Citrus Sinensis ID: 037089
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| 255546656 | 984 | serine/threonine protein kinase, putativ | 0.924 | 0.198 | 0.597 | 4e-51 | |
| 225428366 | 1001 | PREDICTED: phototropin-2 [Vitis vinifera | 0.919 | 0.193 | 0.536 | 2e-42 | |
| 297744446 | 979 | unnamed protein product [Vitis vinifera] | 0.843 | 0.181 | 0.532 | 6e-42 | |
| 356559155 | 990 | PREDICTED: phototropin-2-like [Glycine m | 0.943 | 0.201 | 0.472 | 1e-40 | |
| 113911589 | 952 | phototropin-2 [Solanum lycopersicum] | 0.838 | 0.185 | 0.492 | 1e-40 | |
| 350537331 | 952 | phototropin-2 [Solanum lycopersicum] gi| | 0.838 | 0.185 | 0.492 | 2e-40 | |
| 60099458 | 996 | phototropin [Phaseolus vulgaris] | 0.957 | 0.202 | 0.481 | 2e-40 | |
| 356526675 | 996 | PREDICTED: phototropin-2-like [Glycine m | 0.962 | 0.203 | 0.466 | 5e-39 | |
| 224102759 | 923 | predicted protein [Populus trichocarpa] | 0.549 | 0.125 | 0.699 | 6e-37 | |
| 357517333 | 941 | Phototropin [Medicago truncatula] gi|355 | 0.668 | 0.149 | 0.585 | 4e-36 |
| >gi|255546656|ref|XP_002514387.1| serine/threonine protein kinase, putative [Ricinus communis] gi|223546484|gb|EEF47983.1| serine/threonine protein kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 206 bits (525), Expect = 4e-51, Method: Compositional matrix adjust.
Identities = 129/216 (59%), Positives = 152/216 (70%), Gaps = 21/216 (9%)
Query: 9 HDQSAGKDQQRPIEVFQPKASHDIGQSSGTNEDLHTQA-----LKAFTTTST----NKWM 59
+DQS ++ IEVF P AS GQ TN A L+ F+++S+ NKWM
Sbjct: 16 NDQSINQELTS-IEVFAPAASSIAGQPRPTNTSQIAGAKEGGSLQTFSSSSSRAPPNKWM 74
Query: 60 AFEGESGSYPKIKVSDES----NGRFFNEKKAVDVDRIFTGANIAERTAEWGLVVKSDVL 115
AF G+ GS + SD + N F N ++ T A+IAERTAEWGLVVKSDV
Sbjct: 75 AF-GKEGS--SVTSSDANRATDNNSFTNFNGKSISQQVLTEASIAERTAEWGLVVKSDV- 130
Query: 116 GEGTFKAVNLRKPSGDGDRSK-NSSERFTIDSTRTSEESERGAFPRVSEELKAALATLQQ 174
GEG+FKA+N+ +GDGDRSK NS ERF +DSTRTSEESE GAFPRVS+ELK AL++LQQ
Sbjct: 131 GEGSFKAINMS--TGDGDRSKKNSLERFAVDSTRTSEESEAGAFPRVSQELKDALSSLQQ 188
Query: 175 TFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRN 210
TFVVSDATKPDCPIMYASSGFF+MTGYSSKEVIGRN
Sbjct: 189 TFVVSDATKPDCPIMYASSGFFTMTGYSSKEVIGRN 224
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225428366|ref|XP_002280118.1| PREDICTED: phototropin-2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297744446|emb|CBI37708.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356559155|ref|XP_003547866.1| PREDICTED: phototropin-2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|113911589|gb|ABI48276.1| phototropin-2 [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|350537331|ref|NP_001234289.1| phototropin-2 [Solanum lycopersicum] gi|154000865|gb|ABS57001.1| phototropin-2 [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|60099458|dbj|BAD89968.1| phototropin [Phaseolus vulgaris] | Back alignment and taxonomy information |
|---|
| >gi|356526675|ref|XP_003531942.1| PREDICTED: phototropin-2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224102759|ref|XP_002312790.1| predicted protein [Populus trichocarpa] gi|222849198|gb|EEE86745.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357517333|ref|XP_003628955.1| Phototropin [Medicago truncatula] gi|355522977|gb|AET03431.1| Phototropin [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| TAIR|locus:2155821 | 915 | PHOT2 "phototropin 2" [Arabido | 0.492 | 0.113 | 0.629 | 2.2e-31 | |
| TAIR|locus:2102674 | 996 | PHOT1 "phototropin 1" [Arabido | 0.592 | 0.125 | 0.510 | 2.3e-26 | |
| UNIPROTKB|Q8H935 | 963 | Vfphot1a "Phototropin" [Vicia | 0.881 | 0.193 | 0.405 | 9.5e-26 | |
| UNIPROTKB|Q2QYY8 | 921 | PHOT1A "Phototropin-1A" [Oryza | 0.473 | 0.108 | 0.536 | 4.5e-21 | |
| UNIPROTKB|Q2RBR1 | 921 | PHOT1B "Phototropin-1B" [Oryza | 0.473 | 0.108 | 0.536 | 4.5e-21 | |
| UNIPROTKB|Q9ST27 | 907 | PHOT2 "Phototropin-2" [Oryza s | 0.374 | 0.087 | 0.569 | 1.5e-18 | |
| TAIR|locus:2058852 | 399 | PLPB "PAS/LOV PROTEIN C" [Arab | 0.312 | 0.165 | 0.439 | 1.5e-05 | |
| UNIPROTKB|G4N7Q5 | 1101 | MGG_03538 "Uncharacterized pro | 0.241 | 0.046 | 0.450 | 3.7e-05 | |
| UNIPROTKB|G4NCS4 | 225 | MGG_01041 "Cellulose signaling | 0.161 | 0.151 | 0.558 | 0.0007 |
| TAIR|locus:2155821 PHOT2 "phototropin 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 323 (118.8 bits), Expect = 2.2e-31, Sum P(2) = 2.2e-31
Identities = 73/116 (62%), Positives = 86/116 (74%)
Query: 97 ANIAERTAEWGL-VVKSDVLGEG-TFKAVNLRKPSGDGDRSKNSSERFTIDSTRTSEESE 154
A I ERTAEWGL VK D +G +FK S + +RSKN S R + +ST SE
Sbjct: 64 AKITERTAEWGLSAVKPDSGDDGISFKL------SSEVERSKNMSRRSSEEST----SSE 113
Query: 155 RGAFPRVSEELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRN 210
GAFPRVS+ELK AL+TLQQTFVVSDAT+P CPI+YASSGFF+MTGYSSKE++GRN
Sbjct: 114 SGAFPRVSQELKTALSTLQQTFVVSDATQPHCPIVYASSGFFTMTGYSSKEIVGRN 169
|
|
| TAIR|locus:2102674 PHOT1 "phototropin 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8H935 Vfphot1a "Phototropin" [Vicia faba (taxid:3906)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2QYY8 PHOT1A "Phototropin-1A" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2RBR1 PHOT1B "Phototropin-1B" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9ST27 PHOT2 "Phototropin-2" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2058852 PLPB "PAS/LOV PROTEIN C" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4N7Q5 MGG_03538 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NCS4 MGG_01041 "Cellulose signaling associated protein ENVOY" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00036312001 | SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (1001 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| PRK13559 | 361 | PRK13559, PRK13559, hypothetical protein; Provisio | 2e-10 | |
| PRK13557 | 540 | PRK13557, PRK13557, histidine kinase; Provisional | 7e-09 | |
| PRK13558 | 665 | PRK13558, PRK13558, bacterio-opsin activator; Prov | 2e-05 | |
| smart00091 | 67 | smart00091, PAS, PAS domain | 5e-04 |
| >gnl|CDD|237427 PRK13559, PRK13559, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Score = 58.7 bits (142), Expect = 2e-10
Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 5/82 (6%)
Query: 132 GDRSKNSSERFTIDSTRTSEESERGAFPRVSEELKAALATLQQT---FVVSDATKPDCPI 188
GD SS+ F+ D + + F S L ++QT ++D +PD PI
Sbjct: 11 GDLPAASSKAFSADRKELAAIHDPRDFRGASGRL--FEQAMEQTRMAMCITDPHQPDLPI 68
Query: 189 MYASSGFFSMTGYSSKEVIGRN 210
+ A+ F +TGY+++EV+GRN
Sbjct: 69 VLANQAFLDLTGYAAEEVVGRN 90
|
Length = 361 |
| >gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237426 PRK13558, PRK13558, bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214512 smart00091, PAS, PAS domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| PF00989 | 113 | PAS: PAS fold; InterPro: IPR013767 PAS domains are | 98.62 | |
| PF13426 | 104 | PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ | 98.28 | |
| PRK13557 | 540 | histidine kinase; Provisional | 98.06 | |
| PF13188 | 64 | PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A. | 97.98 | |
| PRK13559 | 361 | hypothetical protein; Provisional | 97.83 | |
| PF08448 | 110 | PAS_4: PAS fold; InterPro: IPR013656 The PAS fold | 97.8 | |
| TIGR02040 | 442 | PpsR-CrtJ transcriptional regulator PpsR. This mod | 97.8 | |
| TIGR00229 | 124 | sensory_box PAS domain S-box. The PAS domain was p | 97.74 | |
| PRK10060 | 663 | RNase II stability modulator; Provisional | 97.55 | |
| PRK13560 | 807 | hypothetical protein; Provisional | 97.52 | |
| PRK11006 | 430 | phoR phosphate regulon sensor protein; Provisional | 97.42 | |
| TIGR02040 | 442 | PpsR-CrtJ transcriptional regulator PpsR. This mod | 97.36 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 97.3 | |
| cd00130 | 103 | PAS PAS domain; PAS motifs appear in archaea, euba | 97.1 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 96.87 | |
| PRK09776 | 1092 | putative diguanylate cyclase; Provisional | 96.78 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 96.74 | |
| PRK09776 | 1092 | putative diguanylate cyclase; Provisional | 96.71 | |
| smart00091 | 67 | PAS PAS domain. PAS motifs appear in archaea, euba | 96.69 | |
| COG2202 | 232 | AtoS FOG: PAS/PAC domain [Signal transduction mech | 96.52 | |
| PRK11360 | 607 | sensory histidine kinase AtoS; Provisional | 96.52 | |
| KOG1229 | 775 | consensus 3'5'-cyclic nucleotide phosphodiesterase | 96.47 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 96.44 | |
| PF12860 | 115 | PAS_7: PAS fold | 96.33 | |
| PRK11359 | 799 | cyclic-di-GMP phosphodiesterase; Provisional | 96.22 | |
| PRK13560 | 807 | hypothetical protein; Provisional | 95.87 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 95.61 | |
| PRK11086 | 542 | sensory histidine kinase DcuS; Provisional | 95.51 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 95.45 | |
| PRK15053 | 545 | dpiB sensor histidine kinase DpiB; Provisional | 95.43 | |
| TIGR02938 | 494 | nifL_nitrog nitrogen fixation negative regulator N | 94.86 | |
| PF13596 | 106 | PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. | 91.24 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 88.74 | |
| TIGR02373 | 124 | photo_yellow photoactive yellow protein. Members o | 85.92 | |
| COG3283 | 511 | TyrR Transcriptional regulator of aromatic amino a | 85.15 | |
| COG5002 | 459 | VicK Signal transduction histidine kinase [Signal | 82.96 |
| >PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] | Back alignment and domain information |
|---|
Probab=98.62 E-value=5.4e-08 Score=69.49 Aligned_cols=45 Identities=31% Similarity=0.508 Sum_probs=40.9
Q ss_pred HHHHHHHHhcCCeEEEEcCCCCCCCEEEEcHHHHHhhCCCcccccCCC
Q 037089 163 EELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRN 210 (211)
Q Consensus 163 rlL~~aLdss~dgIvItDa~~~D~pIVYVN~AFerMTGYS~eELIGRN 210 (211)
+.++.++++++++|++.|. ++.|+|+|++|++|+||+.++++|++
T Consensus 1 e~~~~i~~~~~~~i~~~d~---~g~I~~~N~a~~~l~g~~~~~~~g~~ 45 (113)
T PF00989_consen 1 ERYRAILENSPDGIFVIDE---DGRILYVNQAAEELLGYSREELIGKS 45 (113)
T ss_dssp HHHHHHHHCSSSEEEEEET---TSBEEEECHHHHHHHSS-HHHHTTSB
T ss_pred CHHHHHHhcCCceEEEEeC---cCeEEEECHHHHHHHccCHHHHcCCc
Confidence 3578999999999999998 77899999999999999999999986
|
PAS domains appear in archaea, bacteria and eukaryotes. Several PAS-domain proteins are known to detect their signal by way of an associated cofactor. Haeme, flavin, and a 4-hydroxycinnamyl chromophore are used in different proteins. The PAS domain was named after three proteins that it occurs in: Per- period circadian protein Arnt- Ah receptor nuclear translocator protein Sim- single-minded protein. PAS domains are often associated with PAC domains IPR001610 from INTERPRO. It appears that these domains are directly linked, and that together they form the conserved 3D PAS fold. The division between the PAS and PAC domains is caused by major differences in sequences in the region connecting these two motifs []. In human PAS kinase, this region has been shown to be very flexible, and adopts different conformations depending on the bound ligand []. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels [].; GO: 0006355 regulation of transcription, DNA-dependent; PDB: 2GJ3_A 4F3L_B 1XFN_A 1OTD_A 2PYR_A 1KOU_A 1XFQ_A 2ZOI_A 2ZOH_A 1OTA_A .... |
| >PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A | Back alignment and domain information |
|---|
| >PRK13557 histidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF13188 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A | Back alignment and domain information |
|---|
| >PRK13559 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] | Back alignment and domain information |
|---|
| >TIGR02040 PpsR-CrtJ transcriptional regulator PpsR | Back alignment and domain information |
|---|
| >TIGR00229 sensory_box PAS domain S-box | Back alignment and domain information |
|---|
| >PRK10060 RNase II stability modulator; Provisional | Back alignment and domain information |
|---|
| >PRK13560 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11006 phoR phosphate regulon sensor protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02040 PpsR-CrtJ transcriptional regulator PpsR | Back alignment and domain information |
|---|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PRK09776 putative diguanylate cyclase; Provisional | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >PRK09776 putative diguanylate cyclase; Provisional | Back alignment and domain information |
|---|
| >smart00091 PAS PAS domain | Back alignment and domain information |
|---|
| >COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11360 sensory histidine kinase AtoS; Provisional | Back alignment and domain information |
|---|
| >KOG1229 consensus 3'5'-cyclic nucleotide phosphodiesterases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF12860 PAS_7: PAS fold | Back alignment and domain information |
|---|
| >PRK11359 cyclic-di-GMP phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK13560 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PRK11086 sensory histidine kinase DcuS; Provisional | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15053 dpiB sensor histidine kinase DpiB; Provisional | Back alignment and domain information |
|---|
| >TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL | Back alignment and domain information |
|---|
| >PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >TIGR02373 photo_yellow photoactive yellow protein | Back alignment and domain information |
|---|
| >COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 211 | ||||
| 2z6d_A | 130 | Crystal Structure Of Lov1 Domain Of Phototropin2 Fr | 6e-22 | ||
| 2z6c_A | 129 | Crystal Structure Of Lov1 Domain Of Phototropin1 Fr | 2e-20 | ||
| 1n9l_A | 109 | Crystal Structure Of The Phot-lov1 Domain From Chla | 9e-11 | ||
| 3ue6_A | 166 | The Dark Structure Of The Blue-light Photoreceptor | 1e-09 | ||
| 3ulf_A | 170 | The Light State Structure Of The Blue-light Photore | 1e-09 | ||
| 2v0u_A | 146 | N- And C-terminal Helices Of Oat Lov2 (404-546) Are | 1e-06 | ||
| 4ees_A | 115 | Crystal Structure Of Ilov Length = 115 | 1e-06 | ||
| 2v1a_A | 144 | N- And C-Terminal Helices Of Oat Lov2 (404-546) Are | 1e-06 | ||
| 4eeu_A | 118 | Crystal Structure Of Philov2.1 Length = 118 | 1e-06 | ||
| 2wkr_A | 332 | Structure Of A Photoactivatable Rac1 Containing The | 4e-06 | ||
| 2wkq_A | 332 | Structure Of A Photoactivatable Rac1 Containing The | 4e-06 | ||
| 2wkp_A | 332 | Structure Of A Photoactivatable Rac1 Containing Lov | 4e-06 | ||
| 4eer_A | 115 | Crystal Structure Of Lov2 Domain Of Arabidopsis Tha | 4e-06 | ||
| 4eep_A | 115 | Crystal Structure Of Lov2 Domain Of Arabidopsis Tha | 5e-06 | ||
| 3hjk_A | 154 | 2.0 Angstrom Structure Of The Ile74val Variant Of V | 2e-05 | ||
| 3is2_A | 154 | 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic | 2e-05 | ||
| 3is2_B | 154 | 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic | 2e-05 | ||
| 3d72_A | 149 | 1.65 Angstrom Crystal Structure Of The Cys71val Var | 2e-05 | ||
| 2pd8_A | 149 | 1.8 Angstrom Crystal Structure Of The Cys71ser Muta | 2e-05 | ||
| 3rh8_B | 148 | Crystal Structure Of The Light-State Dimer Of Funga | 3e-05 | ||
| 2pd7_A | 149 | 2.0 Angstrom Crystal Structure Of The Fungal Blue-L | 3e-05 | ||
| 3hji_A | 154 | 1.8 Angstrom Crystal Structure Of The I74v:i85v Var | 3e-05 | ||
| 2pr5_A | 132 | Structural Basis For Light-dependent Signaling In T | 1e-04 | ||
| 1g28_A | 104 | Structure Of A Flavin-Binding Domain, Lov2, From Th | 3e-04 | ||
| 3t50_A | 128 | X-Ray Structure Of The Lov Domain From The Lov-Hk S | 8e-04 |
| >pdb|2Z6D|A Chain A, Crystal Structure Of Lov1 Domain Of Phototropin2 From Arabidopsis Thaliana Length = 130 | Back alignment and structure |
|
| >pdb|2Z6C|A Chain A, Crystal Structure Of Lov1 Domain Of Phototropin1 From Arabidopsis Thaliana Length = 129 | Back alignment and structure |
| >pdb|1N9L|A Chain A, Crystal Structure Of The Phot-lov1 Domain From Chlamydomonas Reinhardtii In The Dark State. Length = 109 | Back alignment and structure |
| >pdb|3UE6|A Chain A, The Dark Structure Of The Blue-light Photoreceptor Aureochrome1 Lov Length = 166 | Back alignment and structure |
| >pdb|3ULF|A Chain A, The Light State Structure Of The Blue-light Photoreceptor Aureochrome1 Lov Length = 170 | Back alignment and structure |
| >pdb|2V0U|A Chain A, N- And C-terminal Helices Of Oat Lov2 (404-546) Are Involved In Light-induced Signal Transduction (cryo Dark Structure Of Lov2 (404-546)) Length = 146 | Back alignment and structure |
| >pdb|4EES|A Chain A, Crystal Structure Of Ilov Length = 115 | Back alignment and structure |
| >pdb|2V1A|A Chain A, N- And C-Terminal Helices Of Oat Lov2 (404-546) Are Involved In Light-Induced Signal Transduction (Room Temperature (293k) Dark Structure Of Lov2 (404-546)) Length = 144 | Back alignment and structure |
| >pdb|4EEU|A Chain A, Crystal Structure Of Philov2.1 Length = 118 | Back alignment and structure |
| >pdb|2WKR|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450m Mutant Length = 332 | Back alignment and structure |
| >pdb|2WKQ|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450a Mutant Length = 332 | Back alignment and structure |
| >pdb|2WKP|A Chain A, Structure Of A Photoactivatable Rac1 Containing Lov2 Wildtype Length = 332 | Back alignment and structure |
| >pdb|4EER|A Chain A, Crystal Structure Of Lov2 Domain Of Arabidopsis Thaliana Phototropin 2 C426a Mutant Length = 115 | Back alignment and structure |
| >pdb|4EEP|A Chain A, Crystal Structure Of Lov2 Domain Of Arabidopsis Thaliana Phototropin 2 Length = 115 | Back alignment and structure |
| >pdb|3HJK|A Chain A, 2.0 Angstrom Structure Of The Ile74val Variant Of Vivid (Vvd). Length = 154 | Back alignment and structure |
| >pdb|3IS2|A Chain A, 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic Acid Form Of Vivid Length = 154 | Back alignment and structure |
| >pdb|3IS2|B Chain B, 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic Acid Form Of Vivid Length = 154 | Back alignment and structure |
| >pdb|3D72|A Chain A, 1.65 Angstrom Crystal Structure Of The Cys71val Variant In The Fungal Photoreceptor Vvd Length = 149 | Back alignment and structure |
| >pdb|2PD8|A Chain A, 1.8 Angstrom Crystal Structure Of The Cys71ser Mutant Of Vivid Length = 149 | Back alignment and structure |
| >pdb|3RH8|B Chain B, Crystal Structure Of The Light-State Dimer Of Fungal Blue-Light Photoreceptor Vivid Length = 148 | Back alignment and structure |
| >pdb|2PD7|A Chain A, 2.0 Angstrom Crystal Structure Of The Fungal Blue-Light Photoreceptor Vivid Length = 149 | Back alignment and structure |
| >pdb|3HJI|A Chain A, 1.8 Angstrom Crystal Structure Of The I74v:i85v Variant Of Vivid (Vvd). Length = 154 | Back alignment and structure |
| >pdb|2PR5|A Chain A, Structural Basis For Light-dependent Signaling In The Dimeric Lov Photosensor Ytva (dark Structure) Length = 132 | Back alignment and structure |
| >pdb|1G28|A Chain A, Structure Of A Flavin-Binding Domain, Lov2, From The Chimeric PhytochromePHOTOTROPIN PHOTORECEPTOR PHY3 Length = 104 | Back alignment and structure |
| >pdb|3T50|A Chain A, X-Ray Structure Of The Lov Domain From The Lov-Hk Sensory Protein From Brucella Abortus (Dark State). Length = 128 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| 2z6d_A | 130 | Phototropin-2; PAS-fold, LOV-fold, alternative spl | 3e-22 | |
| 3p7n_A | 258 | Sensor histidine kinase; LOV domain, light-activat | 3e-17 | |
| 1n9l_A | 109 | PHOT-LOV1, putative blue light receptor; phototrop | 8e-17 | |
| 3ue6_A | 166 | Aureochrome1; PAS/LOV domain, FMN-binding blue-lig | 1e-16 | |
| 3d72_A | 149 | Vivid PAS protein VVD; circadian, photoreceptor, b | 2e-16 | |
| 2v0u_A | 146 | NPH1-1, LOV2; kinase, transferase, ATP-binding, se | 4e-16 | |
| 4eet_B | 115 | Phototropin-2; LOV, blue light photoreceptor, sign | 4e-16 | |
| 3sw1_A | 162 | Sensory box protein; light-oxygen-voltage, LOV, PA | 6e-16 | |
| 2l0w_A | 138 | Potassium voltage-gated channel, subfamily H (EAG | 1e-15 | |
| 3t50_A | 128 | Blue-light-activated histidine kinase; PAS superfa | 7e-15 | |
| 1byw_A | 110 | Protein (human ERG potassium channel); PAS domain, | 1e-14 | |
| 2pr5_A | 132 | Blue-light photoreceptor; light-oxygen-voltage, LO | 2e-14 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 1e-12 |
| >2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Length = 130 | Back alignment and structure |
|---|
Score = 86.8 bits (216), Expect = 3e-22
Identities = 44/53 (83%), Positives = 51/53 (96%)
Query: 158 FPRVSEELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRN 210
FPRVS+ELK AL+TLQQTFVVSDAT+P CPI+YASSGFF+MTGYSSKE++GRN
Sbjct: 1 FPRVSQELKTALSTLQQTFVVSDATQPHCPIVYASSGFFTMTGYSSKEIVGRN 53
|
| >3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Length = 258 | Back alignment and structure |
|---|
| >1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Length = 109 | Back alignment and structure |
|---|
| >3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Length = 166 | Back alignment and structure |
|---|
| >3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Length = 149 | Back alignment and structure |
|---|
| >2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Length = 146 | Back alignment and structure |
|---|
| >4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Length = 115 | Back alignment and structure |
|---|
| >3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Length = 162 | Back alignment and structure |
|---|
| >2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Length = 138 | Back alignment and structure |
|---|
| >3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Length = 128 | Back alignment and structure |
|---|
| >1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Length = 110 | Back alignment and structure |
|---|
| >2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Length = 132 | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| 2r78_A | 117 | Sensor protein; sensory box sensor histidine kinas | 98.89 | |
| 2gj3_A | 120 | Nitrogen fixation regulatory protein; PAS domain, | 98.86 | |
| 1n9l_A | 109 | PHOT-LOV1, putative blue light receptor; phototrop | 98.76 | |
| 1d06_A | 130 | Nitrogen fixation regulatory protein FIXL; oxygen | 98.75 | |
| 2pr5_A | 132 | Blue-light photoreceptor; light-oxygen-voltage, LO | 98.7 | |
| 3olo_A | 118 | Two-component sensor histidine kinase; structural | 98.69 | |
| 3bwl_A | 126 | Sensor protein; structural genomics, APC87707.1, P | 98.61 | |
| 3mfx_A | 129 | Sensory BOX/ggdef family protein; alpha-beta prote | 98.49 | |
| 3luq_A | 114 | Sensor protein; PAS, histidine, kinase, PSI, MCSG, | 98.49 | |
| 3ewk_A | 227 | Sensor protein; PAS domain, alpha/beta fold, kinas | 98.45 | |
| 3p7n_A | 258 | Sensor histidine kinase; LOV domain, light-activat | 98.44 | |
| 4hi4_A | 121 | Aerotaxis transducer AER2; PAS domain, diatomic GA | 98.42 | |
| 3ue6_A | 166 | Aureochrome1; PAS/LOV domain, FMN-binding blue-lig | 98.4 | |
| 4eet_B | 115 | Phototropin-2; LOV, blue light photoreceptor, sign | 98.4 | |
| 3fc7_A | 125 | HTR-like protein, sensor protein; APC87712.1, HTR- | 98.4 | |
| 2z6d_A | 130 | Phototropin-2; PAS-fold, LOV-fold, alternative spl | 98.36 | |
| 3mqq_A | 120 | Transcriptional regulator, LUXR family; PAS domain | 98.35 | |
| 3b33_A | 115 | Sensor protein; structural genomics, PAS domain, n | 98.32 | |
| 3mxq_A | 152 | Sensor protein; PSI2, MCSG, structural genomics, p | 98.31 | |
| 1ll8_A | 114 | PAS kinase; PAS domain, ligand binding, ligand scr | 98.3 | |
| 2w0n_A | 118 | Sensor protein DCUS; signal transduction, two-comp | 98.27 | |
| 3f1p_B | 121 | ARYL hydrocarbon receptor nuclear translocator; PA | 98.23 | |
| 3lyx_A | 124 | Sensory BOX/ggdef domain protein; structural genom | 98.21 | |
| 3t50_A | 128 | Blue-light-activated histidine kinase; PAS superfa | 98.21 | |
| 3vol_A | 233 | Aerotaxis transducer AER2; heme, oxygen sensor pro | 98.21 | |
| 2l0w_A | 138 | Potassium voltage-gated channel, subfamily H (EAG | 98.17 | |
| 3fg8_A | 118 | Uncharacterized protein RHA05790; PAS domain, stru | 98.17 | |
| 1nwz_A | 125 | PYP, photoactive yellow protein; PAS, LOV, GAF, do | 98.15 | |
| 1byw_A | 110 | Protein (human ERG potassium channel); PAS domain, | 98.13 | |
| 2vlg_A | 111 | Sporulation kinase A; histidine kinase, two-compon | 98.12 | |
| 3a0s_A | 96 | Sensor protein; PAS-fold, kinase, phosphoprotein, | 98.12 | |
| 2kdk_A | 121 | ARYL hydrocarbon receptor nuclear translocator-LI | 98.08 | |
| 3k3c_A | 158 | Protein RV1364C/MT1410; sensor, PAS, signal transd | 98.08 | |
| 3d72_A | 149 | Vivid PAS protein VVD; circadian, photoreceptor, b | 98.08 | |
| 3sw1_A | 162 | Sensory box protein; light-oxygen-voltage, LOV, PA | 98.06 | |
| 1mzu_A | 129 | PPR; photoactive yellow protein, PAS, PYP, signali | 98.05 | |
| 3eeh_A | 125 | Putative light and redox sensing histidine kinase; | 98.03 | |
| 1v9y_A | 167 | Heme PAS sensor protein; signaling protein; HET: H | 98.01 | |
| 3mjq_A | 126 | Uncharacterized protein; NESG, structural genomics | 97.99 | |
| 3nja_A | 125 | Probable ggdef family protein; structural genomics | 97.99 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 97.99 | |
| 3kx0_X | 185 | Uncharacterized protein RV1364C/MT1410; PAS domain | 97.95 | |
| 3f1p_A | 117 | Endothelial PAS domain-containing protein 1; PAS d | 97.94 | |
| 2v0u_A | 146 | NPH1-1, LOV2; kinase, transferase, ATP-binding, se | 97.79 | |
| 2qkp_A | 151 | Uncharacterized protein; structural genomics, unkn | 97.66 | |
| 3icy_A | 118 | Sensor protein; sensory box histidine kinase/respo | 97.51 | |
| 3mr0_A | 142 | Sensory box histidine kinase/response regulator; P | 97.3 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 97.02 | |
| 3h9w_A | 115 | Diguanylate cyclase with PAS/PAC sensor; alpha-bet | 97.01 | |
| 3cax_A | 369 | Uncharacterized protein PF0695; structural genomic | 96.95 | |
| 4eho_A | 635 | Bacteriophytochrome, PAS/PAC sensor; photoreceptor | 96.8 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 96.49 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 95.29 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 95.13 | |
| 3rty_A | 339 | Period circadian protein; PAS domain, signalling, | 94.62 | |
| 2ykf_A | 305 | Pdtas, probable sensor histidine kinase pdtas; tra | 93.42 | |
| 4dj3_A | 317 | Period circadian protein homolog 3; PAS domain, ci | 93.49 | |
| 4dj2_A | 320 | Period circadian protein homolog 1; PAS domains, c | 93.22 | |
| 3gdi_A | 309 | Period circadian protein homolog 2; tandem PAS dom | 93.11 | |
| 4dj2_A | 320 | Period circadian protein homolog 1; PAS domains, c | 92.85 | |
| 3gdi_A | 309 | Period circadian protein homolog 2; tandem PAS dom | 91.64 | |
| 4dj3_A | 317 | Period circadian protein homolog 3; PAS domain, ci | 90.49 |
| >2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
Probab=98.89 E-value=2.7e-09 Score=76.57 Aligned_cols=50 Identities=16% Similarity=0.232 Sum_probs=45.4
Q ss_pred chhhHHHHHHHHHhcCCeEEEEcCCCCCCCEEEEcHHHHHhhCCCcccccCCC
Q 037089 158 FPRVSEELKAALATLQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRN 210 (211)
Q Consensus 158 l~rlsrlL~~aLdss~dgIvItDa~~~D~pIVYVN~AFerMTGYS~eELIGRN 210 (211)
+....+.+..++++++++|+++|. ++.|+|||++|++|+||+.+|++|++
T Consensus 6 l~~se~~~~~l~e~~~d~i~~~d~---~g~i~~vN~a~~~l~Gy~~~el~g~~ 55 (117)
T 2r78_A 6 LYFQSNAYRALFEHAIDGIFIMDA---EGHYLDVNPAICSAIGYTRDEFLALD 55 (117)
T ss_dssp HHHHHHHHHHHHHHCSSEEEEECT---TSBEEEECHHHHHHHCCCHHHHTTCB
T ss_pred HHHhHHHHHHHHhcCCceEEEECC---CCCEEEecHHHHHHHCcCHHHHcCCC
Confidence 556667889999999999999998 67899999999999999999999985
|
| >2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* | Back alignment and structure |
|---|
| >1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* | Back alignment and structure |
|---|
| >2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* | Back alignment and structure |
|---|
| >3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} | Back alignment and structure |
|---|
| >3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} | Back alignment and structure |
|---|
| >4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* | Back alignment and structure |
|---|
| >4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* | Back alignment and structure |
|---|
| >3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} | Back alignment and structure |
|---|
| >2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* | Back alignment and structure |
|---|
| >3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A | Back alignment and structure |
|---|
| >3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 | Back alignment and structure |
|---|
| >2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B | Back alignment and structure |
|---|
| >3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} | Back alignment and structure |
|---|
| >3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A | Back alignment and structure |
|---|
| >3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... | Back alignment and structure |
|---|
| >1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 | Back alignment and structure |
|---|
| >2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* | Back alignment and structure |
|---|
| >2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A | Back alignment and structure |
|---|
| >3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* | Back alignment and structure |
|---|
| >3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 | Back alignment and structure |
|---|
| >3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} | Back alignment and structure |
|---|
| >1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* | Back alignment and structure |
|---|
| >3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A | Back alignment and structure |
|---|
| >2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* | Back alignment and structure |
|---|
| >2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A | Back alignment and structure |
|---|
| >2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A | Back alignment and structure |
|---|
| >4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 211 | ||||
| d1n9la_ | 109 | d.110.3.6 (A:) Putative blue light receptor, phot- | 1e-11 | |
| d1jnua_ | 104 | d.110.3.6 (A:) Photoreceptor phy3 flavin-binding d | 5e-10 | |
| d1bywa_ | 110 | d.110.3.6 (A:) Erg potassium channel, N-terminal d | 9e-10 |
| >d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 109 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Profilin-like superfamily: PYP-like sensor domain (PAS domain) family: Flavin-binding PAS domain domain: Putative blue light receptor, phot-lov1 domain species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]
Score = 57.2 bits (137), Expect = 1e-11
Identities = 25/40 (62%), Positives = 32/40 (80%)
Query: 172 LQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRNW 211
L+ TFVV+DAT PDCP++YAS GF++MTGY EV+G N
Sbjct: 2 LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNC 41
|
| >d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| d1n9la_ | 109 | Putative blue light receptor, phot-lov1 domain {Gr | 98.96 | |
| d1jnua_ | 104 | Photoreceptor phy3 flavin-binding domain, lov2 {Ma | 98.85 | |
| d1v9ya_ | 113 | Direct oxygen sensor protein, DOS {Escherichia col | 98.83 | |
| d1bywa_ | 110 | Erg potassium channel, N-terminal domain {Human (H | 98.78 | |
| d1ew0a_ | 130 | Histidine kinase FixL heme domain {Rhizobium melil | 98.65 | |
| d1mzua_ | 110 | PYP domain of sensor histidine kinase Ppr {Rhodosp | 98.63 | |
| d1nwza_ | 125 | Photoactive yellow protein, PYP {Ectothiorhodospir | 98.55 | |
| d1ll8a_ | 114 | N-terminal PAS domain of Pas kinase {Human (Homo s | 98.19 | |
| d1p97a_ | 114 | Hypoxia-inducible factor Hif2a, C-terminal domain | 97.38 | |
| d2oola2 | 114 | Sensor protein PhyB2 {Rhodopseudomonas palustris [ | 93.01 | |
| d1oj5a_ | 109 | PAS domain of steroid receptor coactivator 1A, NCo | 92.8 |
| >d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Profilin-like superfamily: PYP-like sensor domain (PAS domain) family: Flavin-binding PAS domain domain: Putative blue light receptor, phot-lov1 domain species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]
Probab=98.96 E-value=2e-10 Score=82.31 Aligned_cols=40 Identities=63% Similarity=1.183 Sum_probs=37.1
Q ss_pred cCCeEEEEcCCCCCCCEEEEcHHHHHhhCCCcccccCCCC
Q 037089 172 LQQTFVVSDATKPDCPIMYASSGFFSMTGYSSKEVIGRNW 211 (211)
Q Consensus 172 s~dgIvItDa~~~D~pIVYVN~AFerMTGYS~eELIGRNc 211 (211)
+.++|+|+|+..+|++|+|||++|++|+||+.+|++|+++
T Consensus 2 i~~~~vi~Da~~pdg~Ii~vN~a~~~~~Gy~~~El~G~~~ 41 (109)
T d1n9la_ 2 LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNC 41 (109)
T ss_dssp CSCEEEEEETTSTTCCEEEECHHHHHHHCCCHHHHTTSCG
T ss_pred ccceEEEEeCCCCCCeEEEEcHHHHHHHCcCHHHHcCCcc
Confidence 4689999999878999999999999999999999999974
|
| >d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} | Back information, alignment and structure |
|---|
| >d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} | Back information, alignment and structure |
|---|
| >d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} | Back information, alignment and structure |
|---|
| >d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|