Citrus Sinensis ID: 037024

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MGRAPCCDKANVKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRPDIKHGGFTKEEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKKNVLAGKLSDNTQVSVSTIPEEFGNSSYYLSADSAAGMIFDPSANSNYGNKMTSTTQEAAAASSLSISSSSSTLENNYDLRSANGNVEDEGILLDDFDFEYSYELLNGFDFEKASNEVAQCLGG
ccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHcccHHHHHcccccccccccccccHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccc
cccccccHHcccccccccHHHHHHHHHHHHHccccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHcccccHHHHccccccccccccHHHccccccccHcccccccHccccccccHHHcccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcHHHHHccc
mgrapccdkanvkrgpwsaeEDSILKNYLEqfgnggnwialpkkaglnrcgkscRLRWLNylrpdikhggftkeeDTIICNLyctmgsrwsviasqlpgrtdndvknyWNTKLKKnvlagklsdntqvsvstipeefgnssyylsadsaagmifdpsansnygnkmtSTTQEAAAASSlsissssstlennydlrsangnvedegillddfdfEYSYELLngfdfekaSNEVAQCLGG
mgrapccdkanvkrgpwsaeEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLrpdikhggftkEEDTIICNLYCTMGSRWSVIASqlpgrtdndvkNYWNTKLKKnvlagklsdntqVSVSTIPEEFGNSSYYLSADSAAGMIFDPSANSNYGNKMTSTTQEAAAASSLSISSSSSTLENNYDLRSANGNVEDEGILLDDFDFEYSYELLNGFDFEKASNEVAQCLGG
MGRAPCCDKANVKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRPDIKHGGFTKEEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKKNVLAGKLSDNTQVSVSTIPEEFGNSSYYLSADSAAGMIFDPSANSNYGNKMtsttqeaaaasslsisssssTLENNYDLRSANGNVEDEGILLDDFDFEYSYELLNGFDFEKASNEVAQCLGG
*********************DSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRPDIKHGGFTKEEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKKNVLAGKLSDNTQVSVSTI***FGNSSYYLS********************************************************EDEGILLDDFDFEYSYELLNGFDFEK***********
*GRAPCCDKANVKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRPDIKHGGFTKEEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKK*********************************************************************************************DDFDFEYSYELLNGFDFEKASNE*******
MGRAPCCDKANVKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRPDIKHGGFTKEEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKKNVLAGKLSDNTQVSVSTIPEEFGNSSYYLSADSAAGMIFDPSANSNYGNKMT*********************ENNYDLRSANGNVEDEGILLDDFDFEYSYELLNGFDFEKASNEVAQCLGG
***APCCDKANVKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRPDIKHGGFTKEEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKKNVLAGKLSDNTQVSVS**********************************************************************************EYSYELLNGF*F*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRAPCCDKANVKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRPDIKHGGFTKEEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKKNVLAGKLSDNTQVSVSTIPEEFGNSSYYLSADSAAGMIFDPSANSNYGNKMTSTTQEAAAASSLSISSSSSTLENNYDLRSANGNVEDEGILLDDFDFEYSYELLNGFDFEKASNEVAQCLGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query238 2.2.26 [Sep-21-2011]
Q9M2Y9310 Transcription factor RAX3 no no 0.495 0.380 0.771 1e-55
Q9SJL7298 Transcription factor RAX2 no no 0.5 0.399 0.764 2e-53
Q9FG68329 Transcription factor RAX1 no no 0.495 0.358 0.737 1e-52
Q7XBH4257 Myb-related protein Myb4 no no 0.495 0.459 0.613 4e-42
Q9S9K9257 Transcription factor MYB3 no no 0.529 0.490 0.543 9e-41
P27898 399 Myb-related protein P OS= N/A no 0.487 0.290 0.606 1e-40
P80073 421 Myb-related protein Pp2 O N/A no 0.542 0.306 0.553 4e-40
O22264 371 Transcription factor MYB1 no no 0.487 0.312 0.598 6e-40
P81392316 Myb-related protein 306 O N/A no 0.487 0.367 0.606 9e-40
P81395274 Myb-related protein 330 O N/A no 0.550 0.478 0.545 1e-39
>sp|Q9M2Y9|RAX3_ARATH Transcription factor RAX3 OS=Arabidopsis thaliana GN=RAX3 PE=2 SV=1 Back     alignment and function desciption
 Score =  216 bits (549), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 108/118 (91%)

Query: 1   MGRAPCCDKANVKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLN 60
           MGRAPCCDKANVK+GPWS EED+ LK+Y+E  G GGNWIALP+K GL RCGKSCRLRWLN
Sbjct: 1   MGRAPCCDKANVKKGPWSPEEDAKLKSYIENSGTGGNWIALPQKIGLKRCGKSCRLRWLN 60

Query: 61  YLRPDIKHGGFTKEEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKKNVL 118
           YLRP+IKHGGF++EE+ IIC+LY T+GSRWS+IA+QLPGRTDND+KNYWNT+LKK ++
Sbjct: 61  YLRPNIKHGGFSEEEENIICSLYLTIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLI 118
Transcription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SJL7|RAX2_ARATH Transcription factor RAX2 OS=Arabidopsis thaliana GN=RAX2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FG68|RAX1_ARATH Transcription factor RAX1 OS=Arabidopsis thaliana GN=RAX1 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|P27898|MYBP_MAIZE Myb-related protein P OS=Zea mays GN=P PE=2 SV=1 Back     alignment and function description
>sp|P80073|MYB2_PHYPA Myb-related protein Pp2 OS=Physcomitrella patens subsp. patens GN=PP2 PE=2 SV=1 Back     alignment and function description
>sp|O22264|MYB12_ARATH Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1 Back     alignment and function description
>sp|P81392|MYB06_ANTMA Myb-related protein 306 OS=Antirrhinum majus GN=MYB306 PE=2 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
224092242302 predicted protein [Populus trichocarpa] 0.563 0.443 0.773 2e-60
356564099309 PREDICTED: uncharacterized protein LOC10 0.563 0.433 0.783 3e-60
148905997 415 unknown [Picea sitchensis] 0.537 0.308 0.761 5e-58
351721498261 transcription factor MYBJ6 [Glycine max] 0.634 0.578 0.696 6e-57
356520844260 PREDICTED: transcription factor MYB113-l 0.651 0.596 0.672 8e-57
388501912319 unknown [Lotus japonicus] 0.827 0.617 0.537 3e-56
296081600259 unnamed protein product [Vitis vinifera] 0.970 0.891 0.502 4e-56
225429418264 PREDICTED: transcription repressor MYB6- 0.970 0.875 0.502 4e-56
388502834226 unknown [Lotus japonicus] 0.571 0.601 0.714 7e-56
224117618 365 predicted protein [Populus trichocarpa] 0.579 0.378 0.710 7e-56
>gi|224092242|ref|XP_002309524.1| predicted protein [Populus trichocarpa] gi|222855500|gb|EEE93047.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  238 bits (607), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 119/141 (84%), Gaps = 7/141 (4%)

Query: 1   MGRAPCCDKANVKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLN 60
           MGRAPCCDKANVKRGPWS EED+ LK+YLE  G GGNWIALP+KAGL RCGKSCRLRWLN
Sbjct: 1   MGRAPCCDKANVKRGPWSPEEDATLKSYLETHGTGGNWIALPQKAGLKRCGKSCRLRWLN 60

Query: 61  YLRPDIKHGGFTKEEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKKNVLAG 120
           YLRPDIKHGGFT+EED IIC LY  MGSRWS+IA+QLPGRTDNDVKNYWNTKLKK +LAG
Sbjct: 61  YLRPDIKHGGFTEEEDNIICTLYSQMGSRWSLIAAQLPGRTDNDVKNYWNTKLKKKILAG 120

Query: 121 KLS-------DNTQVSVSTIP 134
           K+S        N  V+V+ IP
Sbjct: 121 KISLTIKNNPINAPVNVANIP 141

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356564099|ref|XP_003550294.1| PREDICTED: uncharacterized protein LOC100789985 [Glycine max] Back     alignment and taxonomy information
>gi|148905997|gb|ABR16159.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|351721498|ref|NP_001237467.1| transcription factor MYBJ6 [Glycine max] gi|114384141|gb|ABI73972.1| transcription factor MYBJ6 [Glycine max] Back     alignment and taxonomy information
>gi|356520844|ref|XP_003529070.1| PREDICTED: transcription factor MYB113-like [Glycine max] Back     alignment and taxonomy information
>gi|388501912|gb|AFK39022.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|296081600|emb|CBI20605.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225429418|ref|XP_002278546.1| PREDICTED: transcription repressor MYB6-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|388502834|gb|AFK39483.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224117618|ref|XP_002331681.1| predicted protein [Populus trichocarpa] gi|222874100|gb|EEF11231.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
TAIR|locus:2169970 374 MYB68 "myb domain protein 68" 0.495 0.315 0.796 1.5e-53
TAIR|locus:2174557333 MYB36 "myb domain protein 36" 0.567 0.405 0.703 8e-53
TAIR|locus:2097335310 MYB84 "myb domain protein 84" 0.495 0.380 0.771 2.1e-52
TAIR|locus:2137589305 MYB87 "myb domain protein 87" 0.655 0.511 0.607 1.2e-51
TAIR|locus:2057931298 RAX2 "REGULATOR OF AXILLARY ME 0.659 0.526 0.611 4e-51
TAIR|locus:2181146329 MYB37 "myb domain protein 37" 0.550 0.398 0.674 2.8e-50
TAIR|locus:2088957317 TDF1 "DEFECTIVE IN MERISTEM DE 0.651 0.488 0.537 6.6e-42
TAIR|locus:2038520246 MYB13 "myb domain protein 13" 0.659 0.638 0.557 8.4e-42
TAIR|locus:2207330294 MYB63 "myb domain protein 63" 0.483 0.391 0.629 2e-41
TAIR|locus:2042526249 MYB14 "myb domain protein 14" 0.655 0.626 0.528 2.8e-41
TAIR|locus:2169970 MYB68 "myb domain protein 68" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 554 (200.1 bits), Expect = 1.5e-53, P = 1.5e-53
 Identities = 94/118 (79%), Positives = 108/118 (91%)

Query:     1 MGRAPCCDKANVKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLN 60
             MGRAPCCDKANVK+GPWS EED+ LK+Y+E  G GGNWIALP+K GL RCGKSCRLRWLN
Sbjct:     1 MGRAPCCDKANVKKGPWSPEEDAKLKDYIENSGTGGNWIALPQKIGLRRCGKSCRLRWLN 60

Query:    61 YLRPDIKHGGFTKEEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKKNVL 118
             YLRP+IKHGGF++EED IICNLY T+GSRWS+IA+QLPGRTDND+KNYWNT+LKK +L
Sbjct:    61 YLRPNIKHGGFSEEEDNIICNLYVTIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLL 118
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0000041 "transition metal ion transport" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2174557 MYB36 "myb domain protein 36" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097335 MYB84 "myb domain protein 84" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137589 MYB87 "myb domain protein 87" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057931 RAX2 "REGULATOR OF AXILLARY MERISTEMS 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181146 MYB37 "myb domain protein 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088957 TDF1 "DEFECTIVE IN MERISTEM DEVELOPMENT AND FUNCTION 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038520 MYB13 "myb domain protein 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207330 MYB63 "myb domain protein 63" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042526 MYB14 "myb domain protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 2e-46
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 8e-45
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-14
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 3e-14
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 1e-12
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 5e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 1e-09
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 7e-09
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 4e-08
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 4e-08
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 5e-06
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  154 bits (390), Expect = 2e-46
 Identities = 67/123 (54%), Positives = 92/123 (74%), Gaps = 1/123 (0%)

Query: 5   PCCDKANVKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRP 64
           PCC K  +KRGPW+ EED IL +++++ G G  W +LPK+AGL RCGKSCRLRW+NYLRP
Sbjct: 16  PCCTKMGMKRGPWTVEEDEILVSFIKKEGEG-RWRSLPKRAGLLRCGKSCRLRWMNYLRP 74

Query: 65  DIKHGGFTKEEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKKNVLAGKLSD 124
            +K GG T +E+ +I  L+  +G+RWS+IA ++PGRTDN++KNYWNT L+K +L   +  
Sbjct: 75  SVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDP 134

Query: 125 NTQ 127
            T 
Sbjct: 135 QTH 137

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 238
PLN03091 459 hypothetical protein; Provisional 100.0
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.88
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.86
PLN03212249 Transcription repressor MYB5; Provisional 99.85
PLN03091 459 hypothetical protein; Provisional 99.8
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.8
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.7
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.66
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.64
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.61
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.48
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.47
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.43
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.4
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.28
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.16
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.07
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.96
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.87
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.79
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.87
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.74
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.74
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.66
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.59
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.48
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.26
KOG1279506 consensus Chromatin remodeling factor subunit and 97.26
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.21
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.13
KOG1279506 consensus Chromatin remodeling factor subunit and 97.06
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.04
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.73
PRK13923170 putative spore coat protein regulator protein YlbO 96.69
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.64
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.99
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.95
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.83
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.71
PLN031421033 Probable chromatin-remodeling complex ATPase chain 95.32
PRK13923170 putative spore coat protein regulator protein YlbO 95.21
KOG2656 445 consensus DNA methyltransferase 1-associated prote 94.1
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 94.09
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 93.68
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 92.36
KOG4282 345 consensus Transcription factor GT-2 and related pr 90.76
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 90.6
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 86.77
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 86.77
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 83.38
KOG1194 534 consensus Predicted DNA-binding protein, contains 83.02
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 82.23
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 81.94
KOG4282345 consensus Transcription factor GT-2 and related pr 80.89
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.6e-38  Score=288.99  Aligned_cols=122  Identities=52%  Similarity=1.087  Sum_probs=116.4

Q ss_pred             CCCCccCCCCCCCCCCCCHHHHHHHHHHHHHhCCCCCceecccccCCCCCcchhhhhhccccCCCCCCCCCCHHHHHHHH
Q 037024            1 MGRAPCCDKANVKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRPDIKHGGFTKEEDTIIC   80 (238)
Q Consensus         1 mg~~~~~~k~~~~kg~WT~eED~~L~~~v~~~g~~~~W~~Ia~~~~~~Rt~~qcr~Rw~~~L~p~i~k~~WT~eED~~L~   80 (238)
                      |||+|||+|+.++|++||+|||++|+++|.+||. .+|..||+.++++|+++|||+||.++|+|.+++++||+|||++|+
T Consensus         1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~-~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLL   79 (459)
T PLN03091          1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGH-GCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLII   79 (459)
T ss_pred             CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCc-CCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHH
Confidence            9999999999999999999999999999999998 699999999977999999999999999999999999999999999


Q ss_pred             HHHHhhCCchhhhcccCCCCCHHHHHHHHHHhhchhhhcCCCC
Q 037024           81 NLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKKNVLAGKLS  123 (238)
Q Consensus        81 ~~v~~~G~~W~~Ia~~l~gRt~~~cr~Rw~~~l~~~~~~~~~t  123 (238)
                      +++.+||++|..||+.|||||+++||+||+.++++.++.....
T Consensus        80 eL~k~~GnKWskIAk~LPGRTDnqIKNRWnslLKKklr~~~I~  122 (459)
T PLN03091         80 ELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGID  122 (459)
T ss_pred             HHHHHhCcchHHHHHhcCCCCHHHHHHHHHHHHHHHHHHcCCC
Confidence            9999999999999999999999999999999999877643333

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 1e-20
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 3e-20
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 6e-20
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 7e-20
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 7e-20
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 4e-18
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 1e-14
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 3e-09
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 8e-09
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 1e-08
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 2e-04
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 5e-04
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 5e-04
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 66/104 (63%), Gaps = 2/104 (1%)
Query: 14  RGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRPDIKHGGFTK 73
           +GPW+ EED  +   ++++G    W  + K     R GK CR RW N+L P++K   +T+
Sbjct: 7   KGPWTKEEDQKVIELVKKYGTK-QWTLIAKHLK-GRLGKQCRERWHNHLNPEVKKSSWTE 64
Query: 74  EEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKKNV 117
           EED II   +  +G+RW+ IA  LPGRTDN VKN+WN+ +K+ V
Sbjct: 65  EEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKV 108
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 1e-57
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 7e-57
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 8e-57
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 5e-56
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 8e-51
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 1e-50
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 1e-24
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-22
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-05
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 7e-19
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 3e-07
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-14
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-06
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-09
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 4e-07
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 5e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 4e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 1e-06
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 2e-06
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 7e-06
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 8e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 1e-05
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 7e-04
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-05
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 3e-05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 3e-05
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 5e-04
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
 Score =  177 bits (452), Expect = 1e-57
 Identities = 40/108 (37%), Positives = 55/108 (50%), Gaps = 3/108 (2%)

Query: 8   DKANVKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRPDIK 67
           +    K+  ++ EED +LK  + Q G+    IA       NR  + CR RW NYL P I 
Sbjct: 5   NLKAAKKQKFTPEEDEMLKRAVAQHGSDWKMIA---ATFPNRNARQCRDRWKNYLAPSIS 61

Query: 68  HGGFTKEEDTIICNLYCTMGSRWSVIASQLPGRTDNDVKNYWNTKLKK 115
           H  +T EED ++       G +W++IA   PGRTD  +KN W T   K
Sbjct: 62  HTPWTAEEDALLVQKIQEYGRQWAIIAKFFPGRTDIHIKNRWVTISNK 109
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.97
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.88
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.88
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.87
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.86
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.86
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.83
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.78
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.77
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.75
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.74
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.73
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.72
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.71
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.71
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.71
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.71
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.7
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.7
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.69
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.69
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.68
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.66
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.64
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.64
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.64
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.64
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.63
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.63
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.62
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.6
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.6
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.58
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.57
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.57
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.33
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.54
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.51
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.5
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.49
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.46
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.46
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.45
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.43
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.43
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.37
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.06
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.33
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.26
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.06
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.04
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.0
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.92
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.88
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.84
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.76
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.69
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.67
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.59
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.56
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.52
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.5
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.35
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.25
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.24
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.19
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.14
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.44
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.09
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.87
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.86
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.73
2crg_A70 Metastasis associated protein MTA3; transcription 97.69
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.62
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.52
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.36
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.34
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.29
2crg_A70 Metastasis associated protein MTA3; transcription 97.21
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.23
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.89
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.86
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.73
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.86
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 95.84
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.75
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.22
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 89.15
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 88.42
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 87.22
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 80.32
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
Probab=100.00  E-value=1e-39  Score=265.77  Aligned_cols=139  Identities=28%  Similarity=0.526  Sum_probs=95.5

Q ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCCCceecccccCCCCCcchhhhhhccccCCCCCCCCCCHHHHHHHHHHHHhhCC-ch
Q 037024           12 VKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRPDIKHGGFTKEEDTIICNLYCTMGS-RW   90 (238)
Q Consensus        12 ~~kg~WT~eED~~L~~~v~~~g~~~~W~~Ia~~~~~~Rt~~qcr~Rw~~~L~p~i~k~~WT~eED~~L~~~v~~~G~-~W   90 (238)
                      +++++||+|||++|+++|.+||. .+|..||..|+ +|++.||++||.++|+|.+++++||+|||++|+++|..||. +|
T Consensus         4 ~~k~~Wt~eED~~L~~~v~~~g~-~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~v~~~g~~~W   81 (159)
T 1h89_C            4 LGKTRWTREEDEKLKKLVEQNGT-DDWKVIANYLP-NRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRW   81 (159)
T ss_dssp             -----------------------------------------CHHHHHHTTTCTTCCCSCCCHHHHHHHHHHHHHHCSCCH
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCC-CCHHHHHHHcC-CCCHHHHHHHHHHccCCCcCCCCCChHHHHHHHHHHHHhCcccH
Confidence            48999999999999999999997 69999999998 99999999999999999999999999999999999999995 79


Q ss_pred             hhhcccCCCCCHHHHHHHHHHhhchhhhcCCCChHHhHHHHhhhHHhCCCcccccccCCCCc
Q 037024           91 SVIASQLPGRTDNDVKNYWNTKLKKNVLAGKLSDNTQVSVSTIPEEFGNSSYYLSADSAAGM  152 (238)
Q Consensus        91 ~~Ia~~l~gRt~~~cr~Rw~~~l~~~~~~~~~t~~ed~~l~~~~~~~g~~~~~i~~~~~~~~  152 (238)
                      ..||..|||||+.||++||.++|.|.+++++||++||..|++++.+||++|..|+...++.+
T Consensus        82 ~~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~~~g~~W~~Ia~~l~gRt  143 (159)
T 1h89_C           82 SVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRT  143 (159)
T ss_dssp             HHHHHTSTTCCHHHHHHHHHHTTCTTSCCSCCCHHHHHHHHHHHHHHCSCHHHHHTTSTTCC
T ss_pred             HHHHHHcCCCCHHHHHHHHHHHhCccccccCCChHHHHHHHHHHHHHCCCHHHHHHHCCCCC
Confidence            99999999999999999999999999999999999999999999999999999887766543
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 238
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 5e-19
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-10
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-18
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-09
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 3e-16
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 1e-11
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 8e-15
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-06
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 1e-14
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 3e-07
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 1e-13
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-13
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-10
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-13
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 3e-12
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 3e-11
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-05
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 6e-11
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-08
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 2e-10
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 4e-08
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 7e-09
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 0.002
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-08
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 4e-07
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 2e-07
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 75.5 bits (186), Expect = 5e-19
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 12 VKRGPWSAEEDSILKNYLEQFGNGGNWIALPKKAGLNRCGKSCRLRWLNYLRPD 65
          + +GPW+ EED  L   ++++G    W  + K     R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPK-RWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.78
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.77
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.76
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.75
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.73
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.71
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.68
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.62
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.58
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.58
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.55
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.55
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.52
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.51
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.51
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.49
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.49
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.46
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.42
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.36
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.36
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.35
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.25
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.23
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.22
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.01
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.0
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.92
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.28
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.22
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.11
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.92
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.7
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.3
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.01
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.81
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.44
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.14
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 95.43
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.19
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 91.83
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 90.31
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 83.75
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.78  E-value=1.1e-21  Score=141.85  Aligned_cols=72  Identities=14%  Similarity=0.173  Sum_probs=64.9

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCC----CCceecccccCCCCCcchhhhhhccccCCCCCCCCCCHHHHHHHHHHHHhh
Q 037024           14 RGPWSAEEDSILKNYLEQFGNG----GNWIALPKKAGLNRCGKSCRLRWLNYLRPDIKHGGFTKEEDTIICNLYCTM   86 (238)
Q Consensus        14 kg~WT~eED~~L~~~v~~~g~~----~~W~~Ia~~~~~~Rt~~qcr~Rw~~~L~p~i~k~~WT~eED~~L~~~v~~~   86 (238)
                      |++||+|||++|+++|.+||..    .+|..||+.|+ |||++||+.||.++|+|.+++++||.+||.+|+.....+
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lp-gRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~l   76 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVP-NHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNL   76 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTST-TSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSCB
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcC-CCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhcc
Confidence            6899999999999999999862    24999999998 999999999999999999999999999999887655443
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure