Citrus Sinensis ID: 037101

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----
MAQNTNTEALGFVIGGKRISLTKGCALKDQNIPITLECPQPKTSISLPPLPLKDEILQFAEQRLAVVYPIIQEFKSIITSDPLGITKTWVGSDICNYKGFYCESPPDNETAIAVASIDFNGFQLSAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPRFCPHMWSYTYIP
cccccccccEEEEEcccccEEccccHHHccccccEEEcccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEccccccccccEEEEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccEEcccHHcccccccEEEccccEEEEcccccccccccccEEEccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccEEEcccccccccccccccccHHHHHcccccccccccccccc
ccccccEEEEEEEEccccccccccHHHHcccccEEEEcccccccccccHHHccccccHEccccccccccHHHHHHHHcccccHHHHHcccccccccccccEcccccccccccEEEEEEccccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEccccccccccHHccccccEEEEEccccccccccHHHHHHHccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccHccccccEEEEcccccccccccccccccHHHHccccccccccccccccc
MAQNTNTEALGFViggkrisltkgcalkdqnipitlecpqpktsislpplplkDEILQFAEQRLAVVYPIIQEFksiitsdplgitktwvgsdicnykgfycesppdneTAIAVASidfngfqlsaptldgfldqlpdialfhansnnfagtissniaklpylyeldisnnkfsgpfpaavlgmnnlefLDIRfnyftgsvppqiftqnlDFLFinnngfmiklpdnigsTHILFLTLannkfigplpRSIFKAFSELTEVLLVNnqltgclpyeigYLKEAvvfdvgdnqltgqlpfSLACLEKVEQLNFANnllfgmvpeavcglpnllhfslsdnyfthagpLCRFLIEKGVLdvrnncipdlpfqrsvaecadffahprfcphmwsytyip
maqntntealgfviggkrISLTKGCALKDQNIPITLECPQPKTSISLPPLPLKDEILQFAEQRLAVVYPIIQEFksiitsdplgiTKTWVGSDICNYKGFYCESPPDNETAIAVASIDFNGFQLSAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPRFCPHMWSYTYIP
MAQNTNTEALGFVIGGKRISLTKGCALKDQNIPITLECPQPKTSISLPPLPLKDEILQFAEQRLAVVYPIIQEFKSIITSDPLGITKTWVGSDICNYKGFYCESPPDNETAIAVASIDFNGFQLSAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPRFCPHMWSYTYIP
********ALGFVIGGKRISLTKGCALKDQNIPITLECPQPKTSISLPPLPLKDEILQFAEQRLAVVYPIIQEFKSIITSDPLGITKTWVGSDICNYKGFYCESPPDNETAIAVASIDFNGFQLSAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPRFCPHMWSYTYI*
****TNTEALGFVIGGKRISLTKGCALKDQNIPITLECPQPKTSISLPPLPLKDEILQFAEQRLAVVYPIIQEFKSIITSDPLGITKTWVGSDICNYKGFYCESPPDNETAIAVASIDFNGFQLSAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPRFCPHMWSYT*IP
MAQNTNTEALGFVIGGKRISLTKGCALKDQNIPITLECPQPKTSISLPPLPLKDEILQFAEQRLAVVYPIIQEFKSIITSDPLGITKTWVGSDICNYKGFYCESPPDNETAIAVASIDFNGFQLSAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPRFCPHMWSYTYIP
****TNTEALGFVIGGKRISLTKGCALKDQNIPITLECPQPKTSISLPPLPLKDEILQFAEQRLAVVYPIIQEFKSIITSDPLGITKTWVGSDICNYKGFYCESPPDNETAIAVASIDFNGFQLSAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPRFCPHMWS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQNTNTEALGFVIGGKRISLTKGCALKDQNIPITLECPQPKTSISLPPLPLKDEILQFAEQRLAVVYPIIQEFKSIITSDPLGITKTWVGSDICNYKGFYCESPPDNETAIAVASIDFNGFQLSAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPRFCPHMWSYTYIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query395 2.2.26 [Sep-21-2011]
Q8W3M4404 Uncharacterized protein A yes no 0.863 0.844 0.665 1e-135
Q9LHF1494 Leucine-rich repeat exten no no 0.820 0.655 0.449 3e-74
Q9T0K5 760 Leucine-rich repeat exten no no 0.820 0.426 0.437 4e-73
Q9LUI1470 Leucine-rich repeat exten no no 0.807 0.678 0.450 7e-71
O65375 744 Leucine-rich repeat exten no no 0.853 0.452 0.401 4e-68
Q9SN46 857 Leucine-rich repeat exten no no 0.810 0.373 0.423 1e-67
Q9XIL9 727 Pollen-specific leucine-r no no 0.835 0.453 0.396 4e-67
Q9LJ64 956 Pollen-specific leucine-r no no 0.827 0.342 0.4 4e-66
O48809 786 Leucine-rich repeat exten no no 0.815 0.409 0.416 9e-66
Q4PSE6433 Leucine-rich repeat exten no no 0.837 0.764 0.384 2e-64
>sp|Q8W3M4|Y4744_ARATH Uncharacterized protein At4g06744 OS=Arabidopsis thaliana GN=At4g06744 PE=2 SV=1 Back     alignment and function desciption
 Score =  482 bits (1240), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 231/347 (66%), Positives = 279/347 (80%), Gaps = 6/347 (1%)

Query: 53  KDEILQFAEQRLAVVYPIIQEFKSIITSDPLGITKTWVGSDICNYKGFYCESPPDNETAI 112
           + EIL F +QRLAVVYP+IQ FKS+IT DP  +TKTW+GSDIC+Y+GF+C++PP N+TA+
Sbjct: 34  RREILSFLDQRLAVVYPVIQRFKSLITLDPYNVTKTWIGSDICSYRGFHCDNPPHNKTAV 93

Query: 113 AVASIDFNGFQLSAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNK 172
            VASIDFNGFQLSAP+++GF+DQ  D+ALFH NSNNF GT+ S I  L YLYELDISNN+
Sbjct: 94  TVASIDFNGFQLSAPSIEGFIDQFADLALFHVNSNNFGGTVPSKIVNLRYLYELDISNNR 153

Query: 173 FSGPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPD--NIGS 230
           F+G FP AV+GM+ L F+DIRFN F+GS+PPQI  QNL+ LFIN+NGF   LP+    G+
Sbjct: 154 FTGQFPTAVVGMSGLTFIDIRFNSFSGSIPPQILGQNLEVLFINDNGFTASLPEIPGDGT 213

Query: 231 THILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDN 290
           THILFLTLANNKF GPLPRSI ++ S LTEVL +NN  TGC+P+EIG+L  A V D+G N
Sbjct: 214 THILFLTLANNKFNGPLPRSILRSMSTLTEVLFLNNDFTGCIPHEIGFLTGASVIDIGGN 273

Query: 291 QLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGL--PNLLHFSLSDNYFTHAGPLCR 348
           +LTG LP SL CLEKVEQLNFA NLLFG VPEAVC L   NL++ SLSDNYFTH GP CR
Sbjct: 274 KLTGPLPLSLMCLEKVEQLNFAGNLLFGAVPEAVCMLLRDNLVNLSLSDNYFTHVGPWCR 333

Query: 349 FLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPR--FCPHMWSYTY 393
            L+EKGVLDV NNCIP  P QRS+ ECA+FF  P+  +CPHMW +++
Sbjct: 334 GLLEKGVLDVGNNCIPFFPGQRSMQECAEFFVKPKKYYCPHMWFHSF 380

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LHF1|LRX4_ARATH Leucine-rich repeat extensin-like protein 4 OS=Arabidopsis thaliana GN=LRX4 PE=1 SV=1 Back     alignment and function description
>sp|Q9T0K5|LRX3_ARATH Leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=LRX3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LUI1|LRX6_ARATH Leucine-rich repeat extensin-like protein 6 OS=Arabidopsis thaliana GN=LRX6 PE=2 SV=1 Back     alignment and function description
>sp|O65375|LRX1_ARATH Leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=LRX1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SN46|LRX5_ARATH Leucine-rich repeat extensin-like protein 5 OS=Arabidopsis thaliana GN=LRX5 PE=2 SV=2 Back     alignment and function description
>sp|Q9XIL9|PLRX3_ARATH Pollen-specific leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=PEX3 PE=2 SV=1 Back     alignment and function description
>sp|Q9LJ64|PLRX1_ARATH Pollen-specific leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=1 Back     alignment and function description
>sp|O48809|LRX2_ARATH Leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=LRX2 PE=1 SV=1 Back     alignment and function description
>sp|Q4PSE6|LRX7_ARATH Leucine-rich repeat extensin-like protein 7 OS=Arabidopsis thaliana GN=LRX7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query395
255538218437 serine-threonine protein kinase, plant-t 1.0 0.903 0.751 1e-168
224137628430 predicted protein [Populus trichocarpa] 1.0 0.918 0.714 1e-163
449447263433 PREDICTED: uncharacterized protein At4g0 0.982 0.896 0.686 1e-156
356553974435 PREDICTED: uncharacterized protein At4g0 0.896 0.813 0.738 1e-152
356564166443 PREDICTED: uncharacterized protein At4g0 0.858 0.765 0.755 1e-150
357437731378 hypothetical protein MTR_1g018910 [Medic 0.870 0.910 0.718 1e-145
30680322404 Leucine-rich repeat-containing protein [ 0.863 0.844 0.665 1e-133
297813189409 leucine-rich repeat family protein [Arab 0.855 0.826 0.656 1e-132
255555347418 serine-threonine protein kinase, plant-t 0.896 0.846 0.653 1e-131
224060520342 predicted protein [Populus trichocarpa] 0.855 0.988 0.671 1e-130
>gi|255538218|ref|XP_002510174.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223550875|gb|EEF52361.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 300/399 (75%), Positives = 336/399 (84%), Gaps = 4/399 (1%)

Query: 1   MAQNTNTEALGFVIGGKRISLTKGCA---LKDQNIPITLECPQ-PKTSISLPPLPLKDEI 56
           +A N N E L F I  +  S  K C     K+Q +PITL+CP+       +P LPLK E+
Sbjct: 23  VAINPNRETLEFPISSRAKSTGKSCNNENYKNQKMPITLDCPKLVVPLPPIPTLPLKTEL 82

Query: 57  LQFAEQRLAVVYPIIQEFKSIITSDPLGITKTWVGSDICNYKGFYCESPPDNETAIAVAS 116
             F ++RLA VYPIIQ+FKSIITSDPLGITKTWVGSDIC+YKGF+C++PPDN++AIAVAS
Sbjct: 83  SVFLDERLAFVYPIIQKFKSIITSDPLGITKTWVGSDICSYKGFFCDNPPDNKSAIAVAS 142

Query: 117 IDFNGFQLSAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGP 176
           IDFNGFQLSA TLDGFLDQLPDIALFHANSN F+GTIS +IAKLPYLYELDISNN FSGP
Sbjct: 143 IDFNGFQLSAATLDGFLDQLPDIALFHANSNFFSGTISPDIAKLPYLYELDISNNLFSGP 202

Query: 177 FPAAVLGMNNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPDNIGSTHILFL 236
           FP AVLGMN L FLDIRFN+F+G++PPQ+FTQ LD LF+NNN FM  LPDNI +THIL+L
Sbjct: 203 FPTAVLGMNGLTFLDIRFNFFSGAIPPQLFTQELDALFLNNNNFMTNLPDNIVNTHILYL 262

Query: 237 TLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQL 296
           TLANNKFIGPLP  IFKAFS LTEVLL+NNQLTGCLPYEIG LKEAVVFD G+N+LTG L
Sbjct: 263 TLANNKFIGPLPGGIFKAFSSLTEVLLLNNQLTGCLPYEIGLLKEAVVFDAGNNRLTGSL 322

Query: 297 PFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVL 356
           P SLACL+KVEQLNFA NLLFGMVPE VC + NL++ SLSDNYFT  GP CR LI KGVL
Sbjct: 323 PLSLACLQKVEQLNFAGNLLFGMVPELVCKMENLVNLSLSDNYFTTVGPWCRILIAKGVL 382

Query: 357 DVRNNCIPDLPFQRSVAECADFFAHPRFCPHMWSYTYIP 395
           DVRNNCIPDLPFQRS+ ECA+FFAHPRFCPHMWSYTYIP
Sbjct: 383 DVRNNCIPDLPFQRSIMECANFFAHPRFCPHMWSYTYIP 421

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224137628|ref|XP_002327173.1| predicted protein [Populus trichocarpa] gi|222835488|gb|EEE73923.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449447263|ref|XP_004141388.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus] gi|449531011|ref|XP_004172481.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356553974|ref|XP_003545325.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max] Back     alignment and taxonomy information
>gi|356564166|ref|XP_003550327.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max] Back     alignment and taxonomy information
>gi|357437731|ref|XP_003589141.1| hypothetical protein MTR_1g018910 [Medicago truncatula] gi|87240777|gb|ABD32635.1| Leucine-rich repeat, plant specific [Medicago truncatula] gi|217075731|gb|ACJ86225.1| unknown [Medicago truncatula] gi|355478189|gb|AES59392.1| hypothetical protein MTR_1g018910 [Medicago truncatula] gi|388494932|gb|AFK35532.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|30680322|ref|NP_849339.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|75331365|sp|Q8W3M4.1|Y4744_ARATH RecName: Full=Uncharacterized protein At4g06744; Flags: Precursor gi|18149208|dbj|BAB83614.1| extensin-like protein [Arabidopsis thaliana] gi|332657160|gb|AEE82560.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297813189|ref|XP_002874478.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297320315|gb|EFH50737.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255555347|ref|XP_002518710.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223542091|gb|EEF43635.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224060520|ref|XP_002300228.1| predicted protein [Populus trichocarpa] gi|222847486|gb|EEE85033.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query395
TAIR|locus:1005716458404 AT4G06744 [Arabidopsis thalian 0.858 0.839 0.669 9.6e-128
TAIR|locus:2012171494 AT1G49750 [Arabidopsis thalian 0.893 0.714 0.501 8.3e-90
TAIR|locus:2094854494 AT3G24480 [Arabidopsis thalian 0.820 0.655 0.449 9.6e-73
TAIR|locus:2142105 760 LRX3 "AT4G13340" [Arabidopsis 0.820 0.426 0.440 1.1e-71
TAIR|locus:2094389470 AT3G22800 "AT3G22800" [Arabido 0.807 0.678 0.453 9.9e-71
TAIR|locus:2121348391 AT4G28380 [Arabidopsis thalian 0.820 0.828 0.420 5.6e-68
TAIR|locus:2124142 857 AT4G18670 "AT4G18670" [Arabido 0.820 0.378 0.431 1.9e-67
TAIR|locus:2008895 744 LRX1 "AT1G12040" [Arabidopsis 0.853 0.452 0.404 2.2e-66
TAIR|locus:2085889 956 AT3G19020 [Arabidopsis thalian 0.827 0.342 0.403 4.1e-65
TAIR|locus:2044576 727 AT2G15880 [Arabidopsis thalian 0.822 0.447 0.402 1.1e-64
TAIR|locus:1005716458 AT4G06744 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1254 (446.5 bits), Expect = 9.6e-128, P = 9.6e-128
 Identities = 231/345 (66%), Positives = 278/345 (80%)

Query:    55 EILQFAEQRLAVVYPIIQEFKSIITSDPLGITKTWVGSDICNYKGFYCESPPDNETAIAV 114
             EIL F +QRLAVVYP+IQ FKS+IT DP  +TKTW+GSDIC+Y+GF+C++PP N+TA+ V
Sbjct:    36 EILSFLDQRLAVVYPVIQRFKSLITLDPYNVTKTWIGSDICSYRGFHCDNPPHNKTAVTV 95

Query:   115 ASIDFNGFQLSAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFS 174
             ASIDFNGFQLSAP+++GF+DQ  D+ALFH NSNNF GT+ S I  L YLYELDISNN+F+
Sbjct:    96 ASIDFNGFQLSAPSIEGFIDQFADLALFHVNSNNFGGTVPSKIVNLRYLYELDISNNRFT 155

Query:   175 GPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFTQNLDFLFINNNGFMIKLPD--NIGSTH 232
             G FP AV+GM+ L F+DIRFN F+GS+PPQI  QNL+ LFIN+NGF   LP+    G+TH
Sbjct:   156 GQFPTAVVGMSGLTFIDIRFNSFSGSIPPQILGQNLEVLFINDNGFTASLPEIPGDGTTH 215

Query:   233 ILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQL 292
             ILFLTLANNKF GPLPRSI ++ S LTEVL +NN  TGC+P+EIG+L  A V D+G N+L
Sbjct:   216 ILFLTLANNKFNGPLPRSILRSMSTLTEVLFLNNDFTGCIPHEIGFLTGASVIDIGGNKL 275

Query:   293 TGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGL--PNLLHFSLSDNYFTHAGPLCRFL 350
             TG LP SL CLEKVEQLNFA NLLFG VPEAVC L   NL++ SLSDNYFTH GP CR L
Sbjct:   276 TGPLPLSLMCLEKVEQLNFAGNLLFGAVPEAVCMLLRDNLVNLSLSDNYFTHVGPWCRGL 335

Query:   351 IEKGVLDVRNNCIPDLPFQRSVAECADFFAHPR--FCPHMWSYTY 393
             +EKGVLDV NNCIP  P QRS+ ECA+FF  P+  +CPHMW +++
Sbjct:   336 LEKGVLDVGNNCIPFFPGQRSMQECAEFFVKPKKYYCPHMWFHSF 380
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2012171 AT1G49750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094854 AT3G24480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142105 LRX3 "AT4G13340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094389 AT3G22800 "AT3G22800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121348 AT4G28380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124142 AT4G18670 "AT4G18670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008895 LRX1 "AT1G12040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085889 AT3G19020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044576 AT2G15880 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8W3M4Y4744_ARATHNo assigned EC number0.66570.86320.8440yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.40.896.1
hypothetical protein (341 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pg.C_scaffold_1082000001
hypothetical protein (367 aa)
  •     0.478
fgenesh4_pg.C_scaffold_243000006
hypothetical protein (350 aa)
  •     0.442

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  133 bits (336), Expect = 7e-34
 Identities = 90/272 (33%), Positives = 139/272 (51%), Gaps = 15/272 (5%)

Query: 74  FKSIITSDPLGITKTWVGS-DICNYKGFYCESPPDNETAIAVASIDFNGFQLSAPTLDGF 132
           FKS I +DPL     W  S D+C ++G  C +      +  V SID +G  +S       
Sbjct: 37  FKSSI-NDPLKYLSNWNSSADVCLWQGITCNN------SSRVVSIDLSGKNISGKISSAI 89

Query: 133 LDQLPDIALFHANSNNFAGTISSNIAKLPY-LYELDISNNKFSGPFPAAVLGMNNLEFLD 191
             +LP I   + ++N  +G I  +I      L  L++SNN F+G  P   +   NLE LD
Sbjct: 90  F-RLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSI--PNLETLD 146

Query: 192 IRFNYFTGSVPPQI-FTQNLDFLFINNNGFMIKLPDNIGS-THILFLTLANNKFIGPLPR 249
           +  N  +G +P  I    +L  L +  N  + K+P+++ + T + FLTLA+N+ +G +PR
Sbjct: 147 LSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPR 206

Query: 250 SIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQL 309
            + +  S L  + L  N L+G +PYEIG L      D+  N LTG +P SL  L+ ++ L
Sbjct: 207 ELGQMKS-LKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYL 265

Query: 310 NFANNLLFGMVPEAVCGLPNLLHFSLSDNYFT 341
               N L G +P ++  L  L+   LSDN  +
Sbjct: 266 FLYQNKLSGPIPPSIFSLQKLISLDLSDNSLS 297

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 395
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.9
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.8
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.8
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.79
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.79
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
PLN03150623 hypothetical protein; Provisional 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.54
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.53
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.41
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.4
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.3
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.3
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.28
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.19
PLN03150623 hypothetical protein; Provisional 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.04
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.96
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.8
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.78
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.72
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.68
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.5
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.49
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.47
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.41
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.4
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.39
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.27
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.17
PRK15386 426 type III secretion protein GogB; Provisional 98.13
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.04
PRK15386 426 type III secretion protein GogB; Provisional 97.97
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.92
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.8
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.8
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.46
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.87
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.67
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.48
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.29
KOG4341483 consensus F-box protein containing LRR [General fu 96.1
KOG4308 478 consensus LRR-containing protein [Function unknown 95.97
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.79
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.43
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.42
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.02
KOG0473 326 consensus Leucine-rich repeat protein [Function un 94.25
KOG4308478 consensus LRR-containing protein [Function unknown 94.24
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.68
KOG4341483 consensus F-box protein containing LRR [General fu 93.58
smart0037026 LRR Leucine-rich repeats, outliers. 93.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.54
smart0037026 LRR Leucine-rich repeats, outliers. 92.54
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.13
KOG1947 482 consensus Leucine rich repeat proteins, some prote 90.87
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 86.28
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.55
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.46
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.27
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 83.93
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.9e-36  Score=325.56  Aligned_cols=293  Identities=30%  Similarity=0.493  Sum_probs=182.6

Q ss_pred             hhhHHHHHHHHHHhccCCCCCCCCCCC-CCCCCCcceeeeCCCCCCCccccEEEEEcCCCCcCCCCcccccCCCCCCcEE
Q 037101           64 LAVVYPIIQEFKSIITSDPLGITKTWV-GSDICNYKGFYCESPPDNETAIAVASIDFNGFQLSAPTLDGFLDQLPDIALF  142 (395)
Q Consensus        64 ~~~~~~~l~~~k~~~~~~~~~~~~~W~-~~~~C~w~gv~c~~~~~~~~~~~l~~L~Ls~~~l~~~~~~~~l~~l~~L~~L  142 (395)
                      .+.++.+|++||+.+. +|.+...+|. ..++|.|.||.|+..      .+|+.||++++.+.+. .+..+..+++|+.|
T Consensus        27 ~~~~~~~l~~~~~~~~-~~~~~~~~w~~~~~~c~w~gv~c~~~------~~v~~L~L~~~~i~~~-~~~~~~~l~~L~~L   98 (968)
T PLN00113         27 HAEELELLLSFKSSIN-DPLKYLSNWNSSADVCLWQGITCNNS------SRVVSIDLSGKNISGK-ISSAIFRLPYIQTI   98 (968)
T ss_pred             CHHHHHHHHHHHHhCC-CCcccCCCCCCCCCCCcCcceecCCC------CcEEEEEecCCCcccc-CChHHhCCCCCCEE
Confidence            4478899999999995 7777788996 468999999999753      2788888888887773 45567777777777


Q ss_pred             ECCCCCCCCCCccccC-CCCCCCEEEccCCCCCC----------------------CcchhhcCCCCCcEEEeecCcCCC
Q 037101          143 HANSNNFAGTISSNIA-KLPYLYELDISNNKFSG----------------------PFPAAVLGMNNLEFLDIRFNYFTG  199 (395)
Q Consensus       143 ~l~~n~l~~~~p~~~~-~l~~L~~L~Ls~n~l~~----------------------~~p~~l~~l~~L~~L~Ls~n~l~~  199 (395)
                      ++++|.+.+.+|..+. .+++|++|+|++|++++                      .+|..++.+++|++|++++|.+.+
T Consensus        99 ~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~  178 (968)
T PLN00113         99 NLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVG  178 (968)
T ss_pred             ECCCCccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccc
Confidence            7777777776665543 56666666666665554                      444445555555555555555554


Q ss_pred             CCCchhcc-CCCCeeeeccccCcccCCccccC-ccccEEEcccCCCCCCCchHHHhcCCCCcEEEccCCcCcccCchhhc
Q 037101          200 SVPPQIFT-QNLDFLFINNNGFMIKLPDNIGS-THILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIG  277 (395)
Q Consensus       200 ~~p~~~~~-~~L~~L~L~~n~l~~~~~~~~~~-~~L~~L~l~~n~l~~~~p~~~~~~l~~L~~L~l~~n~l~~~~~~~~~  277 (395)
                      .+|..+.. ++|++|++++|.+.+.+|..++. .+|++|++++|.+.+.+|..+.. +++|++|++++|.+++.+|..++
T Consensus       179 ~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~l~  257 (968)
T PLN00113        179 KIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG-LTSLNHLDLVYNNLTGPIPSSLG  257 (968)
T ss_pred             cCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhc-CCCCCEEECcCceeccccChhHh
Confidence            55544433 45555555555555555555544 55555555555555555554443 55555555555555555555555


Q ss_pred             CCCCCcEEEccCCcccccCchhccCCCCCCeeecccCcCCCCChhhhcCCCCCcEEEccCCcccccCCC-CcCCCCCCEE
Q 037101          278 YLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPL-CRFLIEKGVL  356 (395)
Q Consensus       278 ~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~~~-~~~l~~L~~L  356 (395)
                      ++++|++|++++|++.+.+|..+..+++|++|++++|.+.+.+|..+..+++|+.|++++|.+++..+. +..+++|+.|
T Consensus       258 ~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L  337 (968)
T PLN00113        258 NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVL  337 (968)
T ss_pred             CCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEE
Confidence            555555555555555555555555555566666666655555555555556666666666655554432 5555666666


Q ss_pred             EccCCCCCC
Q 037101          357 DVRNNCIPD  365 (395)
Q Consensus       357 ~L~~N~i~~  365 (395)
                      ++++|.+++
T Consensus       338 ~L~~n~l~~  346 (968)
T PLN00113        338 QLWSNKFSG  346 (968)
T ss_pred             ECcCCCCcC
Confidence            666666553

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 8e-20
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-20
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-12
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-05
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 6e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 8e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 9e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 3e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 3e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score = 94.7 bits (234), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 101/352 (28%), Positives = 162/352 (46%), Gaps = 53/352 (15%)
Query: 47  LPPLPLKD-EILQFAEQRLAVVYPIIQEFKSIITSDPLGITKTWVGSDICNYKGFYCESP 105
           +PPLPLK  + L  AE +     P   +F S       G   T  G D+     FY   P
Sbjct: 263 IPPLPLKSLQYLSLAENKFTGEIP---DFLS-------GACDTLTGLDLSGNH-FYGAVP 311
Query: 106 PDNETAIAVASIDFNGFQLSAPTLDGFLDQLPDIALFHANSNNFAGTI-SSNIAKLPYLY 164
           P                         F      +     +SNNF+G +    + K+  L 
Sbjct: 312 P-------------------------FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLK 346
Query: 165 ELDISNNKFSGPFPAAVLGMN-NLEFLDIRFNYFTGSVPPQIF---TQNLDFLFINNNGF 220
            LD+S N+FSG  P ++  ++ +L  LD+  N F+G + P +       L  L++ NNGF
Sbjct: 347 VLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 406
Query: 221 MIKLPDNIGS-THILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYL 279
             K+P  + + + ++ L L+ N   G +P S+  + S+L ++ L  N L G +P E+ Y+
Sbjct: 407 TGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL-GSLSKLRDLKLWLNMLEGEIPQELMYV 465
Query: 280 K--EAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSD 337
           K  E ++ D   N LTG++P  L+    +  ++ +NN L G +P+ +  L NL    LS+
Sbjct: 466 KTLETLILDF--NDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSN 523
Query: 338 NYFTHAGPL----CRFLIEKGV-LDVRNNCIPDLPFQRSVAECADFFAHPRF 384
           N F+   P     CR LI   +  ++ N  IP   F++S    A+F A  R+
Sbjct: 524 NSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRY 575
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-45
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-41
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-41
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-40
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-37
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-32
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-24
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-24
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-26
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 9e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-13
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-13
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  157 bits (400), Expect = 3e-45
 Identities = 65/276 (23%), Positives = 111/276 (40%), Gaps = 14/276 (5%)

Query: 73  EFKSIITSDPLGITKTWVGSDICNYKGFYCESPPDNETAIAVASIDFNGFQLSA----PT 128
           + K  + +       +W+ +  C  + +       +     V ++D +G  L      P+
Sbjct: 13  QIKKDLGNPT--TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPS 70

Query: 129 LDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMNNLE 188
               L  L    L+    NN  G I   IAKL  L+ L I++   SG  P  +  +  L 
Sbjct: 71  SLANLPYL--NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLV 128

Query: 189 FLDIRFNYFTGSVPPQIFT-QNLDFLFINNNGFMIKLPDNIGSTHIL--FLTLANNKFIG 245
            LD  +N  +G++PP I +  NL  +  + N     +PD+ GS   L   +T++ N+  G
Sbjct: 129 TLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTG 188

Query: 246 PLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEK 305
            +P +       L  V L  N L G      G  K      +  N L   L   +   + 
Sbjct: 189 KIPPTFANL--NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKN 245

Query: 306 VEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFT 341
           +  L+  NN ++G +P+ +  L  L   ++S N   
Sbjct: 246 LNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLC 281
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query395
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.94
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.91
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.8
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.36
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.32
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.24
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.89
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.74
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.72
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.67
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.62
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.5
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.34
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.24
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.07
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.52
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.46
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.77
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.71
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=8.4e-43  Score=327.03  Aligned_cols=297  Identities=25%  Similarity=0.398  Sum_probs=266.8

Q ss_pred             hhhHHHHHHHHHHhccCCCCCCCCCCC-CCCCCC--cceeeeCCCCCCCccccEEEEEcCCCCcCCC-CcccccCCCCCC
Q 037101           64 LAVVYPIIQEFKSIITSDPLGITKTWV-GSDICN--YKGFYCESPPDNETAIAVASIDFNGFQLSAP-TLDGFLDQLPDI  139 (395)
Q Consensus        64 ~~~~~~~l~~~k~~~~~~~~~~~~~W~-~~~~C~--w~gv~c~~~~~~~~~~~l~~L~Ls~~~l~~~-~~~~~l~~l~~L  139 (395)
                      .+.|++||++||..+. +|. .+.+|. +.++|.  |.||.|+...   ...+|+.|+++++.+.+. .++..+..+++|
T Consensus         4 ~~~~~~aL~~~k~~~~-~~~-~l~~W~~~~~~C~~~w~gv~C~~~~---~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~L   78 (313)
T 1ogq_A            4 NPQDKQALLQIKKDLG-NPT-TLSSWLPTTDCCNRTWLGVLCDTDT---QTYRVNNLDLSGLNLPKPYPIPSSLANLPYL   78 (313)
T ss_dssp             CHHHHHHHHHHHHHTT-CCG-GGTTCCTTSCTTTTCSTTEEECCSS---SCCCEEEEEEECCCCSSCEECCGGGGGCTTC
T ss_pred             CHHHHHHHHHHHHhcC-Ccc-cccCCCCCCCCCcCCCcceEeCCCC---CCceEEEEECCCCCccCCcccChhHhCCCCC
Confidence            4568899999999995 665 678997 468998  9999997532   124899999999999871 256779999999


Q ss_pred             cEEECCC-CCCCCCCccccCCCCCCCEEEccCCCCCCCcchhhcCCCCCcEEEeecCcCCCCCCchhcc-CCCCeeeecc
Q 037101          140 ALFHANS-NNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFT-QNLDFLFINN  217 (395)
Q Consensus       140 ~~L~l~~-n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~-~~L~~L~L~~  217 (395)
                      ++|++++ |.+.+.+|..++++++|++|++++|.+++.+|..|.++++|++|++++|.+++.+|..+.. ++|++|++++
T Consensus        79 ~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~  158 (313)
T 1ogq_A           79 NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDG  158 (313)
T ss_dssp             SEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCS
T ss_pred             CeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcC
Confidence            9999995 9999999999999999999999999999999999999999999999999999889987766 8999999999


Q ss_pred             ccCcccCCccccC-c-cccEEEcccCCCCCCCchHHHhcCCCCcEEEccCCcCcccCchhhcCCCCCcEEEccCCccccc
Q 037101          218 NGFMIKLPDNIGS-T-HILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQ  295 (395)
Q Consensus       218 n~l~~~~~~~~~~-~-~L~~L~l~~n~l~~~~p~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~  295 (395)
                      |.+.+.+|..++. . +|++|++++|.+.+.+|..+.. ++ |++|++++|.+++..+..+..+++|++|++++|.+++.
T Consensus       159 N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~-l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~  236 (313)
T 1ogq_A          159 NRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFAN-LN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFD  236 (313)
T ss_dssp             SCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGG-CC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCB
T ss_pred             CcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhC-Cc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeee
Confidence            9999999998887 5 8999999999999888888765 55 99999999999999999999999999999999999976


Q ss_pred             CchhccCCCCCCeeecccCcCCCCChhhhcCCCCCcEEEccCCcccccCCCCcCCCCCCEEEccCCC-CCCCCC
Q 037101          296 LPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNC-IPDLPF  368 (395)
Q Consensus       296 ~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~~~~~~l~~L~~L~L~~N~-i~~lp~  368 (395)
                      .|. +..+++|++|++++|++++.+|..+..+++|+.|++++|++++.+|....+++|+.+++++|+ +.+.|.
T Consensus       237 ~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~~~l~~L~~l~l~~N~~lc~~p~  309 (313)
T 1ogq_A          237 LGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPL  309 (313)
T ss_dssp             GGG-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTS
T ss_pred             cCc-ccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCCCccccccChHHhcCCCCccCCCC
Confidence            665 888999999999999999899999999999999999999999988888899999999999998 777664
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 395
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 63.5 bits (153), Expect = 6e-12
 Identities = 47/294 (15%), Positives = 83/294 (28%), Gaps = 20/294 (6%)

Query: 95  CNYKGFYCES------PPDNETAIAVASIDFNGFQLSAPTLDGFLDQLPDIALFHANSNN 148
           C+ +   C        P D     A+  +  N          G    L ++      +N 
Sbjct: 10  CHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKD---GDFKNLKNLHTLILINNK 66

Query: 149 FAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFTQ 208
            +       A L  L  L +S N+           +  L   +        SV   +   
Sbjct: 67  ISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQM 126

Query: 209 NLDFLFINNNGFMIKLPDNIGSTHILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQL 268
            +  L  N                 L      +  I  +P+ +      LTE+ L  N++
Sbjct: 127 IVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLP---PSLTELHLDGNKI 183

Query: 269 TGCLPYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLP 328
           T      +  L       +  N ++     SLA    + +L+  NN L   VP  +    
Sbjct: 184 TKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLV-KVPGGLADHK 242

Query: 329 NLLHFSLSDNYFTHAGP-------LCRFLIEKGVLDVRNNCIPDLPFQRSVAEC 375
            +    L +N  +  G                  + + +N +     Q S   C
Sbjct: 243 YIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRC 296
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query395
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.61
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.51
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.29
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.49
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.26
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.94
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.8
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.29
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.25
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=5e-41  Score=312.67  Aligned_cols=297  Identities=25%  Similarity=0.400  Sum_probs=264.3

Q ss_pred             hhhHHHHHHHHHHhccCCCCCCCCCCC-CCCCC--CcceeeeCCCCCCCccccEEEEEcCCCCcCCC-CcccccCCCCCC
Q 037101           64 LAVVYPIIQEFKSIITSDPLGITKTWV-GSDIC--NYKGFYCESPPDNETAIAVASIDFNGFQLSAP-TLDGFLDQLPDI  139 (395)
Q Consensus        64 ~~~~~~~l~~~k~~~~~~~~~~~~~W~-~~~~C--~w~gv~c~~~~~~~~~~~l~~L~Ls~~~l~~~-~~~~~l~~l~~L  139 (395)
                      .++|++||++||+.+. ++. .+.+|. ++|||  .|.||+|+...   ...+|+.|||+++++.+. .++..+.++++|
T Consensus         4 ~~~e~~aLl~~k~~~~-~~~-~l~sW~~~~d~C~~~w~gv~C~~~~---~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L   78 (313)
T d1ogqa_           4 NPQDKQALLQIKKDLG-NPT-TLSSWLPTTDCCNRTWLGVLCDTDT---QTYRVNNLDLSGLNLPKPYPIPSSLANLPYL   78 (313)
T ss_dssp             CHHHHHHHHHHHHHTT-CCG-GGTTCCTTSCTTTTCSTTEEECCSS---SCCCEEEEEEECCCCSSCEECCGGGGGCTTC
T ss_pred             CHHHHHHHHHHHHHCC-CCC-cCCCCCCCCCCCCCcCCCeEEeCCC---CcEEEEEEECCCCCCCCCCCCChHHhcCccc
Confidence            4688999999999997 543 578996 67999  59999998532   334899999999999984 267889999999


Q ss_pred             cEEECCC-CCCCCCCccccCCCCCCCEEEccCCCCCCCcchhhcCCCCCcEEEeecCcCCCCCCchhcc-CCCCeeeecc
Q 037101          140 ALFHANS-NNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMNNLEFLDIRFNYFTGSVPPQIFT-QNLDFLFINN  217 (395)
Q Consensus       140 ~~L~l~~-n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~-~~L~~L~L~~  217 (395)
                      ++|++++ |.++|.+|..|+++++|++|+|++|++.+..+..+..+.+|+++++++|.+.+.+|..+.. +.++++++++
T Consensus        79 ~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~  158 (313)
T d1ogqa_          79 NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDG  158 (313)
T ss_dssp             SEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCS
T ss_pred             cccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeeccc
Confidence            9999986 8999999999999999999999999999989999999999999999999999899988776 8999999999


Q ss_pred             ccCcccCCccccC-cc-ccEEEcccCCCCCCCchHHHhcCCCCcEEEccCCcCcccCchhhcCCCCCcEEEccCCccccc
Q 037101          218 NGFMIKLPDNIGS-TH-ILFLTLANNKFIGPLPRSIFKAFSELTEVLLVNNQLTGCLPYEIGYLKEAVVFDVGDNQLTGQ  295 (395)
Q Consensus       218 n~l~~~~~~~~~~-~~-L~~L~l~~n~l~~~~p~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~  295 (395)
                      |.+.+.+|..+.. .. ++.+++++|++.+..|..+.. + ....+++.++...+.+|..+..+++++.+++++|.+.+.
T Consensus       159 n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~-l-~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~  236 (313)
T d1ogqa_         159 NRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFAN-L-NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFD  236 (313)
T ss_dssp             SCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGG-C-CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCB
T ss_pred             cccccccccccccccccccccccccccccccccccccc-c-ccccccccccccccccccccccccccccccccccccccc
Confidence            9999999988877 44 589999999999888876554 4 556899999999999999999999999999999999966


Q ss_pred             CchhccCCCCCCeeecccCcCCCCChhhhcCCCCCcEEEccCCcccccCCCCcCCCCCCEEEccCCC-CCCCCC
Q 037101          296 LPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLHFSLSDNYFTHAGPLCRFLIEKGVLDVRNNC-IPDLPF  368 (395)
Q Consensus       296 ~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~~~~~~l~~L~~L~L~~N~-i~~lp~  368 (395)
                      +| .+..+++|++|++++|++++.+|..|+.+++|++|+|++|+|+|.+|.+..+++|+.+++++|+ +++.|.
T Consensus       237 ~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~pl  309 (313)
T d1ogqa_         237 LG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPL  309 (313)
T ss_dssp             GG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTS
T ss_pred             cc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCC
Confidence            54 6888999999999999999999999999999999999999999988888899999999999997 677664
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure