NAD complex, oxid 1e-159
3aoe_E 419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 1e-157
3mw9_A 501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 1e-150
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 1e-102
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 1e-101
1bgv_A 449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 8e-96
2bma_A 470 Glutamate dehydrogenase (NADP+); malaria, drug des 6e-92
3r3j_A 456 Glutamate dehydrogenase; rossman fold, oxidoreduct 5e-91
2yfg_A 447 NADP-specific glutamate dehydrogenase; oxidoreduct 2e-83
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Length = 440 Back     alignment and structure
 Score =  467 bits (1203), Expect = e-166
 Identities = 134/295 (45%), Positives = 172/295 (58%), Gaps = 1/295 (0%)

Query: 2   NALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNA 61
                           LG  + L +SL  P R + V+  +  DDG++A F G+R+ H+ A
Sbjct: 30  GPWEIFTEQVDRVVPYLGRLAPLAESLKRPKRVLIVDVPVRLDDGSVAYFEGYRVHHNTA 89

Query: 62  RGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLT 121
           RGP KGG+RYHPEV   EV ALA  MT K A   +PYGG KGGI  +P  LS  ELERLT
Sbjct: 90  RGPAKGGVRYHPEVTLSEVMALAGWMTIKNAAVGLPYGGGKGGIRVDPRKLSPGELERLT 149

Query: 122 RVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGH-SPAVVTGKPIDLGGSLG 180
           R +T +I  L+G   D+PAPD+ TG + MAW++D YS   G   P VVTGKPI LGGSLG
Sbjct: 150 RRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNVGRTVPGVVTGKPIALGGSLG 209

Query: 181 RDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISG 240
           R  ATGRGV     A   + G  + G R  IQGFGNVG+ AAR   + G ++VAV D +G
Sbjct: 210 RRDATGRGVFITAAAAAEKIGLQVEGARVAIQGFGNVGNAAARAFHDHGARVVAVQDHTG 269

Query: 241 AIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN 295
            + N  GID   LL+HV+E  GV+G+   + + +        + L+PAAL   I 
Sbjct: 270 TVYNEAGIDPYDLLRHVQEFGGVRGYPKAEPLPAADFWGLPVEFLVPAALEKQIT 324
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Length = 421 Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Length = 415 Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Length = 424 Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Length = 419 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Length = 421 Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Length = 419 Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Length = 501 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Length = 364 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Length = 355 Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Length = 449 Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Length = 470 Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Length = 456 Back     alignment and structure
>2yfg_A NADP-specific glutamate dehydrogenase; oxidoreductase; 2.50A {Escherichia coli} PDB: 3sbo_A 2yfg_E Length = 447 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
3k92_A 424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 100.0
2yfq_A 421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 100.0
3aog_A 440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 100.0
3r3j_A 456 Glutamate dehydrogenase; rossman fold, oxidoreduct 100.0
3mw9_A 501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 100.0
3aoe_E 419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 100.0
2tmg_A 415 Protein (glutamate dehydrogenase); metabolic role, 100.0
2bma_A 470 Glutamate dehydrogenase (NADP+); malaria, drug des 100.0
1v9l_A 421 Glutamate dehydrogenase; protein-NAD complex, oxid 100.0
4fcc_A 450 Glutamate dehydrogenase; protein complex, rossmann 100.0
1bgv_A 449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 100.0
1gtm_A 419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 100.0
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 100.0
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 100.0
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 98.38
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.8
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 97.75
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 97.61
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.54
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 97.36
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 97.35
3p2o_A285 Bifunctional protein fold; structural genomics, ce 97.34
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.25
3l07_A285 Bifunctional protein fold; structural genomics, ID 97.25
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 97.23
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.16
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.12
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 97.08
2a9f_A 398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 97.06
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 97.02
1vl6_A 388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.0
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 97.0
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 96.97
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 96.92
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.89
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 96.86
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 96.86
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.83
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 96.8
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 96.8
1pj3_A 564 NAD-dependent malic enzyme, mitochondrial; oxidati 96.78
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 96.78
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 96.78
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.77
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.74
1o0s_A 605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 96.74
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 96.72
1gq2_A 555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 96.71
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 96.7
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 96.69
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.69
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 96.66
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.41
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.37
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 96.24
2dc1_A 236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 96.21
3qy9_A 243 DHPR, dihydrodipicolinate reductase; rossmann fold 96.19
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 96.17
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 96.17
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 96.16
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.13
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 96.08
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 96.08
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 95.96
1j5p_A 253 Aspartate dehydrogenase; TM1643, structural genomi 95.94
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 95.91
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 95.9
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 95.89
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 95.89
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 95.87
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 95.86
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 95.84
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 95.84
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.82
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 95.8
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 95.79
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 95.79
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 95.78
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 95.76
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 95.72
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 95.67
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 95.67
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 95.67
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 95.66
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.66
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 95.66
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 95.66
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 95.65
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 95.65
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 95.64
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 95.64
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 95.63
2g82_O 331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 95.62
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 95.58
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 95.58
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 95.57
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 95.57
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 95.56
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 95.53
2yq5_A 343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 95.53
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 95.53
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 95.51
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.49
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 95.49
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 95.47
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 95.44
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 95.42
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 95.42
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 95.4
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 95.39
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 95.37
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 95.34
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 95.33
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 95.25
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 95.25
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 95.24
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 95.23
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 95.23
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 95.21
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 95.21
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.18
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 95.18
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 95.16
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 95.16
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 95.11
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 95.1
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 95.07
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 95.06
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 95.04
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 95.04
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 95.03
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.98
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 94.97
4f3y_A 272 DHPR, dihydrodipicolinate reductase; structural ge 94.97
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.97
3ijp_A 288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 94.94
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 94.93
4ezb_A 317 Uncharacterized conserved protein; structural geno 94.92
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 94.92
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.91
3p2y_A 381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.9
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 94.9
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 94.89
2ep7_A 342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 94.89
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 94.88
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 94.87
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 94.86
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 94.85
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 94.83
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 94.82
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.8
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 94.79
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 94.79
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 94.76
4had_A 350 Probable oxidoreductase protein; structural genomi 94.74
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 94.72
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 94.7
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 94.7
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 94.69
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 94.67
2i99_A 312 MU-crystallin homolog; thyroid hormine binding pro 94.65
1obf_O 335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 94.63
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.62
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 94.62
2i76_A 276 Hypothetical protein; NADP, dehydrogenase, TM1727, 94.61
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 94.61
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 94.6
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 94.6
3kb6_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 94.56
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 94.52
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 94.52
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 94.51
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 94.49
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 94.47
3gt0_A 247 Pyrroline-5-carboxylate reductase; structural geno 94.44
1kyq_A 274 Met8P, siroheme biosynthesis protein Met8; homodim 94.44
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 94.42
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 94.42
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 94.41
3qha_A 296 Putative oxidoreductase; seattle structural genomi 94.41
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 94.41
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 94.37
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 94.29
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 94.29
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 94.28
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 94.27
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 94.26
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 94.23
1dih_A 273 Dihydrodipicolinate reductase; oxidoreductase; HET 94.2
1ydw_A 362 AX110P-like protein; structural genomics, protein 94.17
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 94.15
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 94.15
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 94.05
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 94.03
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.97
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 93.95
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 93.94
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 93.92
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 93.91
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 93.89
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 93.84
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 93.83
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 93.76
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 93.75
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 93.72
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 93.68
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 93.57
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 93.53
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 93.52
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 93.5
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 93.42
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 93.4
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 93.37
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 93.32
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 93.26
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 93.19
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 93.17
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 93.12
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 93.12
4h3v_A 390 Oxidoreductase domain protein; structural genomics 93.05
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 92.99
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 92.99
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 92.89
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 92.84
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 92.82
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 92.81
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.81
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 92.78
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 92.76
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 92.69
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 92.66
1omo_A 322 Alanine dehydrogenase; two-domain, beta-sandwich-d 92.62
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 92.6
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 92.58
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 92.56
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 92.52
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 92.49
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 92.42
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 92.41
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 92.39
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 92.34
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 92.27
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 92.25
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 92.2
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 92.12
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 92.1
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 92.1
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 92.08
4g65_A 461 TRK system potassium uptake protein TRKA; structur 92.04
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 92.02
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 91.99
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 91.98
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 91.98
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 91.95
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 91.94
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 91.92
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 91.82
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 91.78
4hb9_A 412 Similarities with probable monooxygenase; flavin, 91.71
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 91.67
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 91.64
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 91.61
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 91.59
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 91.57
3hja_A 356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 91.53
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 91.47
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 91.37
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 91.35
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 91.28
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 91.27
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 91.26
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 91.19
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 91.18
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 91.18
1jay_A 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 91.16
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 91.15
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 91.12
3pym_A 332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 91.11
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 91.11
3doc_A 335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 91.11
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 90.45
2b4r_O 345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 91.05
1lc0_A 294 Biliverdin reductase A; oxidoreductase, tetrapyrro 91.04
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 90.97
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 90.97
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 90.95
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 90.93
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 90.91
4dib_A 345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 90.82
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 90.81
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 90.8
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 90.71
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 90.62
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 90.61
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 90.61
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 90.61
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 90.51
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 90.48
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 90.32
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 90.29
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 90.29
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 90.24
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 90.18
3dfu_A 232 Uncharacterized protein from 6-phosphogluconate de 90.17
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 90.15
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 90.15
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 90.08
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 90.07
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 90.07
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 90.02
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 89.99
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 89.92
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 89.9
3lvf_P 338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 89.85
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 89.82
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 89.81
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 89.79
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 89.69
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 89.66
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 89.66
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 89.63
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 89.6
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 89.58
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 89.53
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 89.49
1x7d_A 350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 89.37
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 89.35
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 89.34
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 89.25
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 89.17
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 89.17
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 89.09
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 89.07
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 89.04
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 88.97
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 88.97
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 88.96
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 88.93
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 88.92
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 88.91
2aef_A 234 Calcium-gated potassium channel MTHK; rossmann fol 88.88
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 88.84
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 88.78
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 88.74
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 88.71
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 88.7
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 88.69
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 88.69
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 88.67
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 88.65
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 88.64
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 88.59
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 88.52
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 88.48
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 88.48
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 88.44
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 88.37
3d7l_A 202 LIN1944 protein; APC89317, structural genomics, PS 88.37
2nu8_A 288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 88.36
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 88.36
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 88.34
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 88.33
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 88.33
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 88.32
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 88.27
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 88.27
2pnf_A 248 3-oxoacyl-[acyl-carrier-protein] reductase; short 88.19
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 88.17
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 88.08
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 88.06
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 88.04
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 88.04
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 88.01
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 88.0
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 87.98
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 87.96
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 87.94
4g65_A 461 TRK system potassium uptake protein TRKA; structur 87.93
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 87.92
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 87.91
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 87.86
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 87.84
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 87.81
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 87.81
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 87.77
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 87.7
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 87.67
1xq6_A 253 Unknown protein; structural genomics, protein stru 87.65
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 87.64
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 87.63
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 87.63
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 87.62
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 87.59
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 87.57
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 87.55
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 87.53
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 87.5
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 87.48
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 87.48
1p9l_A 245 Dihydrodipicolinate reductase; oxidoreductase, lys 87.45
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 87.42
4eye_A342 Probable oxidoreductase; structural genomics, niai 87.39
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 87.36
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 87.33
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 87.26
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 87.26
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 87.24
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 87.23
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 87.2
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 87.18
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 87.18
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 87.17
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 87.16
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 87.15
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 87.14
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 87.09
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 87.08
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 87.03
1u7z_A 226 Coenzyme A biosynthesis bifunctional protein coabc 87.02
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 87.0
3imf_A 257 Short chain dehydrogenase; structural genomics, in 86.99
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 86.98
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 86.98
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 86.98
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 86.98
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 86.96
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 86.94
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 86.92
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 86.89
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 86.89
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 86.89
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 86.87
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 86.85
4dqx_A 277 Probable oxidoreductase protein; structural genomi 86.75
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 86.72
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 86.7
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 86.69
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 86.69
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 86.68
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 86.67
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 86.64
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 86.63
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 86.63
3h5n_A 353 MCCB protein; ubiquitin-activating enzyme, microci 86.6
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 86.59
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 86.57
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 86.56
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 86.55
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 86.55
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 86.55
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 86.53
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 86.52
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 86.52
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 86.5
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 86.49
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 86.49
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 86.48
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 86.46
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 86.45
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 86.44
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 86.44
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 86.41
2ywl_A180 Thioredoxin reductase related protein; uncharacter 86.4
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 86.39
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 86.36
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 86.35
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 86.32
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 86.31
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 86.31
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 86.28
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 86.26
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 86.24
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 86.18
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 86.18
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 86.17
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 86.16
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 86.16
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 86.15
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 86.14
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 86.12
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 86.11
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 86.1
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 86.06
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 86.04
3rih_A 293 Short chain dehydrogenase or reductase; structural 85.97
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 85.96
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 85.95
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 85.88
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 85.87
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 85.85
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 85.85
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 85.83
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 85.82
3r8n_K117 30S ribosomal protein S11; protein biosynthesis, R 85.81
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 85.81
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 85.8
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 85.78
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 85.78
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 85.77
3dme_A 369 Conserved exported protein; structural genomics, P 85.73
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
Probab=100.00  E-value=2.2e-99  Score=735.63  Aligned_cols=293  Identities=41%  Similarity=0.766  Sum_probs=287.6

Q ss_pred             CHHHHHHHHHHHHHHHcCCCHHHHHHhcCCCceEEEEEEEEeCCCceeEEEEEEEeecCCCCCCCCCceeecCCCHHHHH
Q 036924            2 NALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNARGPMKGGIRYHPEVDPDEVN   81 (295)
Q Consensus         2 ~~~~~~~~~~~~a~~~~~~~~~~~~~l~~p~r~~~~~~p~~~d~g~~~~~~G~rv~h~~~~Gp~kGGiR~~~~~t~~Ev~   81 (295)
                      ++|+++++||++|+++|+++|+++++|++|+|+++|+|||+||||++++|+|||||||+++||+||||||||++|++|++
T Consensus        16 ~~~~~~~~~~~~a~~~~~~~~~~~~~l~~p~r~~~~~vp~~~d~G~~~v~~GyRvqhn~a~GP~kGGiR~~p~v~~~ev~   95 (424)
T 3k92_A           16 NLFLSTQTIIKEALRKLGYPGDMYELMKEPQRMLTVRIPVKMDNGSVKVFTGYRSQHNDAVGPTKGGVRFHPEVNEEKVK   95 (424)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCHHHHHHHSSCSEEEEEEEEEECTTSCEEEEEEEEEECCCSSSSEECCEEEETTCCHHHHH
T ss_pred             CHHHHHHHHHHHHHHHcCCCHHHHHHhcCCCeEEEEEEEEEecCCcEEEEEEEEEEECCcCCCCCCCeEecCCCCHHHHH
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhCCCCCCccceeccCCCCCCHHHHHHHHHHHHHHHHhhcCCCCcccCCCCCCCHHHHHHHHHHhchhc
Q 036924           82 ALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFH  161 (295)
Q Consensus        82 ~LA~~Mt~K~al~~lp~GGaKGgI~~dP~~~s~~e~erl~r~f~~~l~~~iG~~~dipapDvgt~~~~m~w~~d~~~~~~  161 (295)
                      +||+||||||||++||||||||||.+||+++|+.|+||++|+|+++|.+++||++|||||||||++++|+||+|+|++++
T Consensus        96 ~La~~mt~KnAl~~lP~GGgKggi~~DP~~~s~~El~r~~r~f~~~l~~~iG~~~dipApDvgt~~~~m~~~~~~y~~~~  175 (424)
T 3k92_A           96 ALSIWMTLKCGIANLPYGGGKGGIICDPRTMSFGELERLSRGYVRAISQIVGPTKDIPAPDVYTNSQIMAWMMDEYSRLR  175 (424)
T ss_dssp             HHHHHHHHHHHHTTCSCEEEEEEEECCGGGSCHHHHHHHHHHHHHHHGGGCBTTTEECCBCTTCCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhcCCCCCCcceEEecCCCCCCHHHHHHHHHHHHHHHHHhcCCCCCccCCcCCCCHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCC-CccccCccccCCCCCCCCCchHHHHHHHHHHHHHHcCCCCCCCEEEEEcCcHHHHHHHHHHHHCCCEEEEEecCCc
Q 036924          162 GHS-PAVVTGKPIDLGGSLGRDAATGRGVLFAMEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISG  240 (295)
Q Consensus       162 g~~-~~~~tGkp~~~GG~~~r~~aTg~Gv~~~~~~~l~~~g~~l~g~~vaIqGfGnVG~~~a~~L~~~G~kvVaVsD~~G  240 (295)
                      |++ |+++||||+.+|||.+|.++|||||+++++++++++|.+++|+||+||||||||+++|++|++.|+|||+|||++|
T Consensus       176 g~~~~~~vTGkp~~~GGs~~r~~aTg~Gv~~~~~~~~~~~g~~l~g~~vaVqG~GnVG~~aa~~l~e~GakVVavsD~~G  255 (424)
T 3k92_A          176 EFDSPGFITGKPLVLGGSQGRETATAQGVTICIEEAVKKKGIKLQNARIIIQGFGNAGSFLAKFMHDAGAKVIGISDANG  255 (424)
T ss_dssp             TSCCGGGCSSCCGGGTCCTTTTTHHHHHHHHHHHHHHHHTTCCGGGCEEEEECCSHHHHHHHHHHHHHTCEEEEEECSSC
T ss_pred             CCCCcceeecccccCCCcCCCcccHHHHHHHHHHHHHHHcCCCcccCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCC
Confidence            974 7999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEECCCCCCHHHHHHHHHhcCCcccCCCCeeeCCCCccccCceEEecccccCCCC
Q 036924          241 AIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN  295 (295)
Q Consensus       241 ~iy~~~GlD~~~l~~~~~~~g~~~~~~~~~~~~~~~~l~~~~DvlipaA~~~~I~  295 (295)
                      ++|||+|||+++|+++++++|++.+|+ ++.++++++|+++||||+|||++|+||
T Consensus       256 ~iyd~~GlD~~~l~~~~~~~g~i~~~~-a~~~~~~~i~~~~~DIliPcA~~n~I~  309 (424)
T 3k92_A          256 GLYNPDGLDIPYLLDKRDSFGMVTNLF-TDVITNEELLEKDCDILVPAAISNQIT  309 (424)
T ss_dssp             EEECTTCCCHHHHHHHCCSSSCCGGGC-SCCBCHHHHHHSCCSEEEECSCSSCBC
T ss_pred             cEECCCCCCHHHHHHHHHHhCCCCCCC-cEEecCccceeccccEEeecCcccccC
Confidence            999999999999999999999999998 777888999999999999999999997
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 295
d1v9la2176 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyroba 3e-62
d1b26a2175 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermo 4e-59
d1gtma2178 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archae 6e-58
d1hwxa2208 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (B 1e-51
d1bgva2194 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostr 2e-50
d1bgva1 255 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clost 8e-38
d1c1da2148 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rh 3e-35
d1leha2134 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus 1e-34
d1leha1 230 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillu 1e-29
d1b26a1 234 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Therm 1e-29
d1hwxa1 293 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow ( 1e-27
d1gtma1 239 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archa 3e-27
d1v9la1 242 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrob 2e-26
d1c1da1201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 2e-15
>d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 176 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Aminoacid dehydrogenases
domain: Glutamate dehydrogenase
species: Pyrobaculum islandicum [TaxId: 2277]

 Score =  192 bits (490), Expect = 3e-62
 Identities = 76/175 (43%), Positives = 99/175 (56%), Gaps = 1/175 (0%)

Query: 2   NALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNA 61
             L       K    L G      K L  P R + V   +  D G    F G+R+QH + 
Sbjct: 2   GFLEYVLNYVKKGVELGGFPEDFYKILSRPRRVLIVNIPVRLDGGGFEVFEGYRVQHCDV 61

Query: 62  RGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLT 121
            GP KGG+R+HPEV   +  ALA LMT K ++A +PYGGAKG +  +P  LS  ELE L+
Sbjct: 62  LGPYKGGVRFHPEVTLADDVALAILMTLKNSLAGLPYGGAKGAVRVDPKKLSQRELEELS 121

Query: 122 RVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHS-PAVVTGKPIDL 175
           R + + I  LIG   D+PAPD+GT  Q MAW++DEYSK  G++ P V T KP +L
Sbjct: 122 RGYARAIAPLIGDVVDIPAPDVGTNAQIMAWMVDEYSKIKGYNVPGVFTSKPPEL 176
>d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 175 Back     information, alignment and structure
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 178 Back     information, alignment and structure
>d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 208 Back     information, alignment and structure
>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 194 Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 255 Back     information, alignment and structure
>d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 148 Back     information, alignment and structure
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 134 Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 230 Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 293 Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 239 Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 242 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
d1b26a2175 Glutamate dehydrogenase {Thermotoga maritima [TaxI 100.0
d1gtma2178 Glutamate dehydrogenase {Archaeon Pyrococcus furio 100.0
d1v9la2176 Glutamate dehydrogenase {Pyrobaculum islandicum [T 100.0
d1hwxa2208 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 100.0
d1bgva2194 Glutamate dehydrogenase {Clostridium symbiosum [Ta 100.0
d1c1da2148 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 100.0
d1leha2134 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 100.0
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 100.0
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 100.0
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 100.0
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 99.97
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 99.97
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 99.92
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 99.83
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 98.09
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.95
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.8
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.45
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.33
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.22
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.15
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.02
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.84
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.82
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 96.82
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.81
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.77
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.76
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 96.72
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.69
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.68
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.68
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.59
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.49
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.42
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.39
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.38
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.38
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.36
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.36
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.26
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.25
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.24
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.14
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 96.04
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.96
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.91
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.87
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 95.84
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 95.8
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.79
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.77
d1jaya_ 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 95.7
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 95.69
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 95.66
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.66
d1vl6a1 222 Malate oxidoreductase (malic enzyme) {Thermotoga m 95.55
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.52
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.5
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.4
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.37
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.36
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.21
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.21
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.18
d1ydwa1 184 Probable oxidoreductase At4g09670 {Thale cress (Ar 95.17
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.14
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 95.13
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 95.1
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.07
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.06
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.01
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.99
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 94.96
d1h6da1 221 Glucose-fructose oxidoreductase, N-terminal domain 94.93
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.91
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.9
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.86
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.82
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 94.79
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 94.77
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 94.77
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 94.77
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.66
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.63
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 94.63
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.61
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.58
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.54
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 94.51
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.46
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.39
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.38
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 94.36
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 94.35
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.27
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.26
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.24
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.21
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 94.17
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 94.11
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 94.03
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.94
d1mv8a2 202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.94
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 93.91
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.87
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 93.8
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 93.79
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 93.68
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.64
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.57
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 93.53
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.52
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.5
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 93.47
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 93.3
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 93.28
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 93.26
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 93.17
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.1
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 92.95
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 92.94
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.91
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 92.82
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 92.77
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 92.74
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 92.72
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 92.66
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 92.65
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 92.63
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.62
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 92.49
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 92.48
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 92.47
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 92.45
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 92.36
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 92.32
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 92.31
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 92.21
d1o0sa1 308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 92.19
d1pj3a1 294 Mitochondrial NAD(P)-dependent malic enzyme {Human 92.17
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 92.1
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 92.01
d1gq2a1 298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 91.91
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 91.88
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 91.87
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 91.66
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 91.64
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 91.63
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 91.58
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 91.55
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 91.54
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 91.51
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 91.28
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 91.23
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 91.22
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 91.21
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 91.15
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 91.13
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 91.1
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 91.06
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 91.05
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 90.97
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 90.97
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 90.86
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 90.74
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.72
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 90.72
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 90.71
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 90.71
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 90.54
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 90.51
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 90.46
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 90.4
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 90.37
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 90.36
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 90.32
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 90.21
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 90.19
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 90.16
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 90.06
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 89.91
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 89.85
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 89.73
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 89.7
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 89.61
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 89.59
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 89.58
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 89.55
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 89.54
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 89.44
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 89.38
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 89.35
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.3
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 89.27
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 89.21
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 89.16
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 89.11
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 89.08
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 89.07
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 89.05
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 89.03
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 89.02
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 89.01
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 88.98
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 88.95
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 88.94
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 88.88
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 88.86
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 88.71
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 88.66
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 88.58
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 88.54
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 88.47
d2nvwa1 237 Galactose/lactose metabolism regulatory protein GA 88.44
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 88.37
d1kifa1 246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 88.29
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 88.24
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 88.23
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 88.19
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 88.16
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 88.11
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 88.06
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 88.04
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 87.91
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 87.8
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.77
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 87.68
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 87.68
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 87.67
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 87.66
d2i0za1 251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 87.65
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 87.6
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 87.48
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 87.13
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 87.1
d2uubk1119 Ribosomal protein S11 {Thermus thermophilus [TaxId 86.88
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 86.87
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 86.85
d2blna2 203 Polymyxin resistance protein ArnA, N-terminal doma 86.85
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 86.69
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 86.64
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 86.58
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 86.39
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 86.25
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 86.2
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 86.17
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 86.01
d1dxla1 221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 86.01
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 85.9
d1v59a1 233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 85.84
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 85.38
d1cjca2 230 Adrenodoxin reductase of mitochondrial p450 system 85.11
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 84.7
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 84.47
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 84.26
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 84.21
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 83.97
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 83.73
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 83.37
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 83.23
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 83.13
d1lqta2 239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 83.02
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 82.84
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 82.57
d2qalk1117 Ribosomal protein S11 {Escherichia coli [TaxId: 56 82.57
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 82.3
d2gqfa1 253 Hypothetical protein HI0933 {Haemophilus influenza 82.26
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 82.07
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 81.36
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 81.35
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 81.24
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 81.22
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 81.2
d2fcra_173 Flavodoxin {Chondrus crispus [TaxId: 2769]} 81.13
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 81.13
d1yoba1179 Flavodoxin {Azotobacter vinelandii [TaxId: 354]} 81.08
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 80.98
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 80.96
d1ojta1 229 Dihydrolipoamide dehydrogenase {Neisseria meningit 80.96
d1lvla1 220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 80.56
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 80.44
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 80.09
>d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Aminoacid dehydrogenases
domain: Glutamate dehydrogenase
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=3e-70  Score=470.33  Aligned_cols=174  Identities=49%  Similarity=0.826  Sum_probs=171.0

Q ss_pred             CHHHHHHHHHHHHHHHcCCCHHHHHHhcCCCceEEEEEEEEeCCCceeEEEEEEEeecCCCCCCCCCceeecCCCHHHHH
Q 036924            2 NALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDNARGPMKGGIRYHPEVDPDEVN   81 (295)
Q Consensus         2 ~~~~~~~~~~~~a~~~~~~~~~~~~~l~~p~r~~~~~~p~~~d~g~~~~~~G~rv~h~~~~Gp~kGGiR~~~~~t~~Ev~   81 (295)
                      ++|++++.+|++|+++++++++++++|++|+|+++|+|||+||||++++|+|||||||+++||+||||||||+++++||+
T Consensus         1 s~~~~~~~~~~~A~~~l~l~~~~~~~L~~P~r~i~v~iPv~~DdG~~~~f~gyR~qhn~~~GP~kGGiR~~~~v~~~ev~   80 (175)
T d1b26a2           1 SLYEMAVEQFNRAASLMDLESDLAEVLRRPKRVLIVEFPVRMDDGHVEVFTGYRVQHNVARGPAKGGIRYHPDVTLDEVK   80 (175)
T ss_dssp             CHHHHHHHHHHHHHHHTTCCHHHHHHHHSCSEEEEEEEEEECTTSCEEEEEEEEEEEECTTSSEEEEEEECSSCCHHHHH
T ss_pred             CHHHHHHHHHHHHHHHcCCCHHHHHHHhCCCeEEEEEEEEEECCCcEEEEEeEEEEeecccccccCCeeEcccccHHHHH
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhCCCCCCccceeccCCCCCCHHHHHHHHHHHHHHHHhhcCCCCcccCCCCCCCHHHHHHHHHHhchhc
Q 036924           82 ALAQLMTWKTAVANIPYGGAKGGIGCNPVDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFH  161 (295)
Q Consensus        82 ~LA~~Mt~K~al~~lp~GGaKGgI~~dP~~~s~~e~erl~r~f~~~l~~~iG~~~dipapDvgt~~~~m~w~~d~~~~~~  161 (295)
                      +||+|||||||+++||||||||||.+||+++|+.|+||++|+|+++|.+++||++|||||||||++++|+||+|+|+++.
T Consensus        81 aLa~~MT~K~A~~~lP~GGgKggi~~dP~~~s~~Eler~~r~f~~~l~~~iG~~~dipApDvgT~~~~M~wi~dey~~~~  160 (175)
T d1b26a2          81 ALAFWMTWKTAVMNLPFGGGKGGVRVDPKKLSRNELERLSRRFFSEIQVIIGPYNDIPAPDVNTNADVIAWYMDTYSMNV  160 (175)
T ss_dssp             HHHHHHHHHHHHHTCSCEEEEEEEECCGGGSCHHHHHHHHHHHHHHGGGTCBTTTEEEECCTTCCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhhCCccccccceeecCCCCCCHHHHHHHHHHHHHHHHhccCCCcccccCcCCCCHHHHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CC-CCccccCccccC
Q 036924          162 GH-SPAVVTGKPIDL  175 (295)
Q Consensus       162 g~-~~~~~tGkp~~~  175 (295)
                      |+ .+|+|||||+++
T Consensus       161 g~~~~g~vTGKp~~l  175 (175)
T d1b26a2         161 GHTVLGIVTGKPVEL  175 (175)
T ss_dssp             TSCCCCSCSSCCGGG
T ss_pred             CCcCceeEecCccCC
Confidence            98 499999999864
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2uubk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qalk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure