Citrus Sinensis ID: 036960


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MEILQDIGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTLELRNCNTLQSLPKLLLPSYPEKVDTFMLESLSKLFRIITTRKLTYFIFTKCLKLNKSGNILADSQQKIQHMFSLYYPYFVSKMVANVGCKCRQFGAAKVENQMRHRIWCCKS
ccccccccccccccEEEccccccccccHHHHccccccEEcccccccccccccccHHHcccccEEccccccccccccccccccccccccccccccccccccccccccHHccccccccEEccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHcHHHHHHccccccccc
ccccHHHHHHHHHHHEcccccccccccHHHccHHHHcEEEccccccccccHHccHHHHHHHcEEcccccccHcHccHHHccccHHHHcHccHHHHHHHHHHHHccccEEEEEEcHHHHcccHHHHHHHHHHHHHHHHcHHHcccccccccccHHHHHHHHccHHccccEEEEEccc
meilqdigCLSLLKELNLCvndfqrlpasigslsslKRMNLvenkldnlpitisikqisplrtlelrncntlqslpklllpsypekvDTFMLESLSKLFRIITTRKLTYFIFTKCLKlnksgnilaDSQQKIQHMFSLYYPYFVSKMVANvgckcrqfGAAKVENQMRHRIWCCKS
MEILQDIGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVEnkldnlpitisikqisplrtlELRNCNTLQSLPKLLLPSYPEKVDTFMLESLSKLFRIITTRKLTYFIFTKCLKLNKSGNILADSQQKIQHMFSLYYPYFVSKMVANVGCKCRQFGAAKVENQMRHRIWCCKS
MEILQDIGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTLELRNCNTLQSLPKLLLPSYPEKVDTFMLESLSKLFRIITTRKLTYFIFTKCLKLNKSGNILADSQQKIQHMFSLYYPYFVSKMVANVGCKCRQFGAAKVENQMRHRIWCCKS
**ILQDIGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTLELRNCNTLQSLPKLLLPSYPEKVDTFMLESLSKLFRIITTRKLTYFIFTKCLKLNKSGNILADSQQKIQHMFSLYYPYFVSKMVANVGCKCRQFGAAKVENQMRHRIWCC**
MEILQDIGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTLELRNCNTLQSLPKLLLPSYPEKVDTFMLESLSKLFRIITTRKLTYFIFTKCLKLNKSGNILADSQQKIQHMFSLYYPYFVSKMVANVGCKCRQFGAAKVENQMRHRIWCC**
MEILQDIGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTLELRNCNTLQSLPKLLLPSYPEKVDTFMLESLSKLFRIITTRKLTYFIFTKCLKLNKSGNILADSQQKIQHMFSLYYPYFVSKMVANVGCKCRQFGAAKVENQMRHRIWCCKS
MEILQDIGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTLELRNCNTLQSLPKLLLPSYPEKVDTFMLESLSKLFRIITTRKLTYFIFTKCLKLNKSGNILADSQQKIQHMFSLYYPYFVSKMVANVGCKCRQFGAAKVENQMRHRIWCCKS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEILQDIGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTLELRNCNTLQSLPKLLLPSYPEKVDTFMLESLSKLFRIITTRKLTYFIFTKCLKLNKSGNILADSQQKIQHMFSLYYPYFVSKMVANVGCKCRQFGAAKVENQMRHRIWCCKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query176 2.2.26 [Sep-21-2011]
Q9ERV7 915 p53-induced protein with yes no 0.414 0.079 0.412 6e-07
Q6UWE0 723 E3 ubiquitin-protein liga yes no 0.403 0.098 0.405 1e-06
Q80ZI6 727 E3 ubiquitin-protein liga no no 0.505 0.122 0.351 2e-06
Q40392 1144 TMV resistance protein N N/A no 0.437 0.067 0.395 6e-06
Q9HB75 910 p53-induced protein with no no 0.426 0.082 0.397 3e-05
Q7XA40 992 Putative disease resistan N/A no 0.357 0.063 0.4 7e-05
Q7KRY7 1851 Protein lap4 OS=Drosophil yes no 0.659 0.062 0.362 0.0001
Q9Y4C4 1052 Malignant fibrous histioc no no 0.403 0.067 0.364 0.0001
O75427 683 Leucine-rich repeat and c no no 0.380 0.098 0.352 0.0004
Q1ZXD6 2800 Probable serine/threonine yes no 0.329 0.020 0.428 0.0005
>sp|Q9ERV7|PIDD_MOUSE p53-induced protein with a death domain OS=Mus musculus GN=Pidd PE=1 SV=1 Back     alignment and function desciption
 Score = 53.9 bits (128), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 47/80 (58%), Gaps = 7/80 (8%)

Query: 2   EILQDIGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPL 61
           E+ + +G L  L  L +  N  +RLP ++GSLS+L+R++L EN LD +P      +I  L
Sbjct: 167 ELPEALGALPALTFLTVTHNRLERLPLTLGSLSTLQRLDLSENLLDTIP-----SEIGNL 221

Query: 62  RTLELRN--CNTLQSLPKLL 79
           R+L   N   N LQSLP  L
Sbjct: 222 RSLSELNLASNRLQSLPASL 241




Promotes apoptosis downstream of the tumor suppressor as component of the DNA damage/stress response pathway that connects p53/TP53 to apoptosis. Associates with NEMO/IKBKG and RIP1 and enhances sumoylation and ubiquitination of NEMO/IKBKG which is important for activation of the transcription factor NF-kappa-B. Associates with CASP2/caspase-2 and CRADD/RAIDD, and induces activation of CASP2 which an important regulator in apoptotic pathways.
Mus musculus (taxid: 10090)
>sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 Back     alignment and function description
>sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=2 SV=1 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9HB75|PIDD_HUMAN p53-induced protein with a death domain OS=Homo sapiens GN=PIDD PE=1 SV=2 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 Back     alignment and function description
>sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 Back     alignment and function description
>sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
432095404 694 E3 ubiquitin-protein ligase LRSAM1 [Myot 0.511 0.129 0.389 2e-07
224103133 397 predicted protein [Populus trichocarpa] 0.681 0.302 0.357 2e-07
224145030 1435 tir-nbs-lrr resistance protein [Populus 0.681 0.083 0.385 3e-07
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.693 0.082 0.375 6e-07
297794743 1184 predicted protein [Arabidopsis lyrata su 0.721 0.107 0.352 6e-07
255537139 1137 leucine-rich repeat-containing protein, 0.721 0.111 0.311 7e-07
227438275 1226 disease resistance protein [Brassica rap 0.727 0.104 0.35 9e-07
255563202 1158 leucine-rich repeat containing protein, 0.693 0.105 0.360 2e-06
432106188 635 p53-induced protein with a death domain 0.426 0.118 0.435 2e-06
73968001 728 PREDICTED: E3 ubiquitin-protein ligase L 0.505 0.122 0.382 9e-06
>gi|432095404|gb|ELK26603.1| E3 ubiquitin-protein ligase LRSAM1 [Myotis davidii] Back     alignment and taxonomy information
 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 62/95 (65%), Gaps = 5/95 (5%)

Query: 5   QDIGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTL 64
           +DIG L+ L+ LNL  N    LP SIG+L+ L+ +N+ +NKL  LP T+   ++  LRTL
Sbjct: 38  EDIGQLTALQVLNLERNQLTHLPRSIGNLTQLQTLNVKDNKLKELPDTLG--ELRSLRTL 95

Query: 65  ELRNCNTLQSLPKLLLPSYPEKVDTFMLESLSKLF 99
           ++R+ N +Q LP++L  ++   ++T  L++ S +F
Sbjct: 96  DIRD-NEIQRLPQML--AHVRTLETLSLDAASMVF 127




Source: Myotis davidii

Species: Myotis davidii

Genus: Myotis

Family: Vespertilionidae

Order: Chiroptera

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|224103133|ref|XP_002334087.1| predicted protein [Populus trichocarpa] gi|222869543|gb|EEF06674.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145030|ref|XP_002325501.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862376|gb|EEE99882.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297794743|ref|XP_002865256.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297311091|gb|EFH41515.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|227438275|gb|ACP30627.1| disease resistance protein [Brassica rapa subsp. pekinensis] Back     alignment and taxonomy information
>gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|432106188|gb|ELK32081.1| p53-induced protein with a death domain [Myotis davidii] Back     alignment and taxonomy information
>gi|73968001|ref|XP_548450.2| PREDICTED: E3 ubiquitin-protein ligase LRSAM1 isoform 1 [Canis lupus familiaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
TAIR|locus:2122925 417 AT4G19470 [Arabidopsis thalian 0.670 0.282 0.338 1.7e-10
TAIR|locus:2122965 1210 AT4G19510 [Arabidopsis thalian 0.676 0.098 0.384 1.9e-10
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.795 0.114 0.326 1.1e-09
UNIPROTKB|E2RR59 728 LRSAM1 "Uncharacterized protei 0.505 0.122 0.382 4e-09
UNIPROTKB|J9P525 728 LRSAM1 "Uncharacterized protei 0.505 0.122 0.382 4e-09
RGD|1564403 727 Lrsam1 "leucine rich repeat an 0.505 0.122 0.361 8.3e-09
UNIPROTKB|Q08E63 724 LRSAM1 "Uncharacterized protei 0.505 0.122 0.361 1.3e-08
UNIPROTKB|F1RS16 723 LRSAM1 "Uncharacterized protei 0.505 0.123 0.372 1.7e-08
MGI|MGI:2684789 727 Lrsam1 "leucine rich repeat an 0.505 0.122 0.351 2.8e-08
UNIPROTKB|Q6UWE0 723 LRSAM1 "E3 ubiquitin-protein l 0.403 0.098 0.405 1.2e-07
TAIR|locus:2122925 AT4G19470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 155 (59.6 bits), Expect = 1.7e-10, P = 1.7e-10
 Identities = 42/124 (33%), Positives = 68/124 (54%)

Query:    14 KELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTLELRNCNTLQ 73
             +++ L   +  + P +   LSSL+ + L  N ++NLP   SIK++  L++L L+NC  L 
Sbjct:    32 RDMYLTDCNLYKFPDNFSCLSSLQSLCLSRNSIENLPG--SIKKLHHLKSLYLKNCKNLI 89

Query:    74 SLPKLLLPSYPEKVDTFMLESLSKLFRIITTRKLTY--FIFTKCLKLNKSGN--ILADSQ 129
             SLP L    Y +      LE++SK   ++   + T+  F+FT C KLN+     I+A +Q
Sbjct:    90 SLPVLPSNQYLDVHGCISLETVSKPMTLLVIAEKTHSTFVFTDCYKLNRDAQEKIVAHTQ 149

Query:   130 QKIQ 133
              K Q
Sbjct:   150 LKSQ 153




GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR59 LRSAM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P525 LRSAM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1564403 Lrsam1 "leucine rich repeat and sterile alpha motif containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E63 LRSAM1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RS16 LRSAM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2684789 Lrsam1 "leucine rich repeat and sterile alpha motif containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q6UWE0 LRSAM1 "E3 ubiquitin-protein ligase LRSAM1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 37.9 bits (88), Expect = 0.002
 Identities = 27/80 (33%), Positives = 48/80 (60%), Gaps = 2/80 (2%)

Query: 2   EILQDIGCLSLLKELNLCVNDFQ-RLPASIGSLSSLKRMNLVENKLDNLPITISIKQISP 60
           EI  +IG L+ L  L+L  N+    +P+S+G+L +L+ + L +NKL   PI  SI  +  
Sbjct: 227 EIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSG-PIPPSIFSLQK 285

Query: 61  LRTLELRNCNTLQSLPKLLL 80
           L +L+L + +    +P+L++
Sbjct: 286 LISLDLSDNSLSGEIPELVI 305


Length = 968

>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 176
KOG0617264 consensus Ras suppressor protein (contains leucine 99.1
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.03
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.03
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.93
KOG0617264 consensus Ras suppressor protein (contains leucine 98.9
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.89
PLN03150623 hypothetical protein; Provisional 98.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.71
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.67
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.67
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.67
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.66
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.63
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.62
PLN03150623 hypothetical protein; Provisional 98.58
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.57
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.57
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.5
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.49
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.45
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.45
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.45
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.3
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.27
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.24
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.24
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.06
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.04
KOG4237498 consensus Extracellular matrix protein slit, conta 98.02
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.0
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.95
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.81
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.61
PRK15386 426 type III secretion protein GogB; Provisional 97.56
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.55
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.52
PRK15386 426 type III secretion protein GogB; Provisional 97.36
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.26
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.21
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.13
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.04
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.0
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.86
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.53
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.53
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.24
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.15
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.12
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 95.94
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.77
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 95.71
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 95.59
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.23
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.13
smart0037026 LRR Leucine-rich repeats, outliers. 95.13
smart0037026 LRR Leucine-rich repeats, outliers. 95.07
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.07
KOG2982 418 consensus Uncharacterized conserved protein [Funct 94.78
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.75
KOG0473 326 consensus Leucine-rich repeat protein [Function un 94.32
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.22
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.35
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 92.04
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 91.78
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 91.33
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.87
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 90.55
KOG2982 418 consensus Uncharacterized conserved protein [Funct 89.58
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 89.57
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 87.05
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 86.48
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.47
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.1
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.10  E-value=2e-11  Score=90.93  Aligned_cols=109  Identities=27%  Similarity=0.291  Sum_probs=74.1

Q ss_pred             ccCccccCCCCCcEEeccCCCCccccccccCCCCCcEEEeeCCCCcccCcccccccCCccceeeccccCCC--CCCchhh
Q 036960            2 EILQDIGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTLELRNCNTL--QSLPKLL   79 (176)
Q Consensus         2 ~lP~~l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~l~~n~l~~lP~~~~~~~l~~L~~L~l~~cn~l--~~lP~~l   79 (176)
                      .+|+.+..+.+|+.|++++|+|+++|.+++.+++|+.|++.-|++..+|..|+  .++.|+.||+.. |++  ..+|..+
T Consensus        47 ~vppnia~l~nlevln~~nnqie~lp~~issl~klr~lnvgmnrl~~lprgfg--s~p~levldlty-nnl~e~~lpgnf  123 (264)
T KOG0617|consen   47 VVPPNIAELKNLEVLNLSNNQIEELPTSISSLPKLRILNVGMNRLNILPRGFG--SFPALEVLDLTY-NNLNENSLPGNF  123 (264)
T ss_pred             ecCCcHHHhhhhhhhhcccchhhhcChhhhhchhhhheecchhhhhcCccccC--CCchhhhhhccc-cccccccCCcch
Confidence            46777777888888888888888888888888888888888888777888888  788888888877 777  4567554


Q ss_pred             hc--CccceeeccCCcCCcccccc-cCCCCccEEEeeCC
Q 036960           80 LP--SYPEKVDTFMLESLSKLFRI-ITTRKLTYFIFTKC  115 (176)
Q Consensus        80 ~~--~L~~~L~l~~~~~L~~l~~~-~~~~~l~~l~~~~c  115 (176)
                      +.  .| +.|++++. ..+.+|.. ....+++.+.+...
T Consensus       124 f~m~tl-ralyl~dn-dfe~lp~dvg~lt~lqil~lrdn  160 (264)
T KOG0617|consen  124 FYMTTL-RALYLGDN-DFEILPPDVGKLTNLQILSLRDN  160 (264)
T ss_pred             hHHHHH-HHHHhcCC-CcccCChhhhhhcceeEEeeccC
Confidence            43  45 55555543 34555332 23445555555443



>PLN03210 Resistant to P Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-09
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 7e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 61.1 bits (149), Expect = 8e-12
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 3/92 (3%)

Query: 7   IGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTLEL 66
              LS L+ + +       LP ++   + L+ + L  N L  LP   SI  ++ LR L +
Sbjct: 100 AFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALP--ASIASLNRLRELSI 157

Query: 67  RNCNTLQSLPKLLLPSYPEKVDTFMLESLSKL 98
           R C  L  LP+ L  S     +   L +L  L
Sbjct: 158 RACPELTELPEPLA-STDASGEHQGLVNLQSL 188


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.45
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.41
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.37
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.34
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.34
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.34
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.32
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.31
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.31
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.31
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.3
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.29
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.29
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.28
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.28
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.28
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.27
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.27
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.26
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.26
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.26
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.25
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.24
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.24
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.24
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.23
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.23
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.22
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.22
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.21
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.2
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.2
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.2
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.19
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.19
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.19
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.18
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.17
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.17
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.17
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.16
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.16
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.15
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.15
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.15
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.15
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.12
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.1
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.02
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.02
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.02
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.02
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.02
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.02
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.01
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.01
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.0
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.0
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.0
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.99
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.98
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.98
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.97
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.96
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.95
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 98.95
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.94
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.94
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.9
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.9
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.89
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.88
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.86
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.84
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.83
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.82
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.77
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.72
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.68
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.56
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.45
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.37
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.37
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.31
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.11
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.1
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.74
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.72
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.7
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.63
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.63
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.62
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.56
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.52
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.49
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.42
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.42
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.95
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.83
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.71
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.58
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.52
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.37
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.32
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.01
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 94.15
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.57
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.83
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.45  E-value=4e-13  Score=108.38  Aligned_cols=117  Identities=24%  Similarity=0.354  Sum_probs=80.7

Q ss_pred             ccCccccCCCCCcEEeccCCCC-ccccccccC---------CCCCcEEEeeCCCCcccCcccccccCCccceeeccccCC
Q 036960            2 EILQDIGCLSLLKELNLCVNDF-QRLPASIGS---------LSSLKRMNLVENKLDNLPITISIKQISPLRTLELRNCNT   71 (176)
Q Consensus         2 ~lP~~l~~l~~L~~L~L~~n~l-~~lp~~~~~---------l~~L~~L~l~~n~l~~lP~~~~~~~l~~L~~L~l~~cn~   71 (176)
                      .+|+.++.+++|++|++++|++ ..+|..++.         +++|++|++++|+++.+|..+.  .+++|+.|++++ |.
T Consensus       141 ~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~--~l~~L~~L~L~~-N~  217 (328)
T 4fcg_A          141 ALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIA--NLQNLKSLKIRN-SP  217 (328)
T ss_dssp             CCCGGGGGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGG--GCTTCCEEEEES-SC
T ss_pred             cCcHHHhcCcCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCCCcCcchHhhc--CCCCCCEEEccC-CC
Confidence            4677777778888888877644 347766543         7777777777777777777777  777777777777 77


Q ss_pred             CCCCchhhhc--CccceeeccCCcCCccccccc-CCCCccEEEeeCCcCccccc
Q 036960           72 LQSLPKLLLP--SYPEKVDTFMLESLSKLFRII-TTRKLTYFIFTKCLKLNKSG  122 (176)
Q Consensus        72 l~~lP~~l~~--~L~~~L~l~~~~~L~~l~~~~-~~~~l~~l~~~~c~~l~~~~  122 (176)
                      ++.+|..+..  +| ++|+++++.....++... ...+++.+++++|..+...+
T Consensus       218 l~~l~~~l~~l~~L-~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p  270 (328)
T 4fcg_A          218 LSALGPAIHHLPKL-EELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLP  270 (328)
T ss_dssp             CCCCCGGGGGCTTC-CEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCC
T ss_pred             CCcCchhhccCCCC-CEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcc
Confidence            7777766543  67 777777776666554433 34567777777776665544



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 176
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 38.7 bits (88), Expect = 2e-04
 Identities = 17/71 (23%), Positives = 25/71 (35%), Gaps = 9/71 (12%)

Query: 9   CLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTLELRN 68
               L+ELN+  N    LPA    L  L       N L  +P     +    L+ L +  
Sbjct: 282 LPPSLEELNVSNNKLIELPALPPRLERL---IASFNHLAEVP-----ELPQNLKQLHVEY 333

Query: 69  CNTLQSLPKLL 79
              L+  P + 
Sbjct: 334 NP-LREFPDIP 343


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.28
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.24
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.22
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.12
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.06
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.04
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.03
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.0
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.99
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.96
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.96
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.93
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.92
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.9
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.85
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.77
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.62
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.56
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.54
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.2
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.17
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.15
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.82
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.51
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.29
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.83
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.38
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.1
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.71
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.22
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 92.3
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: U2A'-like
domain: Splicesomal U2A' protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.35  E-value=1.7e-12  Score=93.35  Aligned_cols=106  Identities=18%  Similarity=0.197  Sum_probs=87.8

Q ss_pred             ccccCCCCCcEEeccCCCCccccccccCCCCCcEEEeeCCCCcccCcccccccCCccceeeccccCCCCCCchhhh---c
Q 036960            5 QDIGCLSLLKELNLCVNDFQRLPASIGSLSSLKRMNLVENKLDNLPITISIKQISPLRTLELRNCNTLQSLPKLLL---P   81 (176)
Q Consensus         5 ~~l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~l~~n~l~~lP~~~~~~~l~~L~~L~l~~cn~l~~lP~~l~---~   81 (176)
                      +.+.+..++++|+|++|+|+.+|..+..+++|+.|++++|+|+.++ .+.  .+++|++|++++ |.++.+|..+.   +
T Consensus        12 ~~~~n~~~lr~L~L~~n~I~~i~~~~~~l~~L~~L~Ls~N~i~~l~-~~~--~l~~L~~L~ls~-N~i~~l~~~~~~~l~   87 (162)
T d1a9na_          12 AQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLD-GFP--LLRRLKTLLVNN-NRICRIGEGLDQALP   87 (162)
T ss_dssp             CEEECTTSCEEEECTTSCCCSCCCGGGGTTCCSEEECCSSCCCEEC-CCC--CCSSCCEEECCS-SCCCEECSCHHHHCT
T ss_pred             HhccCcCcCcEEECCCCCCCccCccccccccCCEEECCCCCCCccC-Ccc--cCcchhhhhccc-ccccCCCcccccccc
Confidence            3466788999999999999999877788999999999999999995 588  999999999999 99999987654   3


Q ss_pred             CccceeeccCCcCCccccc---ccCCCCccEEEeeCCc
Q 036960           82 SYPEKVDTFMLESLSKLFR---IITTRKLTYFIFTKCL  116 (176)
Q Consensus        82 ~L~~~L~l~~~~~L~~l~~---~~~~~~l~~l~~~~c~  116 (176)
                      ++ ++|+++++ .+..+++   ......++.+.+.++.
T Consensus        88 ~L-~~L~L~~N-~i~~~~~l~~l~~l~~L~~L~l~~N~  123 (162)
T d1a9na_          88 DL-TELILTNN-SLVELGDLDPLASLKSLTYLCILRNP  123 (162)
T ss_dssp             TC-CEEECCSC-CCCCGGGGGGGGGCTTCCEEECCSSG
T ss_pred             cc-ccceeccc-cccccccccccccccccchhhcCCCc
Confidence            78 99999876 4555543   2345678889988875



>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure