Citrus Sinensis ID: 037085


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MARLWPQLASIKNQRGETTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALVDEAKSHRKEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLCNANSQDSVFKEIGWIIQRAVAQQSPQLPDAGSANVSWNQTRWPIETRNVLLMVVVTIAAAFFTVTCNLPDSFLKEDTLA
cccccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHccccccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
ccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccc
MARLWPQLASIKNQRGETTMHLLSTDGDARMVRIFGENNRELCLevdnslmiplhraaleGDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALVDEAKSHRkehlftwkdkegntvlHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLCnansqdsvFKEIGWIIQRAVAqqspqlpdagsanvswnqtrwpietRNVLLMVVVTIAAAFFTVTcnlpdsflkedtla
MARLWPQLAsiknqrgetTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALVDEAKSHRKEHlftwkdkegntvlHLATLNKLKQIVELLirensnrriMIRINTVNKQGQTALQLCNANSQDSVFKEIGWIIQRAVAQQSPQLPDAGSANVSWNQTRWPIETRNVLLMVVVTIAAAFFTVtcnlpdsflkedtla
MARLWPQLASIKNQRGETTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALVDEAKSHRKEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLCNANSQDSVFKEIGWIIQRAVAQQSPQLPDAGSANVSWNQTRWPIETRNVLLMvvvtiaaafftvtCNLPDSFLKEDTLA
*********************LLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIRALVSICPESLEKLT****TALHLAV*********ALV*******KEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLCNANSQDSVFKEIGWIIQRAVAQ**********ANVSWNQTRWPIETRNVLLMVVVTIAAAFFTVTCNLPDSF*******
*ARLWPQLASIKNQRGETTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALVDEAKSHRKEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLCNANSQDSVFKEIGWIIQRA*************************ETRNVLLMVVVTIAAAFFTVTCNL***********
MARLWPQLASIKNQRGETTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALVDEAKSHRKEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLCNANSQDSVFKEIGWIIQRAVAQQSPQLPDAGSANVSWNQTRWPIETRNVLLMVVVTIAAAFFTVTCNLPDSFLKEDTLA
*A**WPQLASIKNQRGETTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALVDEAKSHRKEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLCNANSQDSVFKEIGWIIQRAVAQQSPQLPDAGSANVSWNQTRWPIETRNVLLMVVVTIAAAFFTVTCNLPDSFLK*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARLWPQLASIKNQRGETTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALVDEAKSHRKEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLCNANSQDSVFKEIGWIIQRAVAQQSPQLPDAGSANVSWNQTRWPIETRNVLLMVVVTIAAAFFTVTCNLPDSFLKEDTLA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query248 2.2.26 [Sep-21-2011]
Q6AWW5 524 Ankyrin repeat-containing no no 0.612 0.290 0.271 2e-10
Q9C7A2 590 Ankyrin repeat-containing no no 0.637 0.267 0.285 4e-09
B2RXR6993 Serine/threonine-protein yes no 0.633 0.158 0.271 5e-07
Q9ZU96 532 Ankyrin repeat-containing no no 0.637 0.296 0.244 6e-07
P20749454 B-cell lymphoma 3 protein yes no 0.596 0.325 0.278 9e-07
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.576 0.072 0.261 1e-06
Q54KA7 986 Ankyrin repeat, PH and SE no no 0.629 0.158 0.268 1e-06
Q02989 1411 Alpha-latroinsectotoxin-L N/A no 0.536 0.094 0.271 3e-06
Q9Z2F6448 B-cell lymphoma 3 protein no no 0.596 0.330 0.284 4e-06
Q8N8A2993 Serine/threonine-protein no no 0.608 0.152 0.260 5e-06
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function desciption
 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 81/162 (50%), Gaps = 10/162 (6%)

Query: 8   LASIKNQRGETTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIR 67
           LA  K + G    H+ + +G+ +++ +  E N EL    D+S    LH AA +G  +++ 
Sbjct: 83  LAGTKAKNGFDAFHIAAKNGNLQVLDVLIEANPELSFTFDSSKTTALHTAASQGHGEIVC 142

Query: 68  ALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALVDEAKSHRKEHLFTWKDKEGNTVL 127
            L+    +      SNG+TALH A +   +   + L++     +K  + T  DK+G T L
Sbjct: 143 FLLDKGVDLAAIARSNGKTALHSAARNGHTVIVKKLIE-----KKAGMVTRVDKKGQTAL 197

Query: 128 HLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLC 169
           H+A   +  +IV++L+  + +      IN+ + +G T L + 
Sbjct: 198 HMAVKGQNTEIVDVLMEADGS-----LINSADNKGNTPLHIA 234





Arabidopsis thaliana (taxid: 3702)
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function description
>sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function description
>sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 Back     alignment and function description
>sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 Back     alignment and function description
>sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 Back     alignment and function description
>sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
255539875 430 ankyrin repeat-containing protein, putat 0.939 0.541 0.403 6e-40
255539879315 protein binding protein, putative [Ricin 0.701 0.552 0.401 3e-27
224114660 448 predicted protein [Populus trichocarpa] 0.951 0.526 0.306 8e-25
224136414 459 predicted protein [Populus trichocarpa] 0.641 0.346 0.362 1e-22
225447366 462 PREDICTED: ankyrin repeat-containing pro 0.733 0.393 0.392 2e-22
359490025 450 PREDICTED: LOW QUALITY PROTEIN: ankyrin 0.991 0.546 0.286 5e-20
255539939320 ankyrin repeat-containing protein, putat 0.927 0.718 0.301 2e-19
225469107 430 PREDICTED: ankyrin repeat-containing pro 0.629 0.362 0.365 3e-19
359495749 460 PREDICTED: uncharacterized protein LOC10 0.685 0.369 0.340 4e-19
297739323 371 unnamed protein product [Vitis vinifera] 0.536 0.358 0.422 1e-18
>gi|255539875|ref|XP_002511002.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223550117|gb|EEF51604.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  170 bits (430), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 143/243 (58%), Gaps = 10/243 (4%)

Query: 1   MARLWPQLASIKNQRGETTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALE 60
           +AR + Q   ++ Q G T +HL  + GD  +V +  + + ELC E D   MIPL  A   
Sbjct: 62  IARNYRQFLRVRYQEGYTALHLACSRGDLPLVELLLKLDSELCFEKDKFSMIPLQTAISF 121

Query: 61  GDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALVDEAKSHRKEHLFTWKD 120
           G ++VI  L++  PES+ KLT   ET  HLA K  +S AF+AL++E K  ++EHL   KD
Sbjct: 122 GYTEVISTLIAARPESVRKLTPQRETLFHLAAKHHQSSAFEALLEEVKKLKQEHLLHRKD 181

Query: 121 KEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLCNANSQDSVFKE 180
           ++GN VLH+A  NKL  IV+LL+  +   R M+R+NT+NK+  TAL +   NS+D   ++
Sbjct: 182 RQGNNVLHIAASNKLIGIVKLLLPAD---RAMVRVNTLNKKRLTALDVYYQNSKDISTRD 238

Query: 181 IGWIIQRAVAQQSPQLPDAGSANVSWNQTRWPIETRNVLLMVVVTIAAAFFTVTCNLPDS 240
           IG I+  A   +   LP            RW +ET+NV+L+V+  I  A FT  C+LP S
Sbjct: 239 IGRILCEAGGLEGRSLPMRA-------YIRWTLETKNVILVVLGIITGAAFTTVCSLPKS 291

Query: 241 FLK 243
           F++
Sbjct: 292 FVE 294




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255539879|ref|XP_002511004.1| protein binding protein, putative [Ricinus communis] gi|223550119|gb|EEF51606.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224114660|ref|XP_002332335.1| predicted protein [Populus trichocarpa] gi|222832582|gb|EEE71059.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224136414|ref|XP_002326854.1| predicted protein [Populus trichocarpa] gi|222835169|gb|EEE73604.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225447366|ref|XP_002274771.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490025|ref|XP_003634016.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255539939|ref|XP_002511034.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223550149|gb|EEF51636.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225469107|ref|XP_002269257.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495749|ref|XP_003635081.1| PREDICTED: uncharacterized protein LOC100852638 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739323|emb|CBI28974.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
TAIR|locus:2176252 442 AT5G51160 "AT5G51160" [Arabido 0.762 0.427 0.322 9.5e-20
TAIR|locus:2172099 431 AT5G54620 [Arabidopsis thalian 0.782 0.450 0.296 2.3e-15
TAIR|locus:2128781 677 AT4G03460 "AT4G03460" [Arabido 0.758 0.277 0.276 2e-14
TAIR|locus:2172089 426 ANK "ankyrin" [Arabidopsis tha 0.713 0.415 0.297 2.6e-13
TAIR|locus:2020833 616 AT1G03670 "AT1G03670" [Arabido 0.911 0.366 0.254 3.3e-13
TAIR|locus:2128771 641 AT4G03450 "AT4G03450" [Arabido 0.685 0.265 0.282 7.4e-13
TAIR|locus:2026489 543 AT1G07710 "AT1G07710" [Arabido 0.649 0.296 0.289 9.1e-13
TAIR|locus:2132711 445 AT4G10720 "AT4G10720" [Arabido 0.774 0.431 0.259 1.7e-12
TAIR|locus:2170081 535 AT5G50140 "AT5G50140" [Arabido 0.762 0.353 0.281 2.6e-11
TAIR|locus:2075009 607 AT3G09550 [Arabidopsis thalian 0.645 0.263 0.294 3.2e-11
TAIR|locus:2176252 AT5G51160 "AT5G51160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 240 (89.5 bits), Expect = 9.5e-20, P = 9.5e-20
 Identities = 62/192 (32%), Positives = 97/192 (50%)

Query:    13 NQRGETTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIRALVSI 72
             ++ G + +H  +  G    VR      ++LC   D     PLH A + G  DVIR +V+ 
Sbjct:    44 DKNGFSPLHAAAAAGQVETVRATLGVEKKLCRLKDRDGKTPLHVATMRGKIDVIREIVAS 103

Query:    73 CPESLEKLTSNGETALHLAVKKSRSDAFQALVDEAKSHRKEHLFTWKDKEGNTVLHLATL 132
             C + LE  T  G+TALHLAV     +A  A+V+      +  +   KD++GNT LHLAT 
Sbjct:   104 CVDCLEDETVQGQTALHLAVLHLEIEAVIAIVELITETNRFDVLNKKDEQGNTALHLATW 163

Query:   133 NKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLCNANSQDSVFKEIGWIIQRAVAQQ 192
              K +Q++E+L++          +N +NK G +A+ L      ++  +EI   +  A AQ+
Sbjct:   164 RKNRQVIEVLVQAIPEESRSFEVNAMNKMGLSAMDLLVMFPSEAGDREIYEKLIEAGAQR 223

Query:   193 SPQLPDAGSANV 204
                  D G+ NV
Sbjct:   224 GR---DIGTTNV 232


GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0006826 "iron ion transport" evidence=RCA
GO:0010043 "response to zinc ion" evidence=RCA
GO:0010106 "cellular response to iron ion starvation" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
TAIR|locus:2172099 AT5G54620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172089 ANK "ankyrin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128771 AT4G03450 "AT4G03450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132711 AT4G10720 "AT4G10720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170081 AT5G50140 "AT5G50140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.02320016
hypothetical protein (448 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-18
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-17
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 7e-04
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 76.7 bits (189), Expect = 7e-18
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 13/125 (10%)

Query: 45  EVDNSLMIPLHRAALEGDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALV 104
             D     PLH AA  G  +V++ L+    +   K  ++G T LHLA K    +  + L+
Sbjct: 2   ARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAK-DNDGRTPLHLAAKNGHLEIVKLLL 60

Query: 105 DEAKSHRKEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQT 164
           ++            +DK+GNT LHLA  N    +V+LL++  ++      +N  +K G+T
Sbjct: 61  EKGADVNA------RDKDGNTPLHLAARNGNLDVVKLLLKHGAD------VNARDKDGRT 108

Query: 165 ALQLC 169
            L L 
Sbjct: 109 PLHLA 113


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 248
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.98
PHA02791284 ankyrin-like protein; Provisional 99.97
PHA02875 413 ankyrin repeat protein; Provisional 99.97
PHA02874 434 ankyrin repeat protein; Provisional 99.97
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
PHA02878 477 ankyrin repeat protein; Provisional 99.97
PHA03100 480 ankyrin repeat protein; Provisional 99.96
PHA02875 413 ankyrin repeat protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02946 446 ankyin-like protein; Provisional 99.96
PHA02878 477 ankyrin repeat protein; Provisional 99.96
PHA02874434 ankyrin repeat protein; Provisional 99.96
PHA03100 480 ankyrin repeat protein; Provisional 99.96
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02798 489 ankyrin-like protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.95
PHA02798 489 ankyrin-like protein; Provisional 99.95
PHA03095 471 ankyrin-like protein; Provisional 99.95
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.95
PHA02989 494 ankyrin repeat protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA03095 471 ankyrin-like protein; Provisional 99.95
PHA02876 682 ankyrin repeat protein; Provisional 99.95
KOG0510 929 consensus Ankyrin repeat protein [General function 99.95
PHA02876 682 ankyrin repeat protein; Provisional 99.95
PHA02989 494 ankyrin repeat protein; Provisional 99.94
PHA02946 446 ankyin-like protein; Provisional 99.94
PLN03192823 Voltage-dependent potassium channel; Provisional 99.94
KOG0508 615 consensus Ankyrin repeat protein [General function 99.94
KOG0508 615 consensus Ankyrin repeat protein [General function 99.93
KOG0510 929 consensus Ankyrin repeat protein [General function 99.93
KOG0514452 consensus Ankyrin repeat protein [General function 99.93
PHA02917 661 ankyrin-like protein; Provisional 99.93
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.92
PHA02741169 hypothetical protein; Provisional 99.91
PHA02743166 Viral ankyrin protein; Provisional 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.91
PHA02743166 Viral ankyrin protein; Provisional 99.91
PHA02795 437 ankyrin-like protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
PHA02730 672 ankyrin-like protein; Provisional 99.9
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
PHA02917 661 ankyrin-like protein; Provisional 99.9
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.9
PHA02884300 ankyrin repeat protein; Provisional 99.9
PHA02730 672 ankyrin-like protein; Provisional 99.9
PHA02736154 Viral ankyrin protein; Provisional 99.89
PHA02736154 Viral ankyrin protein; Provisional 99.89
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.88
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.86
PHA02792 631 ankyrin-like protein; Provisional 99.85
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.85
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.84
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.84
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.83
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.82
PHA02884300 ankyrin repeat protein; Provisional 99.82
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.81
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.81
KOG0514452 consensus Ankyrin repeat protein [General function 99.81
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.8
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.79
PHA02792631 ankyrin-like protein; Provisional 99.78
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.78
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.78
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.76
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.75
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.7
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.68
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.66
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.66
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.65
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.6
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.54
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.53
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.53
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.5
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.49
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.48
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.47
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.46
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.45
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.38
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.36
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.05
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.0
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.95
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.94
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.93
PF13962113 PGG: Domain of unknown function 98.91
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.91
PF1360630 Ank_3: Ankyrin repeat 98.84
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.83
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.81
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.76
PF1360630 Ank_3: Ankyrin repeat 98.71
KOG0522 560 consensus Ankyrin repeat protein [General function 98.6
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.59
KOG0522 560 consensus Ankyrin repeat protein [General function 98.58
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.54
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.54
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.47
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.4
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.38
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.33
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.3
KOG2384223 consensus Major histocompatibility complex protein 98.28
KOG0511 516 consensus Ankyrin repeat protein [General function 98.16
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.15
KOG0511 516 consensus Ankyrin repeat protein [General function 98.1
KOG2384223 consensus Major histocompatibility complex protein 98.01
KOG2505591 consensus Ankyrin repeat protein [General function 97.63
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.96
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.86
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.65
KOG2505591 consensus Ankyrin repeat protein [General function 96.18
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 95.62
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.62
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 94.42
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.33
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 91.61
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=9.7e-39  Score=226.92  Aligned_cols=181  Identities=27%  Similarity=0.347  Sum_probs=161.9

Q ss_pred             ccCc-hhHhhhccCCCCHHHHHHhCCCHHHHHHHHhcCcchhhhhcCCCCcHHHHHHHhCCHHHHHHHHHhCchhhhhhc
Q 037085            3 RLWP-QLASIKNQRGETTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIRALVSICPESLEKLT   81 (248)
Q Consensus         3 ~~~~-~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~   81 (248)
                      ...| ++....|.+|+|||||||+.|+.+++.+|++.-....+.+|..|+||||+||..|+.++|+.|+.+.+.+++..+
T Consensus        24 ~s~~kSL~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~t  103 (226)
T KOG4412|consen   24 QSDPKSLNARDDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATT  103 (226)
T ss_pred             hcChhhhhccccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceec
Confidence            3445 444455669999999999999999999999754444477899999999999999999999999998666799999


Q ss_pred             cCCCcHHHHHHHcCChHHHHHHHHHHhccccccccccccCCCCcHhHHHHhCCcHHHHHHHHhhcccccccccccccCCC
Q 037085           82 SNGETALHLAVKKSRSDAFQALVDEAKSHRKEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQ  161 (248)
Q Consensus        82 ~~g~t~lh~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~g~t~Lh~A~~~~~~~~v~~Ll~~g~~~~~~~~~~~~~~~  161 (248)
                      ..|+||||+|+..|..+|+++|+++|+.      ++.+|..|.||||-|+..|+.+++++|+..|+      .+|..|+.
T Consensus       104 n~G~T~LHyAagK~r~eIaqlLle~ga~------i~~kD~~~qtplHRAAavGklkvie~Li~~~a------~~n~qDk~  171 (226)
T KOG4412|consen  104 NGGQTCLHYAAGKGRLEIAQLLLEKGAL------IRIKDKQGQTPLHRAAAVGKLKVIEYLISQGA------PLNTQDKY  171 (226)
T ss_pred             CCCcceehhhhcCChhhHHHHHHhcCCC------CcccccccCchhHHHHhccchhhHHHHHhcCC------CCCccccc
Confidence            9999999999999999999999999988      89999999999999999999999999999998      79999999


Q ss_pred             CCCHHHHHHHcCCCchHHHHHHHHHHhhhhcCCCCCCC
Q 037085          162 GQTALQLCNANSQDSVFKEIGWIIQRAVAQQSPQLPDA  199 (248)
Q Consensus       162 g~tpl~~a~~~~~~~~~~~i~~~L~~~g~~~~~~~~~~  199 (248)
                      |+||||.|..-    ++.++...|.++||+....+..+
T Consensus       172 G~TpL~~al~e----~~~d~a~lLV~~gAd~~~edke~  205 (226)
T KOG4412|consen  172 GFTPLHHALAE----GHPDVAVLLVRAGADTDREDKEG  205 (226)
T ss_pred             CccHHHHHHhc----cCchHHHHHHHhccceeeccccC
Confidence            99999999543    58889999999999988877643



>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-09
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-08
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-08
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 1e-07
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-07
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-07
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-06
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-06
2xeh_A157 Structural Determinants For Improved Thermal Stabil 6e-06
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 9e-05
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-04
1uoh_A226 Human Gankyrin Length = 226 2e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-04
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 3e-04
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 3e-04
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 4e-04
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 5e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 5e-04
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 6e-04
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 6e-04
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 6e-04
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 8e-04
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 8e-04
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure

Iteration: 1

Score = 58.9 bits (141), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 41/142 (28%), Positives = 68/142 (47%), Gaps = 17/142 (11%) Query: 47 DNSLMIPLHRAALEGDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALVDE 106 D+ PLH AA EG ++++ L+S + K S+G T LH A K+ + + L+ + Sbjct: 34 DSDGRTPLHYAAKEGHKEIVKLLISKGADVNAK-DSDGRTPLHYAAKEGHKEIVKLLISK 92 Query: 107 AKSHRKEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTAL 166 KD +G T LH A K+IV+LLI + ++ +NT + G+T L Sbjct: 93 GAD------VNAKDSDGRTPLHYAAKEGHKEIVKLLISKGAD------VNTSDSDGRTPL 140 Query: 167 QLCNANSQDSVF----KEIGWI 184 L + + + K+ GW+ Sbjct: 141 DLAREHGNEEIVKLLEKQGGWL 162
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-17
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-15
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-15
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-15
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-09
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-17
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-17
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-07
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-13
2etb_A256 Transient receptor potential cation channel subfam 1e-15
2etb_A256 Transient receptor potential cation channel subfam 2e-11
2etb_A256 Transient receptor potential cation channel subfam 5e-11
2etb_A256 Transient receptor potential cation channel subfam 9e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-11
2rfa_A232 Transient receptor potential cation channel subfa 2e-15
2rfa_A232 Transient receptor potential cation channel subfa 3e-13
2rfa_A232 Transient receptor potential cation channel subfa 7e-13
2rfa_A232 Transient receptor potential cation channel subfa 1e-11
2rfa_A232 Transient receptor potential cation channel subfa 2e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-15
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-10
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-12
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-09
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-14
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-12
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-13
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-08
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-15
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-10
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-04
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-15
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-09
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-13
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-08
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-14
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-09
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-04
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-14
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-13
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-11
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-09
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-13
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-13
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-09
2pnn_A273 Transient receptor potential cation channel subfa 8e-13
2pnn_A273 Transient receptor potential cation channel subfa 3e-11
2pnn_A273 Transient receptor potential cation channel subfa 5e-11
2pnn_A273 Transient receptor potential cation channel subfa 2e-07
2pnn_A273 Transient receptor potential cation channel subfa 7e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-13
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-07
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-04
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-04
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-04
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
 Score = 77.1 bits (191), Expect = 1e-17
 Identities = 26/126 (20%), Positives = 50/126 (39%), Gaps = 24/126 (19%)

Query: 47  DNSLMIPLHRAALEGDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQAL--- 103
               M  +     EG++  +R  +      L +   +G + LH A ++ RS   + L   
Sbjct: 2   SPEFMDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMR 61

Query: 104 ---VDEAKSHRKEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNK 160
              ++              ++  +T LHLA  +  + IV+ L++  ++      IN VN+
Sbjct: 62  GARINV------------MNRGDDTPLHLAASHGHRDIVQKLLQYKAD------INAVNE 103

Query: 161 QGQTAL 166
            G   L
Sbjct: 104 HGNVPL 109


>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.98
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.98
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.98
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.98
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.98
2etb_A256 Transient receptor potential cation channel subfam 99.98
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.97
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.97
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.97
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.96
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.96
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.93
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.92
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.91
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.89
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.89
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.88
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.87
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.87
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.87
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.85
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.8
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.79
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=100.00  E-value=1.4e-36  Score=225.35  Aligned_cols=159  Identities=26%  Similarity=0.377  Sum_probs=146.3

Q ss_pred             CHHHHHHhCCCHHHHHHHHhcCcchhhhhcCCCCcHHHHHHHhCCHHHHHHHHHhCchhhhhhccCCCcHHHHHHHcCCh
Q 037085           18 TTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIRALVSICPESLEKLTSNGETALHLAVKKSRS   97 (248)
Q Consensus        18 t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~~~g~t~lh~a~~~~~~   97 (248)
                      +.|+.||..|+.++|+.|++.|+++ +.+|..|.||||+|+..++.+++++|++.+ .+++.+|..|.||||+|+..|+.
T Consensus         6 ~~L~~Aa~~G~~~~v~~Ll~~Gadv-n~~d~~g~t~l~~a~~~~~~~~~~~ll~~g-ad~~~~d~~g~TpLh~A~~~g~~   83 (169)
T 4gpm_A            6 KRLIEAAENGNKDRVKDLIENGADV-NASDSDGRTPLHHAAENGHKEVVKLLISKG-ADVNAKDSDGRTPLHHAAENGHK   83 (169)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHTTCCT-TCCCTTSCCHHHHHHHTTCHHHHHHHHHTT-CCTTCCCTTSCCHHHHHHHTTCH
T ss_pred             HHHHHHHHcCCHHHHHHHHHCCCCC-CCcCCCCCCHHHHHHHcCCHHHHHHHHhcc-cchhhhccCCCCHHHHHHHcCCH
Confidence            3699999999999999999999998 889999999999999999999999999984 56889999999999999999999


Q ss_pred             HHHHHHHHHHhccccccccccccCCCCcHhHHHHhCCcHHHHHHHHhhcccccccccccccCCCCCCHHHHHHHcCCCch
Q 037085           98 DAFQALVDEAKSHRKEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLCNANSQDSV  177 (248)
Q Consensus        98 ~~~~~Ll~~~~~~~~~~~~~~~~~~g~t~Lh~A~~~~~~~~v~~Ll~~g~~~~~~~~~~~~~~~g~tpl~~a~~~~~~~~  177 (248)
                      +++++|+++|++      ++.+|..|+||||+|+..|+.+++++|+++|+      +++.+|..|+|||++|+..    +
T Consensus        84 ~~v~~Ll~~gad------vn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~ga------d~~~~d~~G~TpL~~A~~~----g  147 (169)
T 4gpm_A           84 EVVKLLISKGAD------VNAKDSDGRTPLHHAAENGHKEVVKLLISKGA------DVNTSDSDGRTPLDLAREH----G  147 (169)
T ss_dssp             HHHHHHHHTTCC------TTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTC------CTTCCCTTSCCHHHHHHHT----T
T ss_pred             HHHHHHHHCcCC------CCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCC------CccccCCCCCCHHHHHHHc----C
Confidence            999999999988      89999999999999999999999999999998      8999999999999999988    7


Q ss_pred             HHHHHHHHHHhhhhcCC
Q 037085          178 FKEIGWIIQRAVAQQSP  194 (248)
Q Consensus       178 ~~~i~~~L~~~g~~~~~  194 (248)
                      +.+++++|+++||++.-
T Consensus       148 ~~~iv~~Ll~~GA~ie~  164 (169)
T 4gpm_A          148 NEEVVKLLEKQGGWLEH  164 (169)
T ss_dssp             CHHHHHHHHTC------
T ss_pred             CHHHHHHHHHCCCCcCC
Confidence            89999999999998753



>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 248
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-12
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-11
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-08
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.001
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.001
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-05
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-07
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-06
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.004
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-05
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.001
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 63.5 bits (153), Expect = 2e-12
 Identities = 42/184 (22%), Positives = 69/184 (37%), Gaps = 14/184 (7%)

Query: 5   WPQLASIKNQRGETTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSD 64
           +   A+ ++ +G T +HL + +G A MV +         L  + S + PLH  A EG   
Sbjct: 220 YGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNL-GNKSGLTPLHLVAQEGHVP 278

Query: 65  VIRALVSICPESLEKLTSNGETALHLAVKKSRSDAFQALVDEAKSHRKEHLFTWKDKEGN 124
           V   L+      ++  T  G T LH+A         +         + +     K K G 
Sbjct: 279 VADVLIKHGVM-VDATTRMGYTPLHVASHYGNIKLVK------FLLQHQADVNAKTKLGY 331

Query: 125 TVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQGQTALQLCNANSQDSVFKEIGWI 184
           + LH A       IV LL++  ++       N V+  G T L +       SV   +  +
Sbjct: 332 SPLHQAAQQGHTDIVTLLLKNGAS------PNEVSSDGTTPLAIAKRLGYISVTDVLKVV 385

Query: 185 IQRA 188
               
Sbjct: 386 TDET 389


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.94
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.94
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.92
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.91
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.91
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.9
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.88
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.88
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.88
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.7e-33  Score=216.37  Aligned_cols=187  Identities=20%  Similarity=0.240  Sum_probs=172.5

Q ss_pred             cccCchhHhhhccCCCCHHHHHHhCCCHHHHHHHHhcCcchhhhhcCCCCcHHHHHHHhCCHHHHHHHHHhCchhhhhhc
Q 037085            2 ARLWPQLASIKNQRGETTMHLLSTDGDARMVRIFGENNRELCLEVDNSLMIPLHRAALEGDSDVIRALVSICPESLEKLT   81 (248)
Q Consensus         2 l~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~   81 (248)
                      |+..+..++.+|.+|+||||+|+..|+.++++++++.+... ...+..+.++++.++..++.+++++|++.+ .+++.+|
T Consensus        23 l~~~~~~~~~~D~~G~TpLh~Aa~~g~~e~~~~l~~~~~~~-~~~~~~~~~~~~~~~~~~~~~i~~~Ll~~~-~d~~~~d  100 (223)
T d1uoha_          23 ILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPV-NDKDDAGWSPLHIAASAGRDEIVKALLGKG-AQVNAVN  100 (223)
T ss_dssp             HHHCGGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCS-CCCCTTCCCHHHHHHHHTCHHHHHHHHHTT-CCTTCCC
T ss_pred             HHhCCCcCcCcCCCCCCHHHHHHHhhhhccccccccccccc-ccccccccccccccccccccchhHHHhccC-ceeEeeC
Confidence            55678889999999999999999999999999999998887 667778899999999999999999999985 4688899


Q ss_pred             cCCCcHHHHHHHcCChHHHHHHHHHHhccccccccccccCCCCcHhHHHHhCCcHHHHHHHHhhcccccccccccccCCC
Q 037085           82 SNGETALHLAVKKSRSDAFQALVDEAKSHRKEHLFTWKDKEGNTVLHLATLNKLKQIVELLIRENSNRRIMIRINTVNKQ  161 (248)
Q Consensus        82 ~~g~t~lh~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~g~t~Lh~A~~~~~~~~v~~Ll~~g~~~~~~~~~~~~~~~  161 (248)
                      ..|.||||+|+..++.+++++|+++|++      ++.++..|.||||+|+..++.+++++|++.+.      +++.+|..
T Consensus       101 ~~g~tpL~~A~~~~~~e~~~~Ll~~g~d------~~~~~~~~~t~L~~a~~~~~~~~~~~L~~~~~------~i~~~d~~  168 (223)
T d1uoha_         101 QNGCTPLHYAASKNRHEIAVMLLEGGAN------PDAKDHYEATAMHRAAAKGNLKMIHILLYYKA------STNIQDTE  168 (223)
T ss_dssp             TTCCCHHHHHHHHTCHHHHHHHHHTTCC------TTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTC------CSCCCCTT
T ss_pred             CCCCchhhHHHHcCCHHHHHHHHHCCCC------CCCcCCCCCccchhhhhcCCcchhhhhccccc------eeeeccCC
Confidence            9999999999999999999999999988      78899999999999999999999999999987      89999999


Q ss_pred             CCCHHHHHHHcCCCchHHHHHHHHHHhhhhcCCCCCCCCCcccccc
Q 037085          162 GQTALQLCNANSQDSVFKEIGWIIQRAVAQQSPQLPDAGSANVSWN  207 (248)
Q Consensus       162 g~tpl~~a~~~~~~~~~~~i~~~L~~~g~~~~~~~~~~~~~~~~~~  207 (248)
                      |.||||+|+..    ++.+++++|+++|++++..+..+.+ |++.+
T Consensus       169 g~TpL~~Aa~~----g~~~~v~~LL~~Gad~~~~d~~g~t-pl~~A  209 (223)
T d1uoha_         169 GNTPLHLACDE----ERVEEAKLLVSQGASIYIENKEEKT-PLQVA  209 (223)
T ss_dssp             CCCHHHHHHHT----TCHHHHHHHHHTTCCSCCCCTTSCC-HHHHC
T ss_pred             CCceecccccc----CcHHHHHHHHHCCCCCCCCCCCCCC-HHHHH
Confidence            99999999988    7889999999999999988877666 77766



>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure