Citrus Sinensis ID: 036958

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MGEETSDTVNLDWNLSHGPEAQSGSIATEVVNLDDWVDDPIDRIREVFAAEEKSNEAPKTCENNNGFLEDEVSDKKDDDEKGNGNDGSFFDSNICLDLARDTPPPPPCDLLCKAIPSVRGWVTVKNVTPMYGCENSTRESEKDLSLKIPLRPQGWRRFGLAHHLTPPRDGSSARETGERANSLINRILTSWGICGEQNTDSALPDDVDMHSGSNAEGEAIWLRSLLLQRQAQAHRAPTFSYSFSSTLNSAERCLMDTAVEIDSMVLLSTSSSRRRSDSSRVLDVDSGHSGTIQTENCRKFGTSCCQGGTQET
cccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHcccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEccEEcccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccc
cccccccccEccccccccccccccccccccccccccccccHHcccHHccHHccccccccccccccccccccccccccccccccccccccEEEEEEHHcHccccEEEEcEccccccccEEEEEccccEEEEEccccccccccccccccccccccccccHHHHHHccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccHHHcccHHHHHHHHHHHcccccEEcccccccccccccEcccccccccccccHHcccccccccccccccc
mgeetsdtvnldwnlshgpeaqsgsiatevvnlddwvddpiDRIREVFAAeeksneapktcennngfledevsdkkdddekgngndgsffdsnicldlardtpppppcdllckaipsvrgwvtvknvtpmygcenstresekdlslkiplrpqgwrrfglahhltpprdgssaretGERANSLINRILTswgicgeqntdsalpddvdmhsgsnaeGEAIWLRSLLLQRQAqahraptfsysfsstlNSAERCLMDTAVEIDSMVLLStsssrrrsdssrvldvdsghsgtiqtencrkfgtsccqggtqet
MGEETSDTVNLDWNLSHGPEAQSGSIATEVVNLDDWVDDPIDRIREVFAaeeksneapktcennngfledevsdkkdddEKGNGNDGSFFDSNICLDLARDTPPPPPCDLLCKAIPSVRGWVTVKNVTPmygcenstresekdlsLKIPLRPQGWRRFGLAhhltpprdgssareTGERANSLINRILTSWGICGEQNTDSALPDDVDMHSGSNAEGEAIWLRSLLLQRQAQAHRAPTFSYSFSSTLNSAERCLMDTAVEIDSMVLlstsssrrrsdssrvldvdsghsgtiqtencrkfgTSCCQGGTQET
MGEETSDTVNLDWNLSHGPEAQSGSIATEVVNLDDWVDDPIDRIREVFAAEEKSNEAPKTCENNNGFLedevsdkkdddekgngndgSFFDSNICLDLARDTpppppCDLLCKAIPSVRGWVTVKNVTPMYGCENSTRESEKDLSLKIPLRPQGWRRFGLAHHLTPPRDGSSARETGERANSLINRILTSWGICGEQNTDSALPDDVDMHSGSNAEGEAIWlrslllqrqaqahraPTFSYSFSSTLNSAERCLMDTAVEIdsmvllstsssrrrsdssrvldvdsGHSGTIQTENCRKFGTSCCQGGTQET
*************************IATEVVNLDDWVDDPIDRIREVF*********************************************ICL*************LLCKAIPSVRGWVTVKNVTPMYGCE*************IPLRPQGWRRFGLAH********************LINRILTSWGICGE*********************EAIWLRSLLLQRQAQAHRAPTFSYSFSSTLNSAERCLMDTAVEIDSMVL**********************************************
*****SD*VNLDW*****************************************************************************DSNICLDLARDTPPPPPCDLLCKAIPSVRGWVTVKNVTPM*********************************************************************************************************************************************************************NCRKFGTSC*QG*****
********VNLDWNLSHGPEAQSGSIATEVVNLDDWVDDPIDRIREVFAAEEKSNEAPKTCENNNGFLEDEV**********NGNDGSFFDSNICLDLARDTPPPPPCDLLCKAIPSVRGWVTVKNVTPMYGC***********SLKIPLRPQGWRRFGLAHHLT************ERANSLINRILTSWGICGEQNTDSALPDDVDMHSGSNAEGEAIWLRSLLLQ*********TFSYSFSSTLNSAERCLMDTAVEIDSMVLLS**********************TIQTENCRKFGT**********
**************************************************************************************GSFFDSNICLDLARDTPPPPPCDLLCKAIPSVRGWVTVKNVTPMYGCE*************I******************************RANSLINRILTSWGICGE**TDS*LPDDVDM*SGSNAEGEAIWLRSLLLQRQAQ*********************LMDT***IDS*************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEETSDTVNLDWNLSHGPEAQSGSIATEVVNLDDWVDDPIDRIREVFAAEEKSNEAPKTCENNNGFLEDEVSDKKDDDEKGNGNDGSFFDSNICLDLARDTPPPPPCDLLCKAIPSVRGWVTVKNVTPMYGCENSTRESEKDLSLKIPLRPQGWRRFGLAHHLTPPRDGSSARETGERANSLINRILTSWGICGEQNTDSALPDDVDMHSGSNAEGEAIWLRSLLLQRQAQAHRAPTFSYSFSSTLNSAERCLMDTAVEIDSMVLLSTSSSRRRSDSSRVLDVDSGHSGTIQTENCRKFGTSCCQGGTQET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
255579773 427 rnf5, putative [Ricinus communis] gi|223 0.910 0.665 0.400 6e-52
224091605 414 predicted protein [Populus trichocarpa] 0.769 0.579 0.411 3e-48
225441479410 PREDICTED: uncharacterized protein LOC10 0.913 0.695 0.392 8e-43
224138094 446 predicted protein [Populus trichocarpa] 0.919 0.643 0.369 2e-41
297817140 437 zinc finger family protein [Arabidopsis 0.916 0.654 0.336 4e-38
22331846 436 RING/U-box domain-containing protein [Ar 0.913 0.653 0.327 4e-36
255564084 424 rnf5, putative [Ricinus communis] gi|223 0.814 0.599 0.358 6e-35
357509977 453 RING finger protein [Medicago truncatula 0.721 0.496 0.393 2e-34
358248349 442 uncharacterized protein LOC100811099 [Gl 0.762 0.538 0.411 2e-33
356504872 442 PREDICTED: uncharacterized protein LOC10 0.759 0.536 0.414 1e-32
>gi|255579773|ref|XP_002530725.1| rnf5, putative [Ricinus communis] gi|223529739|gb|EEF31679.1| rnf5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  210 bits (535), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 167/417 (40%), Positives = 207/417 (49%), Gaps = 133/417 (31%)

Query: 1   MGEETSDTVNLDWNLSHGPEAQSGSIATEVVNLDDWVDDPIDRIREVF------------ 48
           MGEETSDT+NLD NL  GPE  SGSI++E VN D WVDDP++RIRE              
Sbjct: 1   MGEETSDTMNLDLNLGPGPEVGSGSISSEAVNFDGWVDDPLERIREAVRISNRARQRWRW 60

Query: 49  ------------------------------------AAEEKSNEAPKTCENNNGFLEDEV 72
                                               AAEE++NE PK CENNNGFLED+V
Sbjct: 61  RQYQFPPESHTLSVELNQLIGNSDSVSTLQAGEGSVAAEERTNEVPKMCENNNGFLEDDV 120

Query: 73  SDKKDDDEKGNGNDGSFFDSNICLDLARDTPPPPPC--DLLC--------------KAIP 116
           S+K  D EKG+G DGSFFD NICLDLA D  P   C   L C              K  P
Sbjct: 121 SEKTGDVEKGSGGDGSFFDCNICLDLATD--PVVTCCGHLFCWPCLYRWLHVHSDAKECP 178

Query: 117 SVRGWVTVKNVTPMYGCENSTRESEKDLSLKIPLRPQG-----WR--------------- 156
             +G VT+KNVTP+YG  ++TRE E+DL L+IP RP       WR               
Sbjct: 179 VCKGEVTIKNVTPIYGRGSNTREPEEDLGLEIPHRPHARRVESWRQTIQRSSFSLPMEEM 238

Query: 157 ------RFGLAHHLTPPRDGSSARETGERANSLINRILTSWGICGEQNTDSALPDDVDM- 209
                 RF L   L P +D +  RE G+R N+L++RI+T  G   EQN  + L D VD+ 
Sbjct: 239 IRRLGSRFDLTRDLNPMQDSNGVREMGDRTNALLSRIMTLRGQRAEQNPMAPLDDIVDLT 298

Query: 210 HSGSN---AEGEAIWLRSLLLQRQAQAHRAPTFSYSFSSTLNSAERCL------------ 254
           HSG++   A  +A  + SLLL+R     +  +   S +S LNSAER +            
Sbjct: 299 HSGTSSPEAARQARRIHSLLLRRSQSNSQRSSTHNSHTSALNSAERLIEAYFRNHPTGRN 358

Query: 255 -------------------------MDTAVEIDSMVLLSTSSSRRRSDSSRVLDVDS 286
                                    +DTAVEIDSM  LSTSSSRRR+D+SRV D+D+
Sbjct: 359 QDPPLPVDDRDSFSSIAAVINSESQVDTAVEIDSMGSLSTSSSRRRNDTSRVSDMDT 415

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224091605|ref|XP_002309298.1| predicted protein [Populus trichocarpa] gi|222855274|gb|EEE92821.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225441479|ref|XP_002279934.1| PREDICTED: uncharacterized protein LOC100260713 isoform 1 [Vitis vinifera] gi|359482169|ref|XP_003632722.1| PREDICTED: uncharacterized protein LOC100260713 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224138094|ref|XP_002322728.1| predicted protein [Populus trichocarpa] gi|222867358|gb|EEF04489.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297817140|ref|XP_002876453.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297322291|gb|EFH52712.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22331846|ref|NP_191362.2| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|42572715|ref|NP_974453.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|42572717|ref|NP_974454.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|334186074|ref|NP_001190122.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|19698885|gb|AAL91178.1| putative protein [Arabidopsis thaliana] gi|30387527|gb|AAP31929.1| At3g58030 [Arabidopsis thaliana] gi|332646210|gb|AEE79731.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|332646211|gb|AEE79732.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|332646212|gb|AEE79733.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|332646213|gb|AEE79734.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255564084|ref|XP_002523040.1| rnf5, putative [Ricinus communis] gi|223537723|gb|EEF39344.1| rnf5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357509977|ref|XP_003625277.1| RING finger protein [Medicago truncatula] gi|355500292|gb|AES81495.1| RING finger protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|358248349|ref|NP_001240122.1| uncharacterized protein LOC100811099 [Glycine max] gi|255645563|gb|ACU23276.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356504872|ref|XP_003521218.1| PREDICTED: uncharacterized protein LOC100782225 isoform 1 [Glycine max] gi|356504874|ref|XP_003521219.1| PREDICTED: uncharacterized protein LOC100782225 isoform 2 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
TAIR|locus:2095833436 AT3G58030 [Arabidopsis thalian 0.413 0.295 0.307 3.5e-15
TAIR|locus:2064584425 AT2G42030 [Arabidopsis thalian 0.483 0.355 0.324 9.3e-12
TAIR|locus:2095833 AT3G58030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 161 (61.7 bits), Expect = 3.5e-15, Sum P(2) = 3.5e-15
 Identities = 44/143 (30%), Positives = 62/143 (43%)

Query:    28 TEVVNLDDWVDDPIDRIR-EVFAAEEKSNEAPKTCENNNGFLXXXXXXXXXXXXXXXXXX 86
             T  + L+  + + ++R   +     E+ NE  K CEN +G L                  
Sbjct:    74 TMAIELNQLMGNSVNRAAMQTGEGSERGNEDLKMCENGDGALGDGVLDKKADVEKSSGSD 133

Query:    87 XSFFDSNICLDLARDTXXXXXCDLLC-------------KAIPSVRGWVTVKNVTPMYGC 133
              +FFD NICLDL+++        L C             K  P  +G VT K VTP+YG 
Sbjct:   134 GNFFDCNICLDLSKEPVLTCCGHLYCWPCLYQWLQISDAKECPVCKGEVTSKTVTPIYGR 193

Query:   134 ENSTRESEKDLSLKIPLRPQGWR 156
              N  RE E+ L  K+P+RP   R
Sbjct:   194 GNHKREIEESLDTKVPMRPHARR 216
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2064584 AT2G42030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 312
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.82
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.31
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.46
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.38
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.11
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.09
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.06
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.96
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.9
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.7
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.52
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.49
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.46
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.46
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.41
PHA02929238 N1R/p28-like protein; Provisional 97.11
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.05
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.92
PF1463444 zf-RING_5: zinc-RING finger domain 96.86
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.79
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 96.74
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 96.61
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.03
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.88
PHA02926242 zinc finger-like protein; Provisional 95.84
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 95.84
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 95.78
COG5152259 Uncharacterized conserved protein, contains RING a 95.0
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 94.81
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 94.62
KOG0297 391 consensus TNF receptor-associated factor [Signal t 93.94
COG5222427 Uncharacterized conserved protein, contains RING Z 93.34
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 93.22
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 93.03
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 92.71
KOG4367 699 consensus Predicted Zn-finger protein [Function un 90.82
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 90.56
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 90.35
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 89.9
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 89.74
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 89.41
PF04641260 Rtf2: Rtf2 RING-finger 88.64
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 87.61
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 87.24
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 86.43
KOG4739233 consensus Uncharacterized protein involved in syna 86.17
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 85.78
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 84.76
KOG1002791 consensus Nucleotide excision repair protein RAD16 82.5
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 81.47
KOG3002299 consensus Zn finger protein [General function pred 81.35
COG5242296 TFB4 RNA polymerase II transcription initiation/nu 80.24
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.82  E-value=3.5e-21  Score=176.72  Aligned_cols=110  Identities=32%  Similarity=0.511  Sum_probs=79.5

Q ss_pred             CCCCeeeeccccccccCCCCCCCCC-CCC--------------ccCcccccccccCCcccccccCCCccccccccCCCCC
Q 036958           85 NDGSFFDSNICLDLARDTPPPPPCD-LLC--------------KAIPSVRGWVTVKNVTPMYGCENSTRESEKDLSLKIP  149 (312)
Q Consensus        85 ~~~e~f~CpICLDvfrDPVv~T~CG-lFC--------------k~CPvCR~~vs~~~L~Pnygl~ns~~e~~k~~~~~IP  149 (312)
                      .++.+|+|+||||.++|||+ |.|| +||              +.|||||..++.+.|+|+||++....+..+.  ..||
T Consensus        43 ~~~~~FdCNICLd~akdPVv-TlCGHLFCWpClyqWl~~~~~~~~cPVCK~~Vs~~~vvPlYGrG~~~~~~~~~--~~vP  119 (230)
T KOG0823|consen   43 RDGGFFDCNICLDLAKDPVV-TLCGHLFCWPCLYQWLQTRPNSKECPVCKAEVSIDTVVPLYGRGSKKPSDPRK--KDVP  119 (230)
T ss_pred             CCCCceeeeeeccccCCCEE-eecccceehHHHHHHHhhcCCCeeCCccccccccceEEeeeccCCCCCCCccc--ccCC
Confidence            68899999999999999999 9999 999              4699999999999999999999864433221  1299


Q ss_pred             CCCCCCccCCccccCCCCCCCCCcch---hhhhhhhhhhhhhhcccccccCCCC
Q 036958          150 LRPQGWRRFGLAHHLTPPRDGSSARE---TGERANSLINRILTSWGICGEQNTD  200 (312)
Q Consensus       150 pRP~~~Rr~~l~~~l~~~~d~~g~~~---~~er~~s~~~R~lt~rg~r~~qnp~  200 (312)
                      +||+++|...++..+..-.. .|-+.   +..+..+  ++|++++|++.++.|.
T Consensus       120 ~RP~~~R~e~~~p~~~~~~~-~g~r~~g~~~~~~~~--~~f~~s~~i~~~~~~v  170 (230)
T KOG0823|consen  120 PRPAGQRYESKRPTPQNRGN-HGFRFFGFRLGEESS--NRFMYSFGIGLFGDPV  170 (230)
T ss_pred             CCCCCccccccCCCCccccc-cccccccccccccCC--cceeEEeecccCCCce
Confidence            99999996544433221110 01111   1111112  8899999999888333

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>COG5242 TFB4 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 44.8 bits (105), Expect = 3e-05
 Identities = 45/324 (13%), Positives = 86/324 (26%), Gaps = 106/324 (32%)

Query: 31  VNLDDWVDDP-----IDRIREVFAAEE------KSNEAPKT-------CENNNG----FL 68
           V  D +VD+       D  + + + EE        +    T                 F+
Sbjct: 24  VFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFV 83

Query: 69  EDEVSDKKD---------DDEKGNGNDGSFFDSNICLD-LARDTPP--------PPPCDL 110
           E+    + +          +++        +      D L  D             P   
Sbjct: 84  EE--VLRINYKFLMSPIKTEQRQPSMMTRMYIE--QRDRLYNDNQVFAKYNVSRLQPYLK 139

Query: 111 LCKAIPSVR--GWVTVKNVTPMYGCENSTRESEKDLSLKIPLRPQG---WRRFGLAHHLT 165
           L +A+  +R    V +     + G   +    +  LS K+  +      W      +   
Sbjct: 140 LRQALLELRPAKNVLIDG---VLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCN--- 193

Query: 166 PPRDGSSARETGERANSLINRILTSWGICGEQNTDSALPDDVDMHSGSNAEGEAIWLRSL 225
                 S     E    L+ +I  +W       +D +    + +HS          LR L
Sbjct: 194 ------SPETVLEMLQKLLYQIDPNW----TSRSDHSSNIKLRIHSIQA------ELRRL 237

Query: 226 LLQRQAQAHRAPTFSYSFSSTLNSAERCL--MD--------TAVEIDSMVLLSTSSSRRR 275
           L  +           Y         E CL  +          A  +   +LL+T   R  
Sbjct: 238 LKSKP----------Y---------ENCLLVLLNVQNAKAWNAFNLSCKILLTT---R-- 273

Query: 276 SDSSRVLDVDSGHSGTIQTENCRK 299
                   + +  +  I  ++   
Sbjct: 274 -FKQVTDFLSAATTTHISLDHHSM 296

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.91
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.87
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.85
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.84
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.83
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.79
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.76
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.74
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.73
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.65
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.62
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.62
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.62
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.6
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.59
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.57
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.56
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.55
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.55
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.54
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.53
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.51
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.49
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.49
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.48
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.44
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.43
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.39
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.35
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.34
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.34
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.3
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.3
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.28
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.27
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.26
2ect_A78 Ring finger protein 126; metal binding protein, st 98.24
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.22
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.21
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.19
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.18
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.16
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.14
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.13
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.12
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.06
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.05
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.04
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.97
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.94
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.92
2ea5_A68 Cell growth regulator with ring finger domain prot 97.91
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.9
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.89
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.89
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.88
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.75
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.61
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.57
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.49
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.46
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.38
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.28
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.1
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 96.34
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.11
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 94.79
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 91.2
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 89.63
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 88.02
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 83.67
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 81.9
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
Probab=98.91  E-value=1.4e-10  Score=88.65  Aligned_cols=52  Identities=15%  Similarity=0.151  Sum_probs=45.9

Q ss_pred             CCCCCeeeeccccccccCCCCCCCCC-CCC-----------ccCcccccccccCCcccccccCCC
Q 036958           84 GNDGSFFDSNICLDLARDTPPPPPCD-LLC-----------KAIPSVRGWVTVKNVTPMYGCENS  136 (312)
Q Consensus        84 ~~~~e~f~CpICLDvfrDPVv~T~CG-lFC-----------k~CPvCR~~vs~~~L~Pnygl~ns  136 (312)
                      ....+.|.|+||+++|+|||+ ++|| .||           ..||+|+..+....|+||+.+.+.
T Consensus         9 ~~~p~~~~CpI~~~~m~dPV~-~~cGhtf~r~~I~~~l~~~~~cP~~~~~l~~~~l~pn~~L~~~   72 (85)
T 2kr4_A            9 SDAPDEFRDPLMDTLMTDPVR-LPSGTVMDRSIILRHLLNSPTDPFNRQMLTESMLEPVPELKEQ   72 (85)
T ss_dssp             TTCCTTTBCTTTCSBCSSEEE-CTTSCEEEHHHHHHHHHHCSBCTTTCCBCCGGGCEECHHHHHH
T ss_pred             hcCchheECcccCchhcCCeE-CCCCCEECHHHHHHHHhcCCCCCCCcCCCChHhcchHHHHHHH
Confidence            344578999999999999999 9999 999           369999999999999999988553
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.83
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.8
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.8
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.74
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.64
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.57
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.5
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.48
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.13
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.81
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.79
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.49
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 96.91
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 96.8
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.09
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 91.38
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.83  E-value=1.6e-10  Score=85.46  Aligned_cols=49  Identities=16%  Similarity=0.243  Sum_probs=44.0

Q ss_pred             CCeeeeccccccccCCCCCCCCC-CCC------------ccCcccccccccCCcccccccCCC
Q 036958           87 GSFFDSNICLDLARDTPPPPPCD-LLC------------KAIPSVRGWVTVKNVTPMYGCENS  136 (312)
Q Consensus        87 ~e~f~CpICLDvfrDPVv~T~CG-lFC------------k~CPvCR~~vs~~~L~Pnygl~ns  136 (312)
                      -+.|.|+||+++|+|||+ ++|| .||            ..||+|+..+....+.||+.+.+.
T Consensus         5 P~~l~CpIc~~l~~dPv~-~~cGhtfc~~ci~~~l~~~~~~cP~c~~~l~~~~l~pN~~L~~~   66 (80)
T d2c2la2           5 PDYLCGKISFELMREPCI-TPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEV   66 (80)
T ss_dssp             CSTTBCTTTCSBCSSEEE-CSSCCEEETTHHHHHHHHTCSSCTTTCCCCCGGGCEECHHHHHH
T ss_pred             CccccCcCcCchhhhhcc-cCCcCeecHHHHHHHHhcCCccCCCccccccccccccHHHHHHH
Confidence            378999999999999999 9999 999            359999999999999999888654
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure