Citrus Sinensis ID: 036983

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
ICHLSFDAANPESGVPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTTASNVAGANEADPMEQWTESNDATPTASAVPIHQAETRNFWQGHRFLNFLLACMVFAFVISWLFHFNIPS
ccccccccccccccccEEcccccccHHHHHHHHHHHHHHHHHccccEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccc
cccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEcccEEEEccccccccccHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccc
ichlsfdaanpesgvpielgcscKDDLAAAHKQCAEAWFKikgnktceicgttasnvaganeadpmeqwtesndatptasavpihqaetrnfWQGHRFLNFLLACMVFAFVISWLFHFNIPS
ichlsfdaanpesgvPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTTASNVAGANEADPMEQWTESNDATPTASAVPIHQAETRNFWQGHRFLNFLLACMVFAFVISWLFHFNIPS
ICHLSFDAANPESGVPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTTASNVAGANEADPMEQWTESNDATPTASAVPIHQAETRNFWQGHRFLNFLLACMVFAFVISWLFHFNIPS
**************VPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTTASNV*************************PIHQAETRNFWQGHRFLNFLLACMVFAFVISWLFHFNI**
ICHLSF*AAN****VPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTTASNVAGANEADPME***********************NFWQGHRFLNFLLACMVFAFVISWLFHFNIP*
ICHLSFDAANPESGVPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTTASNVAGA*********************VPIHQAETRNFWQGHRFLNFLLACMVFAFVISWLFHFNIPS
*C**SFDAAN*ESGVPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTTASNVAGANEAD************************TRNFWQGHRFLNFLLACMVFAFVISWLFHFNIPS
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ICHLSFDAANPESGVPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTTASNVAGANEADPMEQWTESNDATPTASAVPIHQAETRNFWQGHRFLNFLLACMVFAFVISWLFHFNIPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
356501115207 PREDICTED: uncharacterized protein LOC10 1.0 0.589 0.786 1e-50
224101081206 predicted protein [Populus trichocarpa] 1.0 0.592 0.745 3e-50
255648063207 unknown [Glycine max] 1.0 0.589 0.778 4e-50
224109408171 predicted protein [Populus trichocarpa] 0.991 0.707 0.770 2e-49
356551560207 PREDICTED: uncharacterized protein LOC10 1.0 0.589 0.762 1e-48
296086113201 unnamed protein product [Vitis vinifera] 0.983 0.597 0.729 9e-47
449441334215 PREDICTED: uncharacterized protein LOC10 1.0 0.567 0.730 2e-46
357492501211 hypothetical protein MTR_5g081560 [Medic 1.0 0.578 0.729 5e-46
224090847 229 predicted protein [Populus trichocarpa] 1.0 0.532 0.672 8e-44
297806597208 zinc finger family protein [Arabidopsis 1.0 0.586 0.691 4e-43
>gi|356501115|ref|XP_003519374.1| PREDICTED: uncharacterized protein LOC100816407 [Glycine max] Back     alignment and taxonomy information
 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 96/122 (78%), Positives = 102/122 (83%)

Query: 1   ICHLSFDAANPESGVPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTTASNVAGA 60
           ICHLS D  N ESG PIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICG+ A NVAGA
Sbjct: 86  ICHLSMDMTNHESGTPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGSVARNVAGA 145

Query: 61  NEADPMEQWTESNDATPTASAVPIHQAETRNFWQGHRFLNFLLACMVFAFVISWLFHFNI 120
            E    EQW E+NDA+   S+ P   AET+NFWQGHRFLNFLLACMVFAFVISWLFHFN+
Sbjct: 146 IEIQMTEQWNEANDASTAPSSGPAPLAETQNFWQGHRFLNFLLACMVFAFVISWLFHFNV 205

Query: 121 PS 122
           PS
Sbjct: 206 PS 207

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224101081|ref|XP_002312134.1| predicted protein [Populus trichocarpa] gi|222851954|gb|EEE89501.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255648063|gb|ACU24487.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224109408|ref|XP_002315185.1| predicted protein [Populus trichocarpa] gi|222864225|gb|EEF01356.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356551560|ref|XP_003544142.1| PREDICTED: uncharacterized protein LOC100818979 [Glycine max] Back     alignment and taxonomy information
>gi|296086113|emb|CBI31554.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449441334|ref|XP_004138437.1| PREDICTED: uncharacterized protein LOC101207404 [Cucumis sativus] gi|449519601|ref|XP_004166823.1| PREDICTED: uncharacterized LOC101207404 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357492501|ref|XP_003616539.1| hypothetical protein MTR_5g081560 [Medicago truncatula] gi|355517874|gb|AES99497.1| hypothetical protein MTR_5g081560 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224090847|ref|XP_002309103.1| predicted protein [Populus trichocarpa] gi|222855079|gb|EEE92626.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297806597|ref|XP_002871182.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297317019|gb|EFH47441.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
TAIR|locus:2166399204 AT5G05830 [Arabidopsis thalian 1.0 0.598 0.682 2.5e-42
TAIR|locus:2150084206 AT5G01070 [Arabidopsis thalian 1.0 0.592 0.536 8.8e-31
TAIR|locus:2065620207 AT2G37950 [Arabidopsis thalian 0.967 0.570 0.532 7.9e-30
TAIR|locus:2154523231 AT5G59000 "AT5G59000" [Arabido 0.844 0.445 0.551 3.9e-28
TAIR|locus:2040949222 AT2G34200 [Arabidopsis thalian 0.590 0.324 0.469 3e-14
TAIR|locus:2043664240 AT2G45530 [Arabidopsis thalian 0.450 0.229 0.454 1.2e-09
TAIR|locus:2175158 494 AT5G60580 [Arabidopsis thalian 0.377 0.093 0.543 1.3e-09
TAIR|locus:505006592 370 AT5G08750 [Arabidopsis thalian 0.336 0.110 0.560 2e-08
TAIR|locus:2081076426 AT3G06330 [Arabidopsis thalian 0.885 0.253 0.269 5.6e-08
TAIR|locus:2160619 367 SHA1 "shoot apical meristem ar 0.368 0.122 0.511 7e-08
TAIR|locus:2166399 AT5G05830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 448 (162.8 bits), Expect = 2.5e-42, P = 2.5e-42
 Identities = 84/123 (68%), Positives = 92/123 (74%)

Query:     1 ICHLSFDAANPESGVPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTTASNVAGA 60
             ICH+S DAAN ESGVPIELGCSCK DLAAAHK CAE WFKIKGNK CE+CG+ A NV G+
Sbjct:    81 ICHMSLDAANLESGVPIELGCSCKADLAAAHKHCAETWFKIKGNKICEVCGSIAGNVVGS 140

Query:    61 NEADPMEQWTESNDATP-TASAVPIHQAETRNFWQGHRFLNFLLACMVFAFVISWLFHFN 119
              E +  E   E+N     T         E R+FWQGHRFLNFLLACMVFAFVISWLFHFN
Sbjct:   141 VEVESEESRNEANGVENLTLRTSGPRLVEGRSFWQGHRFLNFLLACMVFAFVISWLFHFN 200

Query:   120 IPS 122
             +PS
Sbjct:   201 VPS 203
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2150084 AT5G01070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065620 AT2G37950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154523 AT5G59000 "AT5G59000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040949 AT2G34200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043664 AT2G45530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175158 AT5G60580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006592 AT5G08750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081076 AT3G06330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160619 SHA1 "shoot apical meristem arrest 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 4e-13
pfam1290647 pfam12906, RINGv, RING-variant domain 4e-09
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 5e-04
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 58.8 bits (143), Expect = 4e-13
 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 5/51 (9%)

Query: 1  ICHLSFDAANPESGVPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICG 51
          ICH        + G P+   C CK  L   H++C E W    GNKTCEIC 
Sbjct: 4  ICH-----DEGDEGDPLVSPCRCKGSLKYVHQECLERWINESGNKTCEICK 49

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.67
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.64
PHA02825162 LAP/PHD finger-like protein; Provisional 99.62
PHA02862156 5L protein; Provisional 99.57
KOG1609 323 consensus Protein involved in mRNA turnover and st 99.5
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.31
KOG3053 293 consensus Uncharacterized conserved protein [Funct 98.07
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 96.75
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 95.13
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 93.44
COG52191525 Uncharacterized conserved protein, contains RING Z 93.06
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 92.4
PHA02929238 N1R/p28-like protein; Provisional 92.07
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 91.44
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 91.07
cd0016245 RING RING-finger (Really Interesting New Gene) dom 90.96
KOG149384 consensus Anaphase-promoting complex (APC), subuni 89.26
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 88.76
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 88.37
smart0050463 Ubox Modified RING finger domain. Modified RING fi 87.47
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 83.76
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
Probab=99.67  E-value=5.8e-17  Score=101.63  Aligned_cols=46  Identities=46%  Similarity=0.967  Sum_probs=41.5

Q ss_pred             CCCCCCCCCCCCCCCceecCCCccchhhhhhHHHHHHHHhhcCCCeeecCC
Q 036983            1 ICHLSFDAANPESGVPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICG   51 (122)
Q Consensus         1 ICh~~~~~~~~e~~~~l~~pC~CkGsL~~vH~~Cl~~W~~~kg~~~CEIC~   51 (122)
                      ||+++.     +.++++++||.|+|+++++|++||++|+..+++++||||+
T Consensus         4 IC~~~~-----~~~~~l~~PC~C~G~~~~vH~~Cl~~W~~~~~~~~C~iC~   49 (49)
T smart00744        4 ICHDEG-----DEGDPLVSPCRCKGSLKYVHQECLERWINESGNKTCEICK   49 (49)
T ss_pred             CCCCCC-----CCCCeeEeccccCCchhHHHHHHHHHHHHHcCCCcCCCCC
Confidence            788732     3667899999999999999999999999999999999996

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Class
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 2e-12
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 6e-10
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
 Score = 56.7 bits (137), Expect = 2e-12
 Identities = 16/53 (30%), Positives = 20/53 (37%), Gaps = 7/53 (13%)

Query: 1  ICHLSFDAANPESGVPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTT 53
          IC+        E G      C C  +L   H+ C   W  I  N  C+ICG  
Sbjct: 11 ICNE-------ELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVV 56
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.7
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.56
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 96.82
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 96.81
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 96.73
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 96.64
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 96.57
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 96.47
2ecm_A55 Ring finger and CHY zinc finger domain- containing 96.43
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 96.4
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 96.38
2ect_A78 Ring finger protein 126; metal binding protein, st 96.23
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 96.23
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 96.01
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 95.97
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 95.78
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 95.59
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 95.46
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 95.37
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 95.12
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 94.65
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 94.65
2ecw_A85 Tripartite motif-containing protein 30; metal bind 94.59
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 94.59
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 94.54
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 94.47
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 94.31
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 94.06
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 94.03
1z6u_A150 NP95-like ring finger protein isoform B; structura 94.03
2ysl_A73 Tripartite motif-containing protein 31; ring-type 93.79
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 93.5
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 93.44
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 93.41
2ysj_A63 Tripartite motif-containing protein 31; ring-type 93.16
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 92.45
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 92.44
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 92.36
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 92.33
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 91.65
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 91.26
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 91.22
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 90.23
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 89.58
3nw0_A238 Non-structural maintenance of chromosomes element 87.52
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 86.51
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 85.76
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 85.59
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 81.99
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 81.75
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 81.25
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.70  E-value=6.7e-18  Score=108.26  Aligned_cols=49  Identities=31%  Similarity=0.819  Sum_probs=43.2

Q ss_pred             CCCCCCCCCCCCCCCceecCCCccchhhhhhHHHHHHHHhhcCCCeeecCCccccc
Q 036983            1 ICHLSFDAANPESGVPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTTASN   56 (122)
Q Consensus         1 ICh~~~~~~~~e~~~~l~~pC~CkGsL~~vH~~Cl~~W~~~kg~~~CEIC~~~~~n   56 (122)
                      ||+.+.       ++++++||.|+|+++++|++||++|++.+++.+||||++.|+.
T Consensus        11 IC~~~~-------~~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~~~~C~~C~~~~~~   59 (60)
T 1vyx_A           11 ICNEEL-------GNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             TTTEEC-------SCCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             EeecCC-------CCceecCcCCCCchhhhHHHHHHHHHHhCCCCccCCCCCeeec
Confidence            677642       3457899999999999999999999999999999999999964
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.28
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.1
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.03
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 96.85
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.5
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 95.94
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 95.53
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 95.31
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 93.07
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 92.42
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 91.96
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 90.11
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 80.2
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.28  E-value=8.3e-13  Score=81.97  Aligned_cols=41  Identities=29%  Similarity=0.791  Sum_probs=38.7

Q ss_pred             CceecCCCccchhhhhhHHHHHHHHhhcCCCeeecCCcccc
Q 036983           15 VPIELGCSCKDDLAAAHKQCAEAWFKIKGNKTCEICGTTAS   55 (122)
Q Consensus        15 ~~l~~pC~CkGsL~~vH~~Cl~~W~~~kg~~~CEIC~~~~~   55 (122)
                      ++++.||.|+|..+++|+.||++|++.+++.+|++|+++|+
T Consensus        18 ~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~   58 (60)
T d1vyxa_          18 NERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYN   58 (60)
T ss_dssp             CCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCC
T ss_pred             CceeEecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeee
Confidence            45789999999999999999999999999999999999986
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure