Citrus Sinensis ID: 037089

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MKLPNSSPHDQSAGKDQQRPIEVFQPKASHDIGQSSGTNEDLHTQALKAFTTTSTNKWMAFEGESGSYPKIKVSDESNGRFFNEKKAVDVDRIFTGANIAERTAEWGLVVKSDVLGEGTFKAVNLRKPSGDGDRSKNSSERFTIDSTRTSEESERGAFPRVSEELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRNW
ccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccEEEccccccccEEEEEEccccccccccccccccccccccccHHHHHcccccccHHHHHHHHHHccccEEEEccccccccEEEEcHHHHHHHcccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHccEEEEcccccccccccEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHcccEEEEEEcccccccEEEEcHHHHHHHcccHHHHccccc
mklpnssphdqsagkdqqrpievfqpkashdigqssgtnedLHTQALKAFTTTstnkwmafegesgsypkikvsdesngrffnekkavdvdriftgaNIAERTAEWGLVvksdvlgegtfkavnlrkpsgdgdrsknsserftidstrtseesergafprVSEELKAALATLQQTfvvsdatkpdcpimyassgffsmtgysskevigrnw
mklpnssphdqsagkdqqrPIEVFQPKAShdigqssgtnedLHTQALKAFTTTSTNKWMAFegesgsypkikvsdesngrffnekkavdvdriftganiaertaewglvvksdvlgegtfkavnlrkpsgdgdrsknsserftidstrtseesergafPRVSEELKAALATLQQTfvvsdatkpdCPIMYASsgffsmtgysskevigrnw
MKLPNSSPHDQSAGKDQQRPIEVFQPKASHDIGQSSGTNEDLHTQALKAFTTTSTNKWMAFEGESGSYPKIKVSDESNGRFFNEKKAVDVDRIFTGANIAERTAEWGLVVKSDVLGEGTFKAVNLRKPSGDGDRSKNSSERFTIDSTRTSEESERGAFPRVSEELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRNW
*************************************************FT***TNKWMAF******************RFFNEKKAVDVDRIFTGANIAERTAEWGLVVKSDVLGEGTFKAV*******************************************AALATLQQTFVVSDATKPDCPIMYASSGFFSMTGY**********
**********************************************************************************************************GLVVKS***************************************************ELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRNW
*****************QRPIEVFQPKASHDIGQSSGTNEDLHTQALKAFTTTSTNKWMAFEGESGSYPKIKVSDESNGRFFNEKKAVDVDRIFTGANIAERTAEWGLVVKSDVLGEGTFKAVNLRK*********************************VSEELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSS********
*********************************************************************************************************WGLVVKSDVLGE*****************************************PRVSEELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRNW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLPNSSPHDQSAGKDQQRPIEVFQPKASHDIGQSSGTNEDLHTQALKAFTTTSTNKWMAFEGESGSYPKIKVSDESNGRFFNEKKAVDVDRIFTGANIAERTAEWGLVVKSDVLGEGTFKAVNLRKPSGDGDRSKNSSERFTIDSTRTSEESERGAFPRVSEELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRNW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query211 2.2.26 [Sep-21-2011]
P93025 915 Phototropin-2 OS=Arabidop no no 0.753 0.173 0.407 8e-27
O48963 996 Phototropin-1 OS=Arabidop no no 0.592 0.125 0.510 1e-25
Q2RBR1 921 Phototropin-1B OS=Oryza s yes no 0.473 0.108 0.527 1e-22
Q2QYY8 921 Phototropin-1A OS=Oryza s yes no 0.473 0.108 0.527 2e-22
Q9ST27 907 Phototropin-2 OS=Oryza sa no no 0.255 0.059 0.759 2e-19
O64511 399 Protein TWIN LOV 1 OS=Ara no no 0.236 0.125 0.42 1e-06
Q01371 1167 White collar 1 protein OS N/A no 0.241 0.043 0.450 1e-06
Q2NCA3 360 Blue-light-activated hist yes no 0.199 0.116 0.444 2e-06
Q5Z8K3 630 Adagio-like protein 1 OS= no no 0.165 0.055 0.571 4e-06
Q4ZSY3 534 Blue-light-activated prot yes no 0.213 0.084 0.444 6e-06
>sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 Back     alignment and function desciption
 Score =  120 bits (300), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 84/206 (40%), Positives = 110/206 (53%), Gaps = 47/206 (22%)

Query: 7   SPHDQSAGKDQQRPIEVFQPKASHDIGQSSGTNEDLHTQALKAFTTTSTNKWMAFEGESG 66
           SP + +    ++R +E+F P +     ++ G+        L      S++KWM F+    
Sbjct: 9   SPLNDAESLSERRSLEIFNPSSGK---ETHGSTSSSSKPPLDGNNKGSSSKWMEFQD--- 62

Query: 67  SYPKIKVSDESNGRFFNEKKAVDVDRIFTGANIAERTAEWGL-VVKSDVLGEG-TFKAVN 124
                                         A I ERTAEWGL  VK D   +G +FK   
Sbjct: 63  -----------------------------SAKITERTAEWGLSAVKPDSGDDGISFKL-- 91

Query: 125 LRKPSGDGDRSKNSSERFTIDSTRTSEESERGAFPRVSEELKAALATLQQTFVVSDATKP 184
               S + +RSKN     +  S+  S  SE GAFPRVS+ELK AL+TLQQTFVVSDAT+P
Sbjct: 92  ----SSEVERSKN----MSRRSSEESTSSESGAFPRVSQELKTALSTLQQTFVVSDATQP 143

Query: 185 DCPIMYASSGFFSMTGYSSKEVIGRN 210
            CPI+YASSGFF+MTGYSSKE++GRN
Sbjct: 144 HCPIVYASSGFFTMTGYSSKEIVGRN 169
Protein kinase that acts as a blue-light photoreceptor in a signal-transduction pathway for photo-induced movements. Mediates calcium spiking of extra- and intracellular origins in response to blue light. Involved in hypocotyl phototropism. Contributes to the chloroplast accumulation in low blue light and mediates their translocation (avoidance response) at high fluence. Regulates stomata opening and photomorphogenesis response of leaf tissue. Not involved in hypocotyl elongation inhibition, anthocyanin accumulation or cotyledon opening.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 Back     alignment and function description
>sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 Back     alignment and function description
>sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 Back     alignment and function description
>sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 Back     alignment and function description
>sp|O64511|TLOV1_ARATH Protein TWIN LOV 1 OS=Arabidopsis thaliana GN=TLP1 PE=1 SV=2 Back     alignment and function description
>sp|Q01371|WC1_NEUCR White collar 1 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-1 PE=2 SV=2 Back     alignment and function description
>sp|Q2NCA3|LVHK1_ERYLH Blue-light-activated histidine kinase 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=ELI_02980 PE=1 SV=1 Back     alignment and function description
>sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 Back     alignment and function description
>sp|Q4ZSY3|LOVHK_PSEU2 Blue-light-activated protein OS=Pseudomonas syringae pv. syringae (strain B728a) GN=Psyr_2700 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
255546656 984 serine/threonine protein kinase, putativ 0.924 0.198 0.597 4e-51
225428366 1001 PREDICTED: phototropin-2 [Vitis vinifera 0.919 0.193 0.536 2e-42
297744446 979 unnamed protein product [Vitis vinifera] 0.843 0.181 0.532 6e-42
356559155 990 PREDICTED: phototropin-2-like [Glycine m 0.943 0.201 0.472 1e-40
113911589 952 phototropin-2 [Solanum lycopersicum] 0.838 0.185 0.492 1e-40
350537331 952 phototropin-2 [Solanum lycopersicum] gi| 0.838 0.185 0.492 2e-40
60099458 996 phototropin [Phaseolus vulgaris] 0.957 0.202 0.481 2e-40
356526675 996 PREDICTED: phototropin-2-like [Glycine m 0.962 0.203 0.466 5e-39
224102759 923 predicted protein [Populus trichocarpa] 0.549 0.125 0.699 6e-37
357517333 941 Phototropin [Medicago truncatula] gi|355 0.668 0.149 0.585 4e-36
>gi|255546656|ref|XP_002514387.1| serine/threonine protein kinase, putative [Ricinus communis] gi|223546484|gb|EEF47983.1| serine/threonine protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 129/216 (59%), Positives = 152/216 (70%), Gaps = 21/216 (9%)

Query: 9   HDQSAGKDQQRPIEVFQPKASHDIGQSSGTNEDLHTQA-----LKAFTTTST----NKWM 59
           +DQS  ++    IEVF P AS   GQ   TN      A     L+ F+++S+    NKWM
Sbjct: 16  NDQSINQELTS-IEVFAPAASSIAGQPRPTNTSQIAGAKEGGSLQTFSSSSSRAPPNKWM 74

Query: 60  AFEGESGSYPKIKVSDES----NGRFFNEKKAVDVDRIFTGANIAERTAEWGLVVKSDVL 115
           AF G+ GS   +  SD +    N  F N        ++ T A+IAERTAEWGLVVKSDV 
Sbjct: 75  AF-GKEGS--SVTSSDANRATDNNSFTNFNGKSISQQVLTEASIAERTAEWGLVVKSDV- 130

Query: 116 GEGTFKAVNLRKPSGDGDRSK-NSSERFTIDSTRTSEESERGAFPRVSEELKAALATLQQ 174
           GEG+FKA+N+   +GDGDRSK NS ERF +DSTRTSEESE GAFPRVS+ELK AL++LQQ
Sbjct: 131 GEGSFKAINMS--TGDGDRSKKNSLERFAVDSTRTSEESEAGAFPRVSQELKDALSSLQQ 188

Query: 175 TFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRN 210
           TFVVSDATKPDCPIMYASSGFF+MTGYSSKEVIGRN
Sbjct: 189 TFVVSDATKPDCPIMYASSGFFTMTGYSSKEVIGRN 224

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225428366|ref|XP_002280118.1| PREDICTED: phototropin-2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297744446|emb|CBI37708.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356559155|ref|XP_003547866.1| PREDICTED: phototropin-2-like [Glycine max] Back     alignment and taxonomy information
>gi|113911589|gb|ABI48276.1| phototropin-2 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|350537331|ref|NP_001234289.1| phototropin-2 [Solanum lycopersicum] gi|154000865|gb|ABS57001.1| phototropin-2 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|60099458|dbj|BAD89968.1| phototropin [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|356526675|ref|XP_003531942.1| PREDICTED: phototropin-2-like [Glycine max] Back     alignment and taxonomy information
>gi|224102759|ref|XP_002312790.1| predicted protein [Populus trichocarpa] gi|222849198|gb|EEE86745.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357517333|ref|XP_003628955.1| Phototropin [Medicago truncatula] gi|355522977|gb|AET03431.1| Phototropin [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
TAIR|locus:2155821 915 PHOT2 "phototropin 2" [Arabido 0.492 0.113 0.629 2.2e-31
TAIR|locus:2102674 996 PHOT1 "phototropin 1" [Arabido 0.592 0.125 0.510 2.3e-26
UNIPROTKB|Q8H935 963 Vfphot1a "Phototropin" [Vicia 0.881 0.193 0.405 9.5e-26
UNIPROTKB|Q2QYY8 921 PHOT1A "Phototropin-1A" [Oryza 0.473 0.108 0.536 4.5e-21
UNIPROTKB|Q2RBR1 921 PHOT1B "Phototropin-1B" [Oryza 0.473 0.108 0.536 4.5e-21
UNIPROTKB|Q9ST27 907 PHOT2 "Phototropin-2" [Oryza s 0.374 0.087 0.569 1.5e-18
TAIR|locus:2058852 399 PLPB "PAS/LOV PROTEIN C" [Arab 0.312 0.165 0.439 1.5e-05
UNIPROTKB|G4N7Q5 1101 MGG_03538 "Uncharacterized pro 0.241 0.046 0.450 3.7e-05
UNIPROTKB|G4NCS4225 MGG_01041 "Cellulose signaling 0.161 0.151 0.558 0.0007
TAIR|locus:2155821 PHOT2 "phototropin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 323 (118.8 bits), Expect = 2.2e-31, Sum P(2) = 2.2e-31
 Identities = 73/116 (62%), Positives = 86/116 (74%)

Query:    97 ANIAERTAEWGL-VVKSDVLGEG-TFKAVNLRKPSGDGDRSKNSSERFTIDSTRTSEESE 154
             A I ERTAEWGL  VK D   +G +FK       S + +RSKN S R + +ST     SE
Sbjct:    64 AKITERTAEWGLSAVKPDSGDDGISFKL------SSEVERSKNMSRRSSEEST----SSE 113

Query:   155 RGAFPRVSEELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRN 210
              GAFPRVS+ELK AL+TLQQTFVVSDAT+P CPI+YASSGFF+MTGYSSKE++GRN
Sbjct:   114 SGAFPRVSQELKTALSTLQQTFVVSDATQPHCPIVYASSGFFTMTGYSSKEIVGRN 169
GO:0000155 "phosphorelay sensor kinase activity" evidence=IEA
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;IMP;IDA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0004871 "signal transducer activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0009638 "phototropism" evidence=IGI;IMP
GO:0010118 "stomatal movement" evidence=IGI;IMP
GO:0009902 "chloroplast relocation" evidence=RCA;TAS
GO:0016020 "membrane" evidence=ISS
GO:0009637 "response to blue light" evidence=IGI;RCA
GO:0010181 "FMN binding" evidence=IDA;TAS
GO:0046777 "protein autophosphorylation" evidence=RCA;TAS
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0009882 "blue light photoreceptor activity" evidence=IMP
GO:0010362 "negative regulation of anion channel activity by blue light" evidence=IMP
GO:0042802 "identical protein binding" evidence=IPI
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0010114 "response to red light" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0010218 "response to far red light" evidence=RCA
GO:0016556 "mRNA modification" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0034660 "ncRNA metabolic process" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
GO:0042793 "transcription from plastid promoter" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:2102674 PHOT1 "phototropin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8H935 Vfphot1a "Phototropin" [Vicia faba (taxid:3906)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QYY8 PHOT1A "Phototropin-1A" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q2RBR1 PHOT1B "Phototropin-1B" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ST27 PHOT2 "Phototropin-2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2058852 PLPB "PAS/LOV PROTEIN C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N7Q5 MGG_03538 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|G4NCS4 MGG_01041 "Cellulose signaling associated protein ENVOY" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00036312001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (1001 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
PRK13559 361 PRK13559, PRK13559, hypothetical protein; Provisio 2e-10
PRK13557 540 PRK13557, PRK13557, histidine kinase; Provisional 7e-09
PRK13558 665 PRK13558, PRK13558, bacterio-opsin activator; Prov 2e-05
smart0009167 smart00091, PAS, PAS domain 5e-04
>gnl|CDD|237427 PRK13559, PRK13559, hypothetical protein; Provisional Back     alignment and domain information 
 Score = 58.7 bits (142), Expect = 2e-10
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 132 GDRSKNSSERFTIDSTRTSEESERGAFPRVSEELKAALATLQQT---FVVSDATKPDCPI 188
           GD    SS+ F+ D    +   +   F   S  L      ++QT     ++D  +PD PI
Sbjct: 11  GDLPAASSKAFSADRKELAAIHDPRDFRGASGRL--FEQAMEQTRMAMCITDPHQPDLPI 68

Query: 189 MYASSGFFSMTGYSSKEVIGRN 210
           + A+  F  +TGY+++EV+GRN
Sbjct: 69  VLANQAFLDLTGYAAEEVVGRN 90

Length = 361
>gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|237426 PRK13558, PRK13558, bacterio-opsin activator; Provisional Back     alignment and domain information
>gnl|CDD|214512 smart00091, PAS, PAS domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 211
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 98.62
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 98.28
PRK13557 540 histidine kinase; Provisional 98.06
PF1318864 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A. 97.98
PRK13559 361 hypothetical protein; Provisional 97.83
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 97.8
TIGR02040 442 PpsR-CrtJ transcriptional regulator PpsR. This mod 97.8
TIGR00229124 sensory_box PAS domain S-box. The PAS domain was p 97.74
PRK10060 663 RNase II stability modulator; Provisional 97.55
PRK13560 807 hypothetical protein; Provisional 97.52
PRK11006 430 phoR phosphate regulon sensor protein; Provisional 97.42
TIGR02040 442 PpsR-CrtJ transcriptional regulator PpsR. This mod 97.36
PRK11091 779 aerobic respiration control sensor protein ArcB; P 97.3
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 97.1
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 96.87
PRK09776 1092 putative diguanylate cyclase; Provisional 96.78
PRK13558 665 bacterio-opsin activator; Provisional 96.74
PRK09776 1092 putative diguanylate cyclase; Provisional 96.71
smart0009167 PAS PAS domain. PAS motifs appear in archaea, euba 96.69
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mech 96.52
PRK11360 607 sensory histidine kinase AtoS; Provisional 96.52
KOG1229 775 consensus 3'5'-cyclic nucleotide phosphodiesterase 96.47
KOG0501 971 consensus K+-channel KCNQ [Inorganic ion transport 96.44
PF12860115 PAS_7: PAS fold 96.33
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 96.22
PRK13560 807 hypothetical protein; Provisional 95.87
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 95.61
PRK11086 542 sensory histidine kinase DcuS; Provisional 95.51
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 95.45
PRK15053 545 dpiB sensor histidine kinase DpiB; Provisional 95.43
TIGR02938 494 nifL_nitrog nitrogen fixation negative regulator N 94.86
PF13596106 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. 91.24
PRK09959 1197 hybrid sensory histidine kinase in two-component r 88.74
TIGR02373124 photo_yellow photoactive yellow protein. Members o 85.92
COG3283 511 TyrR Transcriptional regulator of aromatic amino a 85.15
COG5002 459 VicK Signal transduction histidine kinase [Signal 82.96
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information 
Probab=98.62  E-value=5.4e-08  Score=69.49  Aligned_cols=45  Identities=31%  Similarity=0.508  Sum_probs=40.9

Q ss_pred             HHHHHHHHhcCCeEEEEcCCCCCCCEEEEcHHHHHhhCCCcccccCCC
Q 037089          163 EELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRN  210 (211)
Q Consensus       163 rlL~~aLdss~dgIvItDa~~~D~pIVYVN~AFerMTGYS~eELIGRN  210 (211)
                      +.++.++++++++|++.|.   ++.|+|+|++|++|+||+.++++|++
T Consensus         1 e~~~~i~~~~~~~i~~~d~---~g~I~~~N~a~~~l~g~~~~~~~g~~   45 (113)
T PF00989_consen    1 ERYRAILENSPDGIFVIDE---DGRILYVNQAAEELLGYSREELIGKS   45 (113)
T ss_dssp             HHHHHHHHCSSSEEEEEET---TSBEEEECHHHHHHHSS-HHHHTTSB
T ss_pred             CHHHHHHhcCCceEEEEeC---cCeEEEECHHHHHHHccCHHHHcCCc
Confidence            3578999999999999998   77899999999999999999999986

PAS domains appear in archaea, bacteria and eukaryotes. Several PAS-domain proteins are known to detect their signal by way of an associated cofactor. Haeme, flavin, and a 4-hydroxycinnamyl chromophore are used in different proteins. The PAS domain was named after three proteins that it occurs in: Per- period circadian protein Arnt- Ah receptor nuclear translocator protein Sim- single-minded protein. PAS domains are often associated with PAC domains IPR001610 from INTERPRO. It appears that these domains are directly linked, and that together they form the conserved 3D PAS fold. The division between the PAS and PAC domains is caused by major differences in sequences in the region connecting these two motifs []. In human PAS kinase, this region has been shown to be very flexible, and adopts different conformations depending on the bound ligand []. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels [].; GO: 0006355 regulation of transcription, DNA-dependent; PDB: 2GJ3_A 4F3L_B 1XFN_A 1OTD_A 2PYR_A 1KOU_A 1XFQ_A 2ZOI_A 2ZOH_A 1OTA_A ....
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PF13188 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>KOG1229 consensus 3'5'-cyclic nucleotide phosphodiesterases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12860 PAS_7: PAS fold Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR02373 photo_yellow photoactive yellow protein Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
2z6d_A130 Crystal Structure Of Lov1 Domain Of Phototropin2 Fr 6e-22
2z6c_A129 Crystal Structure Of Lov1 Domain Of Phototropin1 Fr 2e-20
1n9l_A109 Crystal Structure Of The Phot-lov1 Domain From Chla 9e-11
3ue6_A166 The Dark Structure Of The Blue-light Photoreceptor 1e-09
3ulf_A170 The Light State Structure Of The Blue-light Photore 1e-09
2v0u_A146 N- And C-terminal Helices Of Oat Lov2 (404-546) Are 1e-06
4ees_A115 Crystal Structure Of Ilov Length = 115 1e-06
2v1a_A144 N- And C-Terminal Helices Of Oat Lov2 (404-546) Are 1e-06
4eeu_A118 Crystal Structure Of Philov2.1 Length = 118 1e-06
2wkr_A 332 Structure Of A Photoactivatable Rac1 Containing The 4e-06
2wkq_A 332 Structure Of A Photoactivatable Rac1 Containing The 4e-06
2wkp_A 332 Structure Of A Photoactivatable Rac1 Containing Lov 4e-06
4eer_A115 Crystal Structure Of Lov2 Domain Of Arabidopsis Tha 4e-06
4eep_A115 Crystal Structure Of Lov2 Domain Of Arabidopsis Tha 5e-06
3hjk_A154 2.0 Angstrom Structure Of The Ile74val Variant Of V 2e-05
3is2_A154 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic 2e-05
3is2_B154 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic 2e-05
3d72_A149 1.65 Angstrom Crystal Structure Of The Cys71val Var 2e-05
2pd8_A149 1.8 Angstrom Crystal Structure Of The Cys71ser Muta 2e-05
3rh8_B148 Crystal Structure Of The Light-State Dimer Of Funga 3e-05
2pd7_A149 2.0 Angstrom Crystal Structure Of The Fungal Blue-L 3e-05
3hji_A154 1.8 Angstrom Crystal Structure Of The I74v:i85v Var 3e-05
2pr5_A132 Structural Basis For Light-dependent Signaling In T 1e-04
1g28_A104 Structure Of A Flavin-Binding Domain, Lov2, From Th 3e-04
3t50_A128 X-Ray Structure Of The Lov Domain From The Lov-Hk S 8e-04
>pdb|2Z6D|A Chain A, Crystal Structure Of Lov1 Domain Of Phototropin2 From Arabidopsis Thaliana Length = 130 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (249), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 51/53 (96%)
Query: 158 FPRVSEELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRN 210
           FPRVS+ELK AL+TLQQTFVVSDAT+P CPI+YASSGFF+MTGYSSKE++GRN
Sbjct: 1   FPRVSQELKTALSTLQQTFVVSDATQPHCPIVYASSGFFTMTGYSSKEIVGRN 53
>pdb|2Z6C|A Chain A, Crystal Structure Of Lov1 Domain Of Phototropin1 From Arabidopsis Thaliana Length = 129 Back     alignment and structure
>pdb|1N9L|A Chain A, Crystal Structure Of The Phot-lov1 Domain From Chlamydomonas Reinhardtii In The Dark State. Length = 109 Back     alignment and structure
>pdb|3UE6|A Chain A, The Dark Structure Of The Blue-light Photoreceptor Aureochrome1 Lov Length = 166 Back     alignment and structure
>pdb|3ULF|A Chain A, The Light State Structure Of The Blue-light Photoreceptor Aureochrome1 Lov Length = 170 Back     alignment and structure
>pdb|2V0U|A Chain A, N- And C-terminal Helices Of Oat Lov2 (404-546) Are Involved In Light-induced Signal Transduction (cryo Dark Structure Of Lov2 (404-546)) Length = 146 Back     alignment and structure
>pdb|4EES|A Chain A, Crystal Structure Of Ilov Length = 115 Back     alignment and structure
>pdb|2V1A|A Chain A, N- And C-Terminal Helices Of Oat Lov2 (404-546) Are Involved In Light-Induced Signal Transduction (Room Temperature (293k) Dark Structure Of Lov2 (404-546)) Length = 144 Back     alignment and structure
>pdb|4EEU|A Chain A, Crystal Structure Of Philov2.1 Length = 118 Back     alignment and structure
>pdb|2WKR|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450m Mutant Length = 332 Back     alignment and structure
>pdb|2WKQ|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450a Mutant Length = 332 Back     alignment and structure
>pdb|2WKP|A Chain A, Structure Of A Photoactivatable Rac1 Containing Lov2 Wildtype Length = 332 Back     alignment and structure
>pdb|4EER|A Chain A, Crystal Structure Of Lov2 Domain Of Arabidopsis Thaliana Phototropin 2 C426a Mutant Length = 115 Back     alignment and structure
>pdb|4EEP|A Chain A, Crystal Structure Of Lov2 Domain Of Arabidopsis Thaliana Phototropin 2 Length = 115 Back     alignment and structure
>pdb|3HJK|A Chain A, 2.0 Angstrom Structure Of The Ile74val Variant Of Vivid (Vvd). Length = 154 Back     alignment and structure
>pdb|3IS2|A Chain A, 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic Acid Form Of Vivid Length = 154 Back     alignment and structure
>pdb|3IS2|B Chain B, 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic Acid Form Of Vivid Length = 154 Back     alignment and structure
>pdb|3D72|A Chain A, 1.65 Angstrom Crystal Structure Of The Cys71val Variant In The Fungal Photoreceptor Vvd Length = 149 Back     alignment and structure
>pdb|2PD8|A Chain A, 1.8 Angstrom Crystal Structure Of The Cys71ser Mutant Of Vivid Length = 149 Back     alignment and structure
>pdb|3RH8|B Chain B, Crystal Structure Of The Light-State Dimer Of Fungal Blue-Light Photoreceptor Vivid Length = 148 Back     alignment and structure
>pdb|2PD7|A Chain A, 2.0 Angstrom Crystal Structure Of The Fungal Blue-Light Photoreceptor Vivid Length = 149 Back     alignment and structure
>pdb|3HJI|A Chain A, 1.8 Angstrom Crystal Structure Of The I74v:i85v Variant Of Vivid (Vvd). Length = 154 Back     alignment and structure
>pdb|2PR5|A Chain A, Structural Basis For Light-dependent Signaling In The Dimeric Lov Photosensor Ytva (dark Structure) Length = 132 Back     alignment and structure
>pdb|1G28|A Chain A, Structure Of A Flavin-Binding Domain, Lov2, From The Chimeric PhytochromePHOTOTROPIN PHOTORECEPTOR PHY3 Length = 104 Back     alignment and structure
>pdb|3T50|A Chain A, X-Ray Structure Of The Lov Domain From The Lov-Hk Sensory Protein From Brucella Abortus (Dark State). Length = 128 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 3e-22
3p7n_A 258 Sensor histidine kinase; LOV domain, light-activat 3e-17
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 8e-17
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 1e-16
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 2e-16
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 4e-16
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 4e-16
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 6e-16
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 1e-15
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 7e-15
1byw_A110 Protein (human ERG potassium channel); PAS domain, 1e-14
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 2e-14
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 1e-12
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Length = 130 Back     alignment and structure
 Score = 86.8 bits (216), Expect = 3e-22
 Identities = 44/53 (83%), Positives = 51/53 (96%)

Query: 158 FPRVSEELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRN 210
           FPRVS+ELK AL+TLQQTFVVSDAT+P CPI+YASSGFF+MTGYSSKE++GRN
Sbjct: 1   FPRVSQELKTALSTLQQTFVVSDATQPHCPIVYASSGFFTMTGYSSKEIVGRN 53
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Length = 258 Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Length = 109 Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Length = 166 Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Length = 149 Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Length = 146 Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Length = 115 Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Length = 162 Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Length = 138 Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Length = 128 Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Length = 110 Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Length = 132 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
2r78_A117 Sensor protein; sensory box sensor histidine kinas 98.89
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 98.86
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 98.76
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 98.75
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 98.7
3olo_A118 Two-component sensor histidine kinase; structural 98.69
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 98.61
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 98.49
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 98.49
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 98.45
3p7n_A 258 Sensor histidine kinase; LOV domain, light-activat 98.44
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 98.42
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 98.4
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 98.4
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 98.4
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 98.36
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 98.35
3b33_A115 Sensor protein; structural genomics, PAS domain, n 98.32
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 98.31
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 98.3
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 98.27
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 98.23
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 98.21
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 98.21
3vol_A 233 Aerotaxis transducer AER2; heme, oxygen sensor pro 98.21
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 98.17
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, stru 98.17
1nwz_A125 PYP, photoactive yellow protein; PAS, LOV, GAF, do 98.15
1byw_A110 Protein (human ERG potassium channel); PAS domain, 98.13
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 98.12
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 98.12
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 98.08
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 98.08
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 98.08
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 98.06
1mzu_A129 PPR; photoactive yellow protein, PAS, PYP, signali 98.05
3eeh_A125 Putative light and redox sensing histidine kinase; 98.03
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 98.01
3mjq_A126 Uncharacterized protein; NESG, structural genomics 97.99
3nja_A125 Probable ggdef family protein; structural genomics 97.99
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 97.99
3kx0_X 185 Uncharacterized protein RV1364C/MT1410; PAS domain 97.95
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 97.94
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 97.79
2qkp_A151 Uncharacterized protein; structural genomics, unkn 97.66
3icy_A118 Sensor protein; sensory box histidine kinase/respo 97.51
3mr0_A142 Sensory box histidine kinase/response regulator; P 97.3
4f3l_A 361 Mclock, circadian locomoter output cycles protein 97.02
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 97.01
3cax_A369 Uncharacterized protein PF0695; structural genomic 96.95
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 96.8
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 96.49
4f3l_A361 Mclock, circadian locomoter output cycles protein 95.29
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 95.13
3rty_A 339 Period circadian protein; PAS domain, signalling, 94.62
2ykf_A305 Pdtas, probable sensor histidine kinase pdtas; tra 93.42
4dj3_A 317 Period circadian protein homolog 3; PAS domain, ci 93.49
4dj2_A 320 Period circadian protein homolog 1; PAS domains, c 93.22
3gdi_A 309 Period circadian protein homolog 2; tandem PAS dom 93.11
4dj2_A 320 Period circadian protein homolog 1; PAS domains, c 92.85
3gdi_A 309 Period circadian protein homolog 2; tandem PAS dom 91.64
4dj3_A 317 Period circadian protein homolog 3; PAS domain, ci 90.49
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
Probab=98.89  E-value=2.7e-09  Score=76.57  Aligned_cols=50  Identities=16%  Similarity=0.232  Sum_probs=45.4

Q ss_pred             chhhHHHHHHHHHhcCCeEEEEcCCCCCCCEEEEcHHHHHhhCCCcccccCCC
Q 037089          158 FPRVSEELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRN  210 (211)
Q Consensus       158 l~rlsrlL~~aLdss~dgIvItDa~~~D~pIVYVN~AFerMTGYS~eELIGRN  210 (211)
                      +....+.+..++++++++|+++|.   ++.|+|||++|++|+||+.+|++|++
T Consensus         6 l~~se~~~~~l~e~~~d~i~~~d~---~g~i~~vN~a~~~l~Gy~~~el~g~~   55 (117)
T 2r78_A            6 LYFQSNAYRALFEHAIDGIFIMDA---EGHYLDVNPAICSAIGYTRDEFLALD   55 (117)
T ss_dssp             HHHHHHHHHHHHHHCSSEEEEECT---TSBEEEECHHHHHHHCCCHHHHTTCB
T ss_pred             HHHhHHHHHHHHhcCCceEEEECC---CCCEEEecHHHHHHHCcCHHHHcCCC
Confidence            556667889999999999999998   67899999999999999999999985
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} Back     alignment and structure
>1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 211
d1n9la_109 d.110.3.6 (A:) Putative blue light receptor, phot- 1e-11
d1jnua_104 d.110.3.6 (A:) Photoreceptor phy3 flavin-binding d 5e-10
d1bywa_110 d.110.3.6 (A:) Erg potassium channel, N-terminal d 9e-10
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 109 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: Flavin-binding PAS domain
domain: Putative blue light receptor, phot-lov1 domain
species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]

 Score = 57.2 bits (137), Expect = 1e-11
 Identities = 25/40 (62%), Positives = 32/40 (80%)

Query: 172 LQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRNW 211
           L+ TFVV+DAT PDCP++YAS GF++MTGY   EV+G N 
Sbjct: 2   LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNC 41
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Length = 104 Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 98.96
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 98.85
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 98.83
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 98.78
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 98.65
d1mzua_110 PYP domain of sensor histidine kinase Ppr {Rhodosp 98.63
d1nwza_125 Photoactive yellow protein, PYP {Ectothiorhodospir 98.55
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 98.19
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 97.38
d2oola2114 Sensor protein PhyB2 {Rhodopseudomonas palustris [ 93.01
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 92.8
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: Flavin-binding PAS domain
domain: Putative blue light receptor, phot-lov1 domain
species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]

Probab=98.96  E-value=2e-10  Score=82.31  Aligned_cols=40  Identities=63%  Similarity=1.183  Sum_probs=37.1

Q ss_pred             cCCeEEEEcCCCCCCCEEEEcHHHHHhhCCCcccccCCCC
Q 037089          172 LQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRNW  211 (211)
Q Consensus       172 s~dgIvItDa~~~D~pIVYVN~AFerMTGYS~eELIGRNc  211 (211)
                      +.++|+|+|+..+|++|+|||++|++|+||+.+|++|+++
T Consensus         2 i~~~~vi~Da~~pdg~Ii~vN~a~~~~~Gy~~~El~G~~~   41 (109)
T d1n9la_           2 LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNC   41 (109)
T ss_dssp             CSCEEEEEETTSTTCCEEEECHHHHHHHCCCHHHHTTSCG
T ss_pred             ccceEEEEeCCCCCCeEEEEcHHHHHHHCcCHHHHcCCcc
Confidence            4689999999878999999999999999999999999974
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Back     information, alignment and structure
>d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure