Citrus Sinensis ID: 036984


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600---
FHEFKNLEHLVMDQMLVEVNTSFLQIVSELMASLRLLSLSYSRLNKNTILDQGFCQLVHLQELYIRDNDLRDSLLGAWQTTSLQELNVASNKLTRNFPLGLCELVLLRELYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQLTESISSSPLMLLTSIEELILSNNHFQIPISLEPLSNLSKLKAFNGEIYLETESHYNSLTPKFQLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHLNLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFNDLSYNRLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTALSEGYYDAVAPTWDHASAPALSYFSPNGSPMGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIPQLIVLTTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLYGQPLSKSCDDNGLTTVTTEAYTENEEGGSLIDMDSFLITFTVSYGIAIIGIIGVLYVNPYWRRRWFYLVEVCMTSCYYFVGDNLILKRFYRGRV
ccccccccccccccccccccccccccHHHHcccccEEEcccccccccccccccccccccccEEEccccccEEEcccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccEEEcccccccccccccEEEcccccEEEcccccccccccEEEccccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccccccEEEccccccEEcccccHHHccccccccccccccEEccccccccccccHHHcccccccEEEccccEEEEcccccccccccccEEEcccccccccccHHHHHHHHHccccccccccccccccccEEEEEEcccccccccHHHHcccccEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHEEHHHHcccHHHHHHHHHHHHHHcEEEEEEEEEEHHHHHHcccc
cccccccHHHHHHHccccccccccccccccccccEEEEEccccccccccccHHHcccccccEEEcccccccccccccccccccEEEEEccccccccccHHHcccccccEEEEccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEEccccccccccHcccccccEEEEcccccccccccccccccccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHccccccccEEEEEccccccccccHHHHcccccccEEEccccEEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHcHHHHcccccccccccccccccEEEEEccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcEEcccccccc
FHEFKNLEHLVMDQMLVEVNTSFLQIVSELMASLRLLSLSYSRLNKNTILDQGFCQLVHLQELYIRDNDLRDSllgawqttSLQELNVASnkltrnfplGLCELVLLRELYidnndlsgslplcltnltslQVLDVSYNQltesisssplMLLTSIEELIlsnnhfqipisleplsnlsklkafngeiyleteshynsltpkfqltsislsgyrddgtfpkflyhqhdlknadlshlnlsgefpnwlmpihclqklatldvsnnffqghipveigtylpglmhlnlsrnafndlsynrlqgsipnwidrlPQISYLLLANNYIEGEIPAQLCQLKEVRLIdlshnnlsghipFCLVNTalsegyydavaptwdhasapalsyfspngspmgkeETVQILTSMsgidlscnkltgeiptqiGYLTRIRALNlshnnltgtipitfsnlkqIESLDLSYNllhgkipqlIVLTTLAVFRVAYNnlsgkipdrvaqfstfeedsyegnpflygqplskscddnglttvtteayteneeggslidmdSFLITFTVSYGIAIIGIIGVlyvnpywrrRWFYLVEVCMTScyyfvgdnliLKRFYRGRV
fhefknlehlvMDQMLVEVNTSFLQIVSELMASLRLLSLSYSRLNKNTILDQGFCQLVHLQELYIRDNDLRDSLLGAWQTTSLQELNVASNKLTRNFPLGLCELVLLRELYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQLTESISSSPLMLLTSIEELILSNNHFQIPISLEPLSNLSKLKAFNGEIYLETESHYNSLTPKFQLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHLNLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFNDLSYNRLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTALSEGYYDAVAPTWDHASAPALSYFSPNGSPMGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIPQLIVLTTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLYGQPLSKSCDDNGLTTVTTEAyteneeggsliDMDSFLITFTVSYGIAIIGIIGVLYVNPYWRRRWFYLVEVCMTSCyyfvgdnlilKRFYRGRV
FHEFKNLEHLVMDQMLVEVNTSFLQIVSELMAslrllslsysrlNKNTILDQGFCQLVHLQELYIRDNDLRDSLLGAWQTTSLQELNVASNKLTRNFPlglcelvllrelYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQLTESISSSPLMLLTSIEELILSNNHFQIPISLEPLSNLSKLKAFNGEIYLETESHYNSLTPKFQLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHLNLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFNDLSYNRLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTALSEGYYDAVAPTWDHASAPALSYFSPNGSPMGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIPQLIVLTTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLYGQPLSKSCDDNGLTTVTTEAYTENEEGGSLIDMDSFLITFTVSYGIAIIGIIGVLYVNPYWRRRWFYLVEVCMTSCYYFVGDNLILKRFYRGRV
******LEHLVMDQMLVEVNTSFLQIVSELMASLRLLSLSYSRLNKNTILDQGFCQLVHLQELYIRDNDLRDSLLGAWQTTSLQELNVASNKLTRNFPLGLCELVLLRELYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQLTESISSSPLMLLTSIEELILSNNHFQIPISLEPLSNLSKLKAFNGEIYLETESHYNSLTPKFQLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHLNLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFNDLSYNRLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTALSEGYYDAVAPTWDHASAPALSYF************VQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIPQLIVLTTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLYGQPLSKSCDDNGLTTVTTEAYTENEEGGSLIDMDSFLITFTVSYGIAIIGIIGVLYVNPYWRRRWFYLVEVCMTSCYYFVGDNLILKRFYR***
FHEFKNLEHLVMDQMLVEVNTSFLQIVSELMASLRLLSLSYSRLNKNTILDQGFCQLVHLQELYIRDNDLRDSLLGAWQTTSLQELNVASNKLTRNFPLGLCELVLLRELYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQLTESISSSPLMLLTSIEELILSNNHFQIPISLEPLSNLSKLKAFNGEIYLETESHYNSLTPKFQLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHLNLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFNDLSYNRLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTAL*************HASAPALSYFSPNGSPMGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIPQLIVLTTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLYGQPL***************************DMDSFLITFTVSYGIAIIGIIGVLYVNPYWRRRWFYLVEVCMTSCYYFVGDNLILKRFYRGRV
FHEFKNLEHLVMDQMLVEVNTSFLQIVSELMASLRLLSLSYSRLNKNTILDQGFCQLVHLQELYIRDNDLRDSLLGAWQTTSLQELNVASNKLTRNFPLGLCELVLLRELYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQLTESISSSPLMLLTSIEELILSNNHFQIPISLEPLSNLSKLKAFNGEIYLETESHYNSLTPKFQLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHLNLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFNDLSYNRLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTALSEGYYDAVAPTWDHASAPALSYFSPNGSPMGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIPQLIVLTTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLYGQPLSKSCDDNGLTTVTTEAYTENEEGGSLIDMDSFLITFTVSYGIAIIGIIGVLYVNPYWRRRWFYLVEVCMTSCYYFVGDNLILKRFYRGRV
F*EFKNLEHLVMDQMLVEVNTSFLQIVSELMASLRLLSLSYSRLNKNTILDQGFCQLVHLQELYIRDNDLRDSLLGAWQTTSLQELNVASNKLTRNFPLGLCELVLLRELYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQLTESISSSPLMLLTSIEELILSNNHFQIPISLEPLSNLSKLKAFNGEIYLETESHYNSLTPKFQLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHLNLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFNDLSYNRLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTALSEGYYDAVAPTWDHASAPALSYFSPNGSPMGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIPQLIVLTTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLYGQPLSKSCDDNGLTTVTTEAYTENEEGGSLIDMDSFLITFTVSYGIAIIGIIGVLYVNPYWRRRWFYLVEVCMTSCYYFVGDNLILKRF*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FHEFKNLEHLVMDQMLVEVNTSFLQIVSELMASLRLLSLSYSRLNKNTILDQGFCQLVHLQELYIRDNDLRDSLLGAWQTTSLQELNVASNKLTRNFPLGLCELVLLRELYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQLTESISSSPLMLLTSIEELILSNNHFQIPISLEPLSNLSKLKAFNGEIYLETESHYNSLTPKFQLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHLNLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFNDLSYNRLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTALSEGYYDAVAPTWDHASAPALSYFSPNGSPMGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIPQLIVLTTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLYGQPLSKSCDDNGLTTVTTEAYTENEEGGSLIDMDSFLITFTVSYGIAIIGIIGVLYVNPYWRRRWFYLVEVCMTSCYYFVGDNLILKRFYRGRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query603 2.2.26 [Sep-21-2011]
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.736 0.354 0.316 2e-43
C0LGF5 1072 Probable LRR receptor-lik no no 0.689 0.388 0.334 9e-41
Q9LHP4 1141 Receptor-like protein kin no no 0.678 0.358 0.304 2e-37
Q9ZUI0 980 Putative leucine-rich rep no no 0.749 0.461 0.31 2e-37
Q9C9H7847 Receptor-like protein 12 no no 0.786 0.559 0.281 5e-37
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.686 0.405 0.307 1e-35
C0LGS2 1136 Probable LRR receptor-lik no no 0.655 0.347 0.317 1e-35
Q9LJF3 1164 Receptor-like protein kin no no 0.650 0.336 0.313 2e-35
O22476 1196 Protein BRASSINOSTEROID I no no 0.799 0.403 0.300 2e-35
Q9ZWC8 1166 Serine/threonine-protein no no 0.708 0.366 0.284 4e-35
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function desciption
 Score =  177 bits (450), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 166/524 (31%), Positives = 253/524 (48%), Gaps = 80/524 (15%)

Query: 35  RLLSLSYSRLNKNTI---LDQGFCQLVHLQELYIRDNDLRDSL------LGAWQ------ 79
           +L+ L+   LN N++   L      L +LQE  +  N+L   +      LG  +      
Sbjct: 383 QLVELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYE 442

Query: 80  -------------TTSLQELNVASNKLTRNFPLGLCELVLLRELYIDNNDLSGSLPLCLT 126
                         T LQE++   N+L+   P  +  L  L  L++  N+L G++P  L 
Sbjct: 443 NRFSGEMPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLG 502

Query: 127 NLTSLQVLDVSYNQLTESISSSPLMLLTSIEELILSNNHFQ--IPISLEPLSNLSKL--- 181
           N   + V+D++ NQL+ SI SS    LT++E  ++ NN  Q  +P SL  L NL+++   
Sbjct: 503 NCHQMTVIDLADNQLSGSIPSS-FGFLTALELFMIYNNSLQGNLPDSLINLKNLTRINFS 561

Query: 182 -KAFNGEIY-LETESHYNSLTPKFQLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHLNL 239
              FNG I  L   S Y S         ++ +G+  +G  P  L    +L    L     
Sbjct: 562 SNKFNGSISPLCGSSSYLSF-------DVTENGF--EGDIPLELGKSTNLDRLRLGKNQF 612

Query: 240 SGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFNDLSYNRL 299
           +G  P     I    +L+ LD+S N   G IPVE+G     L H+        DL+ N L
Sbjct: 613 TGRIPRTFGKI---SELSLLDISRNSLSGIIPVELG-LCKKLTHI--------DLNNNYL 660

Query: 300 QGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTA 359
            G IP W+ +LP +  L L++N   G +P ++  L  +  + L  N+L+G IP  + N  
Sbjct: 661 SGVIPTWLGKLPLLGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQ 720

Query: 360 LSEGYYDAVAPTWDHASAPALSYFSPNGSPMGKEETVQILTSMSGIDLSCNKLTGEIPTQ 419
                 +A+    +  S P  S             T+  L+ +  + LS N LTGEIP +
Sbjct: 721 ----ALNALNLEENQLSGPLPS-------------TIGKLSKLFELRLSRNALTGEIPVE 763

Query: 420 IGYLTRIR-ALNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIP-QLIVLTTLAVFR 477
           IG L  ++ AL+LS+NN TG IP T S L ++ESLDLS+N L G++P Q+  + +L    
Sbjct: 764 IGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGEVPGQIGDMKSLGYLN 823

Query: 478 VAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLYGQPLSKSCDDNG 521
           ++YNNL GK+     QFS ++ D++ GN  L G PLS  C+  G
Sbjct: 824 LSYNNLEGKLK---KQFSRWQADAFVGNAGLCGSPLSH-CNRAG 863




Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons. Involved in the nuclear division phase of megagametogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query603
224120284 929 predicted protein [Populus trichocarpa] 0.900 0.584 0.396 1e-107
224144186 973 predicted protein [Populus trichocarpa] 0.936 0.580 0.387 1e-107
224102049577 predicted protein [Populus trichocarpa] 0.814 0.850 0.426 1e-106
224120450 935 predicted protein [Populus trichocarpa] 0.865 0.558 0.391 1e-98
224106950 863 predicted protein [Populus trichocarpa] 0.895 0.625 0.384 4e-98
224111186 960 predicted protein [Populus trichocarpa] 0.927 0.582 0.384 7e-98
224112249 806 predicted protein [Populus trichocarpa] 0.819 0.612 0.391 4e-95
224106948658 predicted protein [Populus trichocarpa] 0.885 0.811 0.378 1e-92
224142721 926 predicted protein [Populus trichocarpa] 0.951 0.619 0.389 3e-91
224113693 949 predicted protein [Populus trichocarpa] 0.920 0.584 0.366 5e-90
>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  396 bits (1018), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 263/663 (39%), Positives = 346/663 (52%), Gaps = 120/663 (18%)

Query: 46  KNTILDQGFCQLVHLQELYIRDNDLRDSLLGA-WQTTSLQELNVASNKLTRNFPL--GLC 102
           + TIL Q    L +L +L +  + L +S L    + T+L  L +   +L+ + P+  GLC
Sbjct: 274 EGTILAQALPSLKNLHKLDLSSSTLDNSFLQTIGRITTLTSLKLNGCRLSGSIPIAEGLC 333

Query: 103 ELVLLRELYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQLTESISSSPLMLLTSIEELILS 162
           EL  L+ L I NN L+G LP CL NLTSL+ +D+S N     ISSSPL+ LTSI+EL LS
Sbjct: 334 ELKHLQSLDISNNSLTGVLPKCLANLTSLKQIDLSSNHFGGDISSSPLITLTSIQELRLS 393

Query: 163 NNHFQIPISLEPLSNLSKLKAF---NGEIYLETESHYNSLTPKFQLTSISLSGYRDDGT- 218
           +N+FQIPISL   SN S+LK F   N EI  E E H  +L PKFQL  + LSG    G  
Sbjct: 394 DNNFQIPISLRSFSNHSELKFFFGYNNEICAELEEH--NLIPKFQLQRLHLSGQAYGGAL 451

Query: 219 -FPKFLYHQHDLKNADLSHLNLSGEFPNWL----------------------MPIHCLQK 255
            FPKFL++QH+L+    S++ + G  PNWL                      +PIH    
Sbjct: 452 PFPKFLFYQHNLREIYFSNMRMRGGVPNWLLENNTNLHELFLVNNSLSGPFQLPIHPHVS 511

Query: 256 LATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFND---------------------- 293
           L+ LD+S+N    HIP EIG Y P L  L++S+N FN                       
Sbjct: 512 LSQLDISDNHLDSHIPTEIGAYFPSLTFLSMSKNHFNGIIPSSFGYMSSLLVLDLSENNI 571

Query: 294 -----------------LSYNRLQGS------------------------IPNWIDRLPQ 312
                            LS N+LQGS                        I  WI     
Sbjct: 572 SGKLPSCFSSLPLVHVYLSQNKLQGSLEDAFHKSFELITLDLSHNQLTGNISEWIGEFSH 631

Query: 313 ISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCL--------VNTALSEGY 364
           +SYLLL  N +EG IP QLC+L ++  IDLSHN  SGHI  CL         N  +    
Sbjct: 632 MSYLLLGYNNLEGRIPNQLCKLDKLSFIDLSHNKFSGHILPCLRFRSSIWYSNLRIYPDR 691

Query: 365 YDAVAPTWDHASAPALSYFSPNGSPMGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLT 424
           Y    P     +  ++SY  P          + IL  MSG+DLSCN LTGEIP +IG L 
Sbjct: 692 YLIREPL--EITTKSVSYSYP----------ISILNIMSGMDLSCNNLTGEIPPEIGNLN 739

Query: 425 RIRALNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIPQ-LIVLTTLAVFRVAYNNL 483
            I  LNLS+N L G IP TFSNL ++ESLDLS N L G IP  L+ L  L VF VA+NNL
Sbjct: 740 HIHVLNLSNNFLIGPIPQTFSNLSEVESLDLSNNSLTGAIPPGLVQLHYLEVFSVAHNNL 799

Query: 484 SGKI-PDRVAQFSTFEEDSYEGNPFLYGQPLSKSC---DDNGLTTVTTEAYTENEEGGSL 539
           SG+  P+ + QFSTF E SYEGNP L G PLS+ C   ++   +++     T++ E    
Sbjct: 800 SGRTPPNMIPQFSTFNESSYEGNPLLCGPPLSRHCTTQEEEEASSLPKRTSTDDIEESGF 859

Query: 540 IDMDSFLITFTVSYGIAIIGIIGVLYVNPYWRRRWFYLVEVCMTSCYYFVGDNLILKRFY 599
           +D D F ++F V+Y + ++    +LY+NP WRR WFY ++  + +CYYF  DNL +  + 
Sbjct: 860 MDTDVFYVSFVVTYIMMLLVTAAILYINPNWRRAWFYFIKQSINNCYYFFVDNLHMPSWL 919

Query: 600 RGR 602
             R
Sbjct: 920 EVR 922




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224144186|ref|XP_002336117.1| predicted protein [Populus trichocarpa] gi|222873047|gb|EEF10178.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102049|ref|XP_002334215.1| predicted protein [Populus trichocarpa] gi|222870030|gb|EEF07161.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120450|ref|XP_002331051.1| predicted protein [Populus trichocarpa] gi|222872981|gb|EEF10112.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106950|ref|XP_002333589.1| predicted protein [Populus trichocarpa] gi|222837497|gb|EEE75876.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111186|ref|XP_002332969.1| predicted protein [Populus trichocarpa] gi|222834328|gb|EEE72805.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112249|ref|XP_002332816.1| predicted protein [Populus trichocarpa] gi|222833210|gb|EEE71687.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106948|ref|XP_002333588.1| predicted protein [Populus trichocarpa] gi|222837496|gb|EEE75875.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142721|ref|XP_002324703.1| predicted protein [Populus trichocarpa] gi|222866137|gb|EEF03268.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224113693|ref|XP_002332513.1| predicted protein [Populus trichocarpa] gi|222832619|gb|EEE71096.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query603
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.844 0.521 0.342 5e-50
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.812 0.507 0.325 1.5e-47
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.792 0.536 0.344 1.8e-47
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.797 0.514 0.335 2.2e-47
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.844 0.469 0.311 1.3e-46
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.781 0.518 0.332 6.4e-46
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.601 0.363 0.382 1.1e-44
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.824 0.487 0.302 1.1e-41
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.797 0.567 0.276 9.6e-40
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.674 0.356 0.311 2.6e-39
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 529 (191.3 bits), Expect = 5.0e-50, P = 5.0e-50
 Identities = 193/563 (34%), Positives = 266/563 (47%)

Query:    57 LVH-LQELYIRDNDLRDSL---LGAWQTTSLQELNVASNKLTRNFPXXXXXXXXXXXXYI 112
             +VH LQ L    ND+   L   +G      L  +N + N    N P             +
Sbjct:   427 IVHKLQVLDFSANDITGVLPDNIGH-VLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDL 485

Query:   113 DNNDLSGSLPLCL-TNLTSLQVLDVSYNQLTESISSSPLML-LTSIEELILSNNHF--QI 168
               N+ SG LP  L T   SL  L +S+N  +  I   P+   LTS+  L + NN F  +I
Sbjct:   486 SYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPIL--PIQTRLTSLIVLRMHNNLFTGEI 543

Query:   169 PISLEPLSNLSKLKAFNGEIYLETESHYNSLTP-KFQLTSISLSGYRDDGTFPKFLYHQH 227
              + L  L NLS   A N  +   T    +S+ P    L  + LS    +GT P  L   H
Sbjct:   544 GVGLRTLVNLSIFDASNNRL---TGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLAIH 600

Query:   228 DLKNADLSHLNLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEI--GTYLPGLMHLN 285
              L   DLS   LSG+ P+ +  ++ +  +    + NN F G +PV +    Y+  L +  
Sbjct:   601 HLNFLDLSGNLLSGDLPSSV--VNSMYGIKIF-LHNNSFTGPLPVTLLENAYILDLRNNK 657

Query:   286 LSRNA---FND-------LSYNRLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLK 335
             LS +     N        L  N L GSIP  +  L  I  L L++N + G IP  L  L 
Sbjct:   658 LSGSIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLS 717

Query:   336 EVRLIDLSHNNLSGHIPF--CLV-----NTALSEG---YYDAVAPTWDHASAPALSYFSP 385
                   +  +  S  I F   L      +T L +    YYD+     +   A    Y S 
Sbjct:   718 TELGEGIGLSGFSQEISFGDSLQMEFYRSTFLVDEFMLYYDSTYMIVEIEFAAKQRYDSF 777

Query:   386 NGSPMGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPITFS 445
             +G           L  M G+DLS N+L+G IP ++G L+++RALNLS N L+ +IP  FS
Sbjct:   778 SGGT---------LDYMYGLDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFS 828

Query:   446 NLKQIESLDLSYNLLHGKIP-QLIVLTTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEG 504
              LK IESLDLSYN+L G IP QL  LT+LAVF V++NNLSG IP    QF+TF ++SY G
Sbjct:   829 KLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQG-GQFNTFNDNSYLG 887

Query:   505 NPFLYGQPLSKSCDDNGLTTVTTEAYTENEEGG---SLIDMDSFLITFTVSYGIAIIGII 561
             NP L G P  +SC+    T        E EE     + IDM     T   +Y IA+IGI+
Sbjct:   888 NPLLCGTPTDRSCEGKKNTKEADNGGEEEEEDDDDEAAIDMVVLYWTTGSTYAIALIGIL 947

Query:   562 GVLYVNPYWRRRWFYLVEVCMTS 584
              ++  +  WRR W  +V+  + S
Sbjct:   948 VLMCFDCPWRRTWLCIVDAFIAS 970


GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query603
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-37
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-29
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-19
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  148 bits (374), Expect = 3e-37
 Identities = 137/459 (29%), Positives = 213/459 (46%), Gaps = 66/459 (14%)

Query: 81  TSLQELNVASNKLTRNFPLGLCELVLLRELYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQ 140
           TSL+ L +ASN+L    P  L ++  L+ +Y+  N+LSG +P  +  LTSL  LD+ YN 
Sbjct: 188 TSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNN 247

Query: 141 LTESISSSPLMLLTSIEELILSNNHF--QIPISLEPLSNLSKL----KAFNGEI------ 188
           LT  I SS L  L +++ L L  N     IP S+  L  L  L     + +GEI      
Sbjct: 248 LTGPIPSS-LGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQ 306

Query: 189 --YLETESHY-NSLTPKF--------QLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHL 237
              LE    + N+ T K         +L  + L   +  G  PK L   ++L   DLS  
Sbjct: 307 LQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTN 366

Query: 238 NLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFNDLSYN 297
           NL+GE P  L     L KL      +N  +G IP  +G     L  + L  N+F+     
Sbjct: 367 NLTGEIPEGLCSSGNLFKLILF---SNSLEGEIPKSLGA-CRSLRRVRLQDNSFS----- 417

Query: 298 RLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFC--- 354
              G +P+   +LP + +L ++NN ++G I ++   +  ++++ L+ N   G +P     
Sbjct: 418 ---GELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGS 474

Query: 355 --LVNTALSEGYYDAVAPTWDHASAPALSYFSPNGSPMGKEETVQILTSMSGIDLSCNKL 412
             L N  LS   +    P                         +  L+ +  + LS NKL
Sbjct: 475 KRLENLDLSRNQFSGAVP-----------------------RKLGSLSELMQLKLSENKL 511

Query: 413 TGEIPTQIGYLTRIRALNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIPQ-LIVLT 471
           +GEIP ++    ++ +L+LSHN L+G IP +FS +  +  LDLS N L G+IP+ L  + 
Sbjct: 512 SGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVE 571

Query: 472 TLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLYG 510
           +L    +++N+L G +P   A F      +  GN  L G
Sbjct: 572 SLVQVNISHNHLHGSLPSTGA-FLAINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 603
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.95
KOG4237498 consensus Extracellular matrix protein slit, conta 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
PLN03150623 hypothetical protein; Provisional 99.56
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.25
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.22
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.2
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.16
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.11
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.11
PLN03150623 hypothetical protein; Provisional 99.09
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.06
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.0
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.74
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.73
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.7
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.7
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.45
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.35
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.21
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.2
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.15
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.09
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.06
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.97
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.92
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.84
KOG4341483 consensus F-box protein containing LRR [General fu 97.78
PRK15386426 type III secretion protein GogB; Provisional 97.73
PRK15386426 type III secretion protein GogB; Provisional 97.71
KOG4341483 consensus F-box protein containing LRR [General fu 97.66
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.51
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.49
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.49
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.04
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.99
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.81
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.8
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.0
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.53
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.21
KOG4308478 consensus LRR-containing protein [Function unknown 94.42
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.39
KOG4308478 consensus LRR-containing protein [Function unknown 93.42
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.35
smart0037026 LRR Leucine-rich repeats, outliers. 93.35
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.17
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.76
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.25
smart0037026 LRR Leucine-rich repeats, outliers. 90.25
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.72
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.53
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 86.34
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 81.56
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 80.22
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.3e-51  Score=468.29  Aligned_cols=498  Identities=27%  Similarity=0.365  Sum_probs=356.2

Q ss_pred             CCCCCCCceecccccccccccchHHHHHHhcCCCcEEEccCCcCCCCCCCccccCCCCCCCEEEccCCcCCCCccCccc-
Q 036984            1 FHEFKNLEHLVMDQMLVEVNTSFLQIVSELMASLRLLSLSYSRLNKNTILDQGFCQLVHLQELYIRDNDLRDSLLGAWQ-   79 (603)
Q Consensus         1 f~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~i~~~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~-   79 (603)
                      |..+++|++|++++|.+..  .+.......+++|++|+|++|.+++...    ...+++|++|++++|.+....+..+. 
T Consensus        89 ~~~l~~L~~L~Ls~n~~~~--~ip~~~~~~l~~L~~L~Ls~n~l~~~~p----~~~l~~L~~L~Ls~n~~~~~~p~~~~~  162 (968)
T PLN00113         89 IFRLPYIQTINLSNNQLSG--PIPDDIFTTSSSLRYLNLSNNNFTGSIP----RGSIPNLETLDLSNNMLSGEIPNDIGS  162 (968)
T ss_pred             HhCCCCCCEEECCCCccCC--cCChHHhccCCCCCEEECcCCccccccC----ccccCCCCEEECcCCcccccCChHHhc
Confidence            4567888888888876642  1112222246788888888888765321    24578888888888888766666666 


Q ss_pred             CCCCCEEEccCCCCCcCCchhhcCCCCCcEEeccCCCCccCcCccCCCCCCCCEEEcccCcCCccCCcccccCCCCCcEE
Q 036984           80 TTSLQELNVASNKLTRNFPLGLCELVLLRELYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQLTESISSSPLMLLTSIEEL  159 (603)
Q Consensus        80 ~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~~l~~L~~L  159 (603)
                      +++|++|++++|.+.+..|..+.++++|++|++++|.+++..|..++++++|++|++++|.+.+.+|. .+..+++|++|
T Consensus       163 l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L  241 (968)
T PLN00113        163 FSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPY-EIGGLTSLNHL  241 (968)
T ss_pred             CCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCCh-hHhcCCCCCEE
Confidence            88888888888888877888888888888888888888877888888888888888888888776776 67888888888


Q ss_pred             EccCceeeeecCccccCCCCCCceeeccceeeeccCCCCCCCcccccEEeccCCCCCCCcChhhccCCCCCEEEcCCCcc
Q 036984          160 ILSNNHFQIPISLEPLSNLSKLKAFNGEIYLETESHYNSLTPKFQLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHLNL  239 (603)
Q Consensus       160 ~l~~n~~~~~~~~~~l~~L~~L~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~L~~n~i  239 (603)
                      ++++|.+.+..+ ..+.++++|+.+++..+.........+..+.+|+.|++++|.+.+..|..+..+++|+.|++++|.+
T Consensus       242 ~L~~n~l~~~~p-~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~  320 (968)
T PLN00113        242 DLVYNNLTGPIP-SSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNF  320 (968)
T ss_pred             ECcCceeccccC-hhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCcc
Confidence            888888764333 3566777777777764433333333445566888888888888888888888888888888888888


Q ss_pred             cCCCCCCCccccccCCccEEEccCccccccCChhhhhcCCCCcEEecCCCCcc----------------cccCCcCcccC
Q 036984          240 SGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFN----------------DLSYNRLQGSI  303 (603)
Q Consensus       240 ~~~~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~~l~~L~~L~L~~n~l~----------------~l~~~~~~~~~  303 (603)
                      .+..|.+   +..+++|+.|++++|.+.+.+|..+.. +++|+.|++++|.+.                +++.|.+.+.+
T Consensus       321 ~~~~~~~---~~~l~~L~~L~L~~n~l~~~~p~~l~~-~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~  396 (968)
T PLN00113        321 TGKIPVA---LTSLPRLQVLQLWSNKFSGEIPKNLGK-HNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEI  396 (968)
T ss_pred             CCcCChh---HhcCCCCCEEECcCCCCcCcCChHHhC-CCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccC
Confidence            8777776   567788888888888887777766554 778888888887652                45566677778


Q ss_pred             CccccCCCCCCEEeccCCcCcccCCccccCCCCCCEEecCCCcCccCCChhhhccccccccc---CCC-CCCCcCCCCCC
Q 036984          304 PNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTALSEGYY---DAV-APTWDHASAPA  379 (603)
Q Consensus       304 ~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~---~~~-~~~~~~~~~~~  379 (603)
                      |..++.+++|+.|++++|.+++..|..+..+++|+.|++++|.+++.+|..+..++......   ... ...........
T Consensus       397 p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~  476 (968)
T PLN00113        397 PKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKR  476 (968)
T ss_pred             CHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccccccc
Confidence            88888888888888888888888888888888888888888888877776554433221110   000 00111111223


Q ss_pred             eeEEecCCCC--CCcchhhhhcccceEEECcCCCCcccCchhccCcCcCCEEecccccccccCCcCCcCCCCCCEEeCCC
Q 036984          380 LSYFSPNGSP--MGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPITFSNLKQIESLDLSY  457 (603)
Q Consensus       380 ~~~~~~~~~~--~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~  457 (603)
                      +..+...++.  ......+..+++|+.|++++|.+.+.+|..+..+++|++|+|++|.+++.+|..|.++++|+.||+++
T Consensus       477 L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~  556 (968)
T PLN00113        477 LENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQ  556 (968)
T ss_pred             ceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCC
Confidence            3333333322  22233455677777888888888777777777778888888888888877777777778888888888


Q ss_pred             CcCcccCC-CccCCCCCCceecccCcccccCCCcccccCCCCcccccCCcCCCCC
Q 036984          458 NLLHGKIP-QLIVLTTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPFLYGQ  511 (603)
Q Consensus       458 N~l~~~~~-~~~~l~~L~~L~l~~N~l~~~~p~~~~~l~~l~~~~l~gn~~~c~~  511 (603)
                      |++++.+| .+..+++|+.|++++|++.+.+|.. +.+.++....+.|||.+|+.
T Consensus       557 N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~-~~~~~~~~~~~~~n~~lc~~  610 (968)
T PLN00113        557 NQLSGEIPKNLGNVESLVQVNISHNHLHGSLPST-GAFLAINASAVAGNIDLCGG  610 (968)
T ss_pred             CcccccCChhHhcCcccCEEeccCCcceeeCCCc-chhcccChhhhcCCccccCC
Confidence            88877777 6777777888888888888777764 56666667777788877753



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query603
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-36
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-13
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-36
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-13
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 5e-04
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 149 bits (376), Expect = 4e-36, Method: Compositional matrix adjust. Identities = 155/503 (30%), Positives = 227/503 (45%), Gaps = 62/503 (12%) Query: 57 LVHLQELYIRDN----DLRDSLLGAWQTTSLQELNVASNKLTRNFPXXXXXXXXXXXXYI 112 L LQ L + +N ++ D L GA T L L+++ N P + Sbjct: 265 LKSLQYLSLAENKFTGEIPDFLSGACDT--LTGLDLSGNHFYGAVPPFFGSCSLLESLAL 322 Query: 113 DNNDLSGSLPL-CLTNLTSLQVLDVSYNQLTESISSSPLMLLTSIEELILSNNHFQIPIS 171 +N+ SG LP+ L + L+VLD+S+N+ + + S L S+ L LS+N+F PI Sbjct: 323 SSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI- 381 Query: 172 LEPLSNLSK-LKAFNGEIYLETESHYNSLTPKF----QLTSISLSGYRDDGTFPKFLYHQ 226 L NL + K E+YL+ + P +L S+ LS GT P L Sbjct: 382 ---LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 438 Query: 227 HDLKNADLSHLNLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNL 286 L++ L L GE P LM + L+ TL + N G IP + L +LN Sbjct: 439 SKLRDLKLWLNMLEGEIPQELMYVKTLE---TLILDFNDLTGEIP----SGLSNCTNLN- 490 Query: 287 SRNAFNDLSYNRLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNN 346 + LS NRL G IP WI RL ++ L L+NN G IPA+L + + +DL+ N Sbjct: 491 ----WISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNL 546 Query: 347 LSGHIPFCL--------VNTALSEGYY----DAVAPTWDHASAPALSYFSPNGSPMGKEE 394 +G IP + N + Y D + H + L + + + Sbjct: 547 FNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKEC-HGAGNLLEFQGIRSEQLNRLS 605 Query: 395 TVQILT------------------SMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNL 436 T SM +D+S N L+G IP +IG + + LNL HN++ Sbjct: 606 TRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDI 665 Query: 437 TGTIPITFSNLKQIESLDLSYNLLHGKIPQLI-VLTTLAVFRVAYNNLSGKIPDRVAQFS 495 +G+IP +L+ + LDLS N L G+IPQ + LT L ++ NNLSG IP+ + QF Sbjct: 666 SGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE-MGQFE 724 Query: 496 TFEEDSYEGNPFLYGQPLSKSCD 518 TF + NP L G PL + CD Sbjct: 725 TFPPAKFLNNPGLCGYPLPR-CD 746
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query603
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-97
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-82
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-75
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-57
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-29
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-34
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-53
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-50
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-47
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-46
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-32
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-51
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-23
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-48
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-46
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-45
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-39
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-48
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-37
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-47
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-46
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-43
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-34
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-38
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-30
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-13
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-11
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 5e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  314 bits (806), Expect = 1e-97
 Identities = 141/513 (27%), Positives = 213/513 (41%), Gaps = 98/513 (19%)

Query: 31  MASLRLLSLSYSRLNKNTILDQGFCQLVHLQELYIRDNDLRDSL---LGAWQTTSLQELN 87
            + L  L+LS +  +   +      ++  L+ L +  N+    L   L    + SL  L+
Sbjct: 317 CSLLESLALSSNNFS-GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL-SASLLTLD 374

Query: 88  VASNKLTRNFPLGLCELVL--LRELYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQLTESI 145
           ++SN  +      LC+     L+ELY+ NN  +G +P  L+N + L  L +S+N L+ +I
Sbjct: 375 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI 434

Query: 146 SSSPLMLLTSIEELILSNNHFQ--IPISLEPLSNLSKLKAFNGEIYLETESHYNSLTPKF 203
            SS L  L+ + +L L  N  +  IP  L  +  L  L              +N LT   
Sbjct: 435 PSS-LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL-----------DFNDLT--- 479

Query: 204 QLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHLNLSGEFPNWLMPIHCLQKLATLDVSN 263
                        G  P  L +  +L    LS+  L+GE P W   I  L+ LA L +SN
Sbjct: 480 -------------GEIPSGLSNCTNLNWISLSNNRLTGEIPKW---IGRLENLAILKLSN 523

Query: 264 NFFQGHIPVEIGTYLPGLMHLNLSRNAFN------------DLSYNRLQGSIPNWIDRLP 311
           N F G+IP E+G     L+ L+L+ N FN             ++ N + G    +I    
Sbjct: 524 NSFSGNIPAELGD-CRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDG 582

Query: 312 QISYLLLANNYIE--GEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTALSEGYYDAVA 369
                  A N +E  G    QL +L      +++     GH                   
Sbjct: 583 MKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTS----------------- 625

Query: 370 PTWDHASAPALSYFSPNGSPMGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRAL 429
                                    T     SM  +D+S N L+G IP +IG +  +  L
Sbjct: 626 ------------------------PTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFIL 661

Query: 430 NLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIP-QLIVLTTLAVFRVAYNNLSGKIP 488
           NL HN+++G+IP    +L+ +  LDLS N L G+IP  +  LT L    ++ NNLSG IP
Sbjct: 662 NLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIP 721

Query: 489 DRVAQFSTFEEDSYEGNPFLYGQPLSKSCDDNG 521
           +   QF TF    +  NP L G PL +    N 
Sbjct: 722 EM-GQFETFPPAKFLNNPGLCGYPLPRCDPSNA 753


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query603
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.6
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.58
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.4
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.38
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.33
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.15
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.08
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.66
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.47
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.98
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.5
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.42
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.21
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.85
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.4e-55  Score=487.57  Aligned_cols=472  Identities=31%  Similarity=0.435  Sum_probs=314.1

Q ss_pred             cCCCcEEEccCCcCCCCCCCccccCCCCCCCEEEccCCcCCCCccCccc-CCCCCEEEccCCCCCcCCchhhcCCCCCcE
Q 036984           31 MASLRLLSLSYSRLNKNTILDQGFCQLVHLQELYIRDNDLRDSLLGAWQ-TTSLQELNVASNKLTRNFPLGLCELVLLRE  109 (603)
Q Consensus        31 ~~~L~~L~Ls~n~i~~~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~-~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~  109 (603)
                      +++|++|++++|.+.+.  .+. +.++++|++|++++|.+++..+..+. +++|++|++++|.+.+..|..  .+++|++
T Consensus       199 l~~L~~L~Ls~n~l~~~--~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~  273 (768)
T 3rgz_A          199 CVNLEFLDVSSNNFSTG--IPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQY  273 (768)
T ss_dssp             CTTCCEEECCSSCCCSC--CCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCE
T ss_pred             CCcCCEEECcCCcCCCC--Ccc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCE
Confidence            34444444444444331  111 44555555555555555444444444 455555555555544433332  4444555


Q ss_pred             EeccCCCCccCcCccCCCC-CCCCEEEcccCcCCccCCcccccCCCCCcEEEccCceeeeecCccccCCCCCCceeeccc
Q 036984          110 LYIDNNDLSGSLPLCLTNL-TSLQVLDVSYNQLTESISSSPLMLLTSIEELILSNNHFQIPISLEPLSNLSKLKAFNGEI  188 (603)
Q Consensus       110 L~L~~n~i~~~~~~~~~~l-~~L~~L~L~~n~i~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~l~~L~~L~~l~~~~  188 (603)
                      |++++|.+++.+|..+.+. ++|++|++++|.+++.+|. .+..+++|++|++++|.+.+..+...+.++++|+.+++..
T Consensus       274 L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~-~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~  352 (768)
T 3rgz_A          274 LSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPP-FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF  352 (768)
T ss_dssp             EECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCG-GGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCS
T ss_pred             EECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccch-HHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcC
Confidence            5555555544555555543 6666666666666655555 5666777777777777666555544455566666655552


Q ss_pred             eeeeccC-------------------------CCCCCC--cccccEEeccCCCCCCCcChhhccCCCCCEEEcCCCcccC
Q 036984          189 YLETESH-------------------------YNSLTP--KFQLTSISLSGYRDDGTFPKFLYHQHDLKNADLSHLNLSG  241 (603)
Q Consensus       189 ~~~~~~~-------------------------~~~~~~--~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~L~~n~i~~  241 (603)
                      +......                         ...+..  ..+|+.|++++|.+.+..|..+..+++|+.|++++|.+.+
T Consensus       353 n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~  432 (768)
T 3rgz_A          353 NEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG  432 (768)
T ss_dssp             SEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEES
T ss_pred             CccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccC
Confidence            2221111                         111111  3456777777777666677777777788888888887777


Q ss_pred             CCCCCCccccccCCccEEEccCccccccCChhhhhcCCCCcEEecCCCCc----------------ccccCCcCcccCCc
Q 036984          242 EFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAF----------------NDLSYNRLQGSIPN  305 (603)
Q Consensus       242 ~~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~~l~~L~~L~L~~n~l----------------~~l~~~~~~~~~~~  305 (603)
                      ..|..   +..+++|+.|++++|.+.+.+|..+.. +++|+.|++++|.+                +++++|.+.+.+|.
T Consensus       433 ~~p~~---l~~l~~L~~L~L~~n~l~~~~p~~~~~-l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~  508 (768)
T 3rgz_A          433 TIPSS---LGSLSKLRDLKLWLNMLEGEIPQELMY-VKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPK  508 (768)
T ss_dssp             CCCGG---GGGCTTCCEEECCSSCCCSCCCGGGGG-CTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCG
T ss_pred             cccHH---HhcCCCCCEEECCCCcccCcCCHHHcC-CCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCCh
Confidence            77765   566777888888888877667665554 77888888887765                35566777777777


Q ss_pred             cccCCCCCCEEeccCCcCcccCCccccCCCCCCEEecCCCcCccCCChhhhcccccccccCCCCCCCcCCCCCCeeEEec
Q 036984          306 WIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTALSEGYYDAVAPTWDHASAPALSYFSP  385 (603)
Q Consensus       306 ~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  385 (603)
                      +++.+++|++|++++|++++.+|..+..+++|+.|++++|++++.+|..+...........        ........+..
T Consensus       509 ~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~--------~~~~~~~~~~~  580 (768)
T 3rgz_A          509 WIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANF--------IAGKRYVYIKN  580 (768)
T ss_dssp             GGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCST--------TCSCEEEEEEC
T ss_pred             HHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhc--------ccccccccccc
Confidence            7777777777777777777777777777777777777777777777776654331111000        00000000000


Q ss_pred             C----------------C---------------------CCCCcchhhhhcccceEEECcCCCCcccCchhccCcCcCCE
Q 036984          386 N----------------G---------------------SPMGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRA  428 (603)
Q Consensus       386 ~----------------~---------------------~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~  428 (603)
                      .                +                     ........+..+++|+.|++++|++++.+|..++.+++|+.
T Consensus       581 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~  660 (768)
T 3rgz_A          581 DGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFI  660 (768)
T ss_dssp             CSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCE
T ss_pred             ccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCE
Confidence            0                0                     00001123455789999999999999999999999999999


Q ss_pred             EecccccccccCCcCCcCCCCCCEEeCCCCcCcccCC-CccCCCCCCceecccCcccccCCCcccccCCCCcccccCCcC
Q 036984          429 LNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKIP-QLIVLTTLAVFRVAYNNLSGKIPDRVAQFSTFEEDSYEGNPF  507 (603)
Q Consensus       429 L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~-~~~~l~~L~~L~l~~N~l~~~~p~~~~~l~~l~~~~l~gn~~  507 (603)
                      |+|++|++++.+|..|+++++|+.||+++|++++.+| .+..+++|++|++++|+++|.+|.. +++.++....+.|||.
T Consensus       661 L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~-~~~~~~~~~~~~gN~~  739 (768)
T 3rgz_A          661 LNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFETFPPAKFLNNPG  739 (768)
T ss_dssp             EECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS-SSGGGSCGGGGCSCTE
T ss_pred             EeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc-hhhccCCHHHhcCCch
Confidence            9999999999999999999999999999999999999 8999999999999999999999985 7888999999999999


Q ss_pred             CCCCCCCCCCCCCCC
Q 036984          508 LYGQPLSKSCDDNGL  522 (603)
Q Consensus       508 ~c~~~~~~~C~~~~~  522 (603)
                      +|+.|+. .|.....
T Consensus       740 Lcg~~l~-~C~~~~~  753 (768)
T 3rgz_A          740 LCGYPLP-RCDPSNA  753 (768)
T ss_dssp             EESTTSC-CCCSCC-
T ss_pred             hcCCCCc-CCCCCcc
Confidence            9999987 8975543



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 603
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-24
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 9e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score =  102 bits (253), Expect = 6e-24
 Identities = 55/377 (14%), Positives = 124/377 (32%), Gaps = 25/377 (6%)

Query: 110 LYIDNNDLSGSLPLCLTNLTSLQVLDVSYNQLTESISSSPLMLLTSIEELILSNNHFQIP 169
             +   +++ ++    T+L  +  L      +    S   +  L ++ ++  SNN     
Sbjct: 27  TVLGKTNVTDTVSQ--TDLDQVTTLQADRLGIK---SIDGVEYLNNLTQINFSNNQLT-- 79

Query: 170 ISLEPLSNLSKLKAFNGEIYLETESHYNSLTPKFQLTSISLSGYRDDGTFPKFLYHQHDL 229
             + PL NL+KL           +    +        ++  +   D              
Sbjct: 80  -DITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLE 138

Query: 230 K-NADLSHLNLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSR 288
             +  +S ++      +        Q      ++N      + +         +   L+ 
Sbjct: 139 LSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTN 198

Query: 289 NAFNDLSYNRLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLS 348
                 + N++    P  I     +  L L  N ++      L  L  +  +DL++N +S
Sbjct: 199 LESLIATNNQISDITPLGIL--TNLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQIS 254

Query: 349 GHIPFC----LVNTALSEGYYDAVAPTWDHASAPALSYFSPNGSPMGKEETVQILTSMSG 404
              P      L    L       ++P        AL+    N + +     +  L +++ 
Sbjct: 255 NLAPLSGLTKLTELKLGANQISNISPLAGL---TALTNLELNENQLEDISPISNLKNLTY 311

Query: 405 IDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPITFSNLKQIESLDLSYNLLHGKI 464
           + L  N ++   P  +  LT+++ L  ++N ++     + +NL  I  L   +N +    
Sbjct: 312 LTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLT 367

Query: 465 PQLIVLTTLAVFRVAYN 481
           P L  LT +    +   
Sbjct: 368 P-LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query603
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.39
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.38
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.33
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.89
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.76
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.32
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.1
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.96  E-value=2.2e-27  Score=240.33  Aligned_cols=342  Identities=22%  Similarity=0.284  Sum_probs=207.0

Q ss_pred             CCCCCCCEEEccCCcCCCCccCccc-CCCCCEEEccCCCCCcCCchhhcCCCCCcEEeccCCCCccCcCccCCCCCCCCE
Q 036984           55 CQLVHLQELYIRDNDLRDSLLGAWQ-TTSLQELNVASNKLTRNFPLGLCELVLLRELYIDNNDLSGSLPLCLTNLTSLQV  133 (603)
Q Consensus        55 ~~l~~L~~L~Ls~n~i~~~~~~~~~-~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~  133 (603)
                      ..+.+|++|++++++|+++.  .+. +++|++|++++|++++. + .++++++|++|++++|++.+..  .++++++|+.
T Consensus        41 ~~l~~l~~L~l~~~~I~~l~--gl~~L~nL~~L~Ls~N~l~~l-~-~l~~L~~L~~L~L~~n~i~~i~--~l~~l~~L~~  114 (384)
T d2omza2          41 TDLDQVTTLQADRLGIKSID--GVEYLNNLTQINFSNNQLTDI-T-PLKNLTKLVDILMNNNQIADIT--PLANLTNLTG  114 (384)
T ss_dssp             HHHTTCCEEECCSSCCCCCT--TGGGCTTCCEEECCSSCCCCC-G-GGTTCTTCCEEECCSSCCCCCG--GGTTCTTCCE
T ss_pred             HHhCCCCEEECCCCCCCCcc--ccccCCCCCEEeCcCCcCCCC-c-cccCCccccccccccccccccc--cccccccccc
Confidence            34566777777777777652  233 77788888888777764 3 2777778888888888777543  3677778888


Q ss_pred             EEcccCcCCccCCcccccCCCCCcEEEccCceeeeecCccccCCCCCCceeeccceeeeccCCCCCCCcccccEEeccCC
Q 036984          134 LDVSYNQLTESISSSPLMLLTSIEELILSNNHFQIPISLEPLSNLSKLKAFNGEIYLETESHYNSLTPKFQLTSISLSGY  213 (603)
Q Consensus       134 L~L~~n~i~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~l~~L~~L~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~  213 (603)
                      |+++++.+++ ++.  ......+.......|.+........   ..........   ........+.............+
T Consensus       115 L~~~~~~~~~-~~~--~~~~~~~~~~~~~~~~l~~~~~~~~---~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~  185 (384)
T d2omza2         115 LTLFNNQITD-IDP--LKNLTNLNRLELSSNTISDISALSG---LTSLQQLSFG---NQVTDLKPLANLTTLERLDISSN  185 (384)
T ss_dssp             EECCSSCCCC-CGG--GTTCTTCSEEEEEEEEECCCGGGTT---CTTCSEEEEE---ESCCCCGGGTTCTTCCEEECCSS
T ss_pred             cccccccccc-ccc--ccccccccccccccccccccccccc---cccccccccc---cccchhhhhcccccccccccccc
Confidence            8887777763 222  3344566666666655432211110   0000000000   00000011111112222333333


Q ss_pred             CCCCCcChhhccCCCCCEEEcCCCcccCCCCCCCccccccCCccEEEccCccccccCChhhhhcCCCCcEEecCCCCccc
Q 036984          214 RDDGTFPKFLYHQHDLKNADLSHLNLSGEFPNWLMPIHCLQKLATLDVSNNFFQGHIPVEIGTYLPGLMHLNLSRNAFND  293 (603)
Q Consensus       214 ~~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~~l~~L~~L~L~~n~l~~  293 (603)
                      ..  ........+++++.+++++|.+.+..|     ...+++|+.|++++|.++ .++ . +..+++|+.|++++|.+.+
T Consensus       186 ~~--~~~~~~~~l~~~~~l~l~~n~i~~~~~-----~~~~~~L~~L~l~~n~l~-~~~-~-l~~l~~L~~L~l~~n~l~~  255 (384)
T d2omza2         186 KV--SDISVLAKLTNLESLIATNNQISDITP-----LGILTNLDELSLNGNQLK-DIG-T-LASLTNLTDLDLANNQISN  255 (384)
T ss_dssp             CC--CCCGGGGGCTTCSEEECCSSCCCCCGG-----GGGCTTCCEEECCSSCCC-CCG-G-GGGCTTCSEEECCSSCCCC
T ss_pred             cc--ccccccccccccceeeccCCccCCCCc-----ccccCCCCEEECCCCCCC-Ccc-h-hhcccccchhccccCccCC
Confidence            22  224455667777777777777665433     345667777777777776 443 2 2336777777777776654


Q ss_pred             ccCCcCcccCCccccCCCCCCEEeccCCcCcccCCccccCCCCCCEEecCCCcCccCCChhhhcccccccccCCCCCCCc
Q 036984          294 LSYNRLQGSIPNWIDRLPQISYLLLANNYIEGEIPAQLCQLKEVRLIDLSHNNLSGHIPFCLVNTALSEGYYDAVAPTWD  373 (603)
Q Consensus       294 l~~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~~~~~~~  373 (603)
                      +.          .++.+++|++|++++|.+++..  .+..++.++.+++++|.+.+.                       
T Consensus       256 ~~----------~~~~~~~L~~L~l~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~~-----------------------  300 (384)
T d2omza2         256 LA----------PLSGLTKLTELKLGANQISNIS--PLAGLTALTNLELNENQLEDI-----------------------  300 (384)
T ss_dssp             CG----------GGTTCTTCSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCCSCC-----------------------
T ss_pred             CC----------cccccccCCEeeccCcccCCCC--ccccccccccccccccccccc-----------------------
Confidence            32          2455677777777777776443  356677777777777776521                       


Q ss_pred             CCCCCCeeEEecCCCCCCcchhhhhcccceEEECcCCCCcccCchhccCcCcCCEEecccccccccCCcCCcCCCCCCEE
Q 036984          374 HASAPALSYFSPNGSPMGKEETVQILTSMSGIDLSCNKLTGEIPTQIGYLTRIRALNLSHNNLTGTIPITFSNLKQIESL  453 (603)
Q Consensus       374 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L  453 (603)
                                          ..+..+++++.|++++|++++..  .+..+++|++|++++|++++ ++ .+.++++|++|
T Consensus       301 --------------------~~~~~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~n~l~~-l~-~l~~l~~L~~L  356 (384)
T d2omza2         301 --------------------SPISNLKNLTYLTLYFNNISDIS--PVSSLTKLQRLFFANNKVSD-VS-SLANLTNINWL  356 (384)
T ss_dssp             --------------------GGGGGCTTCSEEECCSSCCSCCG--GGGGCTTCCEEECCSSCCCC-CG-GGGGCTTCCEE
T ss_pred             --------------------cccchhcccCeEECCCCCCCCCc--ccccCCCCCEEECCCCCCCC-Ch-hHcCCCCCCEE
Confidence                                12344677788888888887543  36777888888888888874 33 57778888888


Q ss_pred             eCCCCcCcccCCCccCCCCCCceecccC
Q 036984          454 DLSYNLLHGKIPQLIVLTTLAVFRVAYN  481 (603)
Q Consensus       454 ~Ls~N~l~~~~~~~~~l~~L~~L~l~~N  481 (603)
                      ++++|++++.+ .+..+++|+.|++++|
T Consensus       357 ~l~~N~l~~l~-~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         357 SAGHNQISDLT-PLANLTRITQLGLNDQ  383 (384)
T ss_dssp             ECCSSCCCBCG-GGTTCTTCSEEECCCE
T ss_pred             ECCCCcCCCCh-hhccCCCCCEeeCCCC
Confidence            88888887544 3677788888888877



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure