Citrus Sinensis ID: 037138
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 806 | ||||||
| 24461866 | 890 | NBS-LRR type disease resistance protein | 0.972 | 0.880 | 0.578 | 0.0 | |
| 24461861 | 890 | NBS-LRR type disease resistance protein | 0.972 | 0.880 | 0.574 | 0.0 | |
| 24461865 | 892 | NBS-LRR type disease resistance protein | 0.977 | 0.883 | 0.563 | 0.0 | |
| 24461863 | 889 | NBS-LRR type disease resistance protein | 0.959 | 0.869 | 0.526 | 0.0 | |
| 24461864 | 899 | NBS-LRR type disease resistance protein | 0.978 | 0.877 | 0.515 | 0.0 | |
| 224055915 | 880 | cc-nbs-lrr resistance protein [Populus t | 0.960 | 0.879 | 0.495 | 0.0 | |
| 225443158 | 903 | PREDICTED: probable disease resistance p | 0.967 | 0.863 | 0.471 | 0.0 | |
| 359482674 | 991 | PREDICTED: probable disease resistance p | 0.952 | 0.774 | 0.480 | 0.0 | |
| 359482672 | 905 | PREDICTED: probable disease resistance p | 0.967 | 0.861 | 0.478 | 0.0 | |
| 225442867 | 893 | PREDICTED: probable disease resistance p | 0.951 | 0.858 | 0.476 | 0.0 |
| >gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
Score = 908 bits (2346), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 488/843 (57%), Positives = 600/843 (71%), Gaps = 59/843 (6%)
Query: 3 LGKAAYISELEDNLDALLTELQKLIEAKNDVMTRVVNAEQQQQLRRLNKVQGWLSRVEGA 62
L +A YIS+LEDNLD L T+L++LIEAK+DVM RV AE+QQ + RLN+VQGW+SRVE
Sbjct: 23 LNEAKYISQLEDNLDDLQTKLEQLIEAKDDVMNRVEIAERQQ-MSRLNQVQGWVSRVEAV 81
Query: 63 ETEIGELITDSTREIQKLCLGGYCSKNCKSSYKFGKKVAKKLHLVVTLMGEGAFELVAEK 122
+ E +LI ++EI++LCL GYCSKNCKSSY FGKKV KKL LV TLMGEG FE+VAEK
Sbjct: 82 KAEADQLIRVGSQEIERLCLWGYCSKNCKSSYDFGKKVTKKLQLVETLMGEGIFEVVAEK 141
Query: 123 VPLAAVDARPVEPTIVGLNSTLEKVWRCLGEERVGIIGLYGMGGVGKTTLLAQINNKFLD 182
VP AA RP EPT++GL S LE+VWRCL EE GI+GLYGMGGVGKTTLL INNKFL+
Sbjct: 142 VPGAAATERPTEPTVIGLQSQLEQVWRCLVEEPAGIVGLYGMGGVGKTTLLTHINNKFLE 201
Query: 183 TPNDFDVVIWVVVSKDMQLERIQEKIGERIGLL----ENRSLEERASGIFKILSKKKFLL 238
+ +F+ VIWVVVSKD++LE IQE IGE+IGLL +NR +E++A IFKIL +KKF+L
Sbjct: 202 STTNFNYVIWVVVSKDLRLENIQETIGEKIGLLNDTWKNRRIEQKALDIFKILKEKKFVL 261
Query: 239 LLDDVWERIDLTKVGIPFPS--KNTSKVVFTTRL-----------IFKVECLRDKEAWEL 285
LLDD+W+R+DL +VG+P P +TSKVVFT+R FKV CL D +AWEL
Sbjct: 262 LLDDLWQRVDLVEVGVPLPGPQSSTSKVVFTSRSEEVCGLMEAHKKFKVACLSDIDAWEL 321
Query: 286 FLDKVGEETLDSHLDIPKLAHTLAKECGGLPLALITTG--LGCKKSQEEWSYAIEILRRS 343
F KVGEETL S DI +LA T AKECGGLPLALIT G + CKK+ EEW+YAIE+LR S
Sbjct: 322 FQQKVGEETLKSP-DIRQLAQTAAKECGGLPLALITIGRAMACKKTPEEWTYAIEVLRTS 380
Query: 344 ASELPGMGKEVYPLLKFSYDSLSSEIFRSCLLYCSLFPEDCKIDKIELIECWIGEGFLNG 403
+S+ PG+G EVYPLLKFSYDSL S+ RSCLLYC L+PED I K LI+CWIGEGFL
Sbjct: 381 SSQFPGLGNEVYPLLKFSYDSLPSDTIRSCLLYCCLYPEDYCISKEILIDCWIGEGFLTE 440
Query: 404 YEGAEVHNQGYYIIGILVHACLLEEVGSDHVRMHDAIRDMTLWIACEVEKEKENVL---- 459
+ NQGY+I+GIL+HACLLEE G V+MHD +RDM LWIAC +EKEK+N L
Sbjct: 441 RDRFGEQNQGYHILGILLHACLLEEGGDGEVKMHDVVRDMALWIACAIEKEKDNFLVYAG 500
Query: 460 --------------RRRISLMRNKIEKLSDTPTCPHLLSLFPNINRLKTIARRFFDFMPS 505
RR+SLM N+I LS+ TCPHLL+LF N N L+ I FF FMPS
Sbjct: 501 VGLIEAPDVSGWEKARRLSLMHNQITNLSEVATCPHLLTLFLNENELQMIHNDFFRFMPS 560
Query: 506 LTVLNLSNNGFLTKLRPGISKLVSLQYLNLSKTSIRELPKELKALVNLKYLNLEHSRYLH 565
L VLNL+++ LT L GISKLVSLQ+L+LSK+SI ELP ELKALVNLK LNLE++ L
Sbjct: 561 LKVLNLADSS-LTNLPEGISKLVSLQHLDLSKSSIEELPLELKALVNLKCLNLEYTWSLT 619
Query: 566 TIPRQLICSFSMLHVLRMVNCDYSG--KIPLDSILFGGCESLVEELISLKHLNVLTIALK 623
TIPRQLI + S LHVLRM +S + DSILFGG E +VEEL+ LK+L V++ L+
Sbjct: 620 TIPRQLISNLSRLHVLRMFAASHSAFDRASEDSILFGGGELIVEELLGLKYLEVISFTLR 679
Query: 624 SFFALQRFLSSHELQNCTKSLNLRYYDDSKSFNIYSLADLKHLDKLDLIYCRNLEE---- 679
S LQ FLSSH+L++CT++L L+ ++DS S + +LADLK L++L + C+ LEE
Sbjct: 680 SSHGLQSFLSSHKLRSCTRALLLQCFNDSTSLEVSALADLKQLNRLWITECKKLEELKMD 739
Query: 680 ------------FKKVMIDFCIKLREVTWLVFAPNLKSIHIANCHFMQEIISARKLGEVP 727
KKV I C KL+++T+LVFAPNL+SI + C M+E++S K EVP
Sbjct: 740 YTREVQQFVFHSLKKVEILACSKLKDLTFLVFAPNLESIELMGCPAMEEMVSMGKFAEVP 799
Query: 728 ELIGNLKPFAKLQYLHLRALPSLKSIYWNALP-SHIWKKLIMGCAGLKKLPLDSNSRKEH 786
E++ NL PFAKLQ L L +LKSIYW LP H+ C LKKLPLDSNS +E
Sbjct: 800 EVVANLNPFAKLQNLKLFGATNLKSIYWKPLPFPHLKSMSFSHCYKLKKLPLDSNSARER 859
Query: 787 RLV 789
+V
Sbjct: 860 NIV 862
|
Source: Citrus trifoliata Species: Citrus trifoliata Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|224055915|ref|XP_002298700.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222845958|gb|EEE83505.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225443158|ref|XP_002263674.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359482674|ref|XP_002281708.2| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359482672|ref|XP_003632805.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225442867|ref|XP_002281592.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 806 | ||||||
| TAIR|locus:2170902 | 862 | AT5G43740 [Arabidopsis thalian | 0.527 | 0.493 | 0.419 | 5.1e-106 | |
| TAIR|locus:2153474 | 874 | AT5G05400 [Arabidopsis thalian | 0.764 | 0.704 | 0.344 | 1.9e-104 | |
| TAIR|locus:2034765 | 884 | AT1G12290 [Arabidopsis thalian | 0.548 | 0.5 | 0.364 | 4.7e-64 | |
| TAIR|locus:2201986 | 885 | RFL1 "AT1G12210" [Arabidopsis | 0.398 | 0.362 | 0.401 | 1.1e-97 | |
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.578 | 0.524 | 0.365 | 2.3e-71 | |
| TAIR|locus:2171589 | 948 | AT5G47260 [Arabidopsis thalian | 0.916 | 0.779 | 0.347 | 2.5e-97 | |
| TAIR|locus:2031366 | 898 | AT1G63350 "AT1G63350" [Arabido | 0.492 | 0.442 | 0.379 | 2.5e-60 | |
| TAIR|locus:2170892 | 848 | AT5G43730 [Arabidopsis thalian | 0.527 | 0.501 | 0.421 | 8.9e-92 | |
| TAIR|locus:2132741 | 892 | AT4G10780 [Arabidopsis thalian | 0.549 | 0.496 | 0.353 | 1.3e-60 | |
| TAIR|locus:2008440 | 899 | AT1G61180 [Arabidopsis thalian | 0.397 | 0.355 | 0.398 | 3.6e-87 |
| TAIR|locus:2170902 AT5G43740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 822 (294.4 bits), Expect = 5.1e-106, Sum P(2) = 5.1e-106
Identities = 187/446 (41%), Positives = 264/446 (59%)
Query: 1 CALGKAAYISELEDNLDALLTELQKLIEAKNDVMTRVVNAEQQQQLRRLNKVQGWLSRVE 60
C L YI +E NLDAL +++L ++D++ RV + E+ + L+RL +V GWLSRV+
Sbjct: 19 CFLSDRNYIHMMESNLDALQKTMEELKNGRDDLLGRV-SIEEDKGLQRLAQVNGWLSRVQ 77
Query: 61 GAETEIGELITDSTREIQKLCLGGYCSKNCKSSYKFGKKVAKKLHLVVTLMGEGAFELVA 120
E+E +L+ + E +LCL GYCS++C SSY +G+KV+K L V L+ + F +VA
Sbjct: 78 IVESEFKDLLEAMSIETGRLCLLGYCSEDCISSYNYGEKVSKMLEEVKELLSKKDFRMVA 137
Query: 121 EKVPLAAVDARPVEPTIVGLNSTLEKVWRCLGEERXXXXXXXXXXXXXKTTLLAQINNKF 180
+++ + V+ + ++ T VGL+ +E W L + KTTLL +NNKF
Sbjct: 138 QEI-IHKVEKKLIQTT-VGLDKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKF 195
Query: 181 LDTPNDFDVVIWVVVSKDMQLERIQEKIGERIGL---LENRSLEERASGXXXXXXXXXXX 237
++ ++FDVVIWVVVSKD Q E IQ++I R+ E + ++AS
Sbjct: 196 VELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFV 255
Query: 238 XXXDDVWERIDLTKVGIPFPSK-NTSKVVFTTRLI-----------FKVECLRDKEAWEL 285
DD+W +D+TK+G+P P++ N SK+VFTTR KV CL EAWEL
Sbjct: 256 LLLDDLWSEVDMTKIGVPPPTRENGSKIVFTTRSTEVCKHMKADKQIKVACLSPDEAWEL 315
Query: 286 FLDKVGEETLDSHLDIPKLAHTLAKECGGLPLALITTG--LGCKKSQEEWSYAIEILRRS 343
F VG+ L SH DIP LA +A +C GLPLAL G + CK++ +EWS+AI +L +
Sbjct: 316 FRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMSCKETIQEWSHAINVLNSA 375
Query: 344 ASELPGMGKEVYPLLKFSYDSLSSEIFRSCLLYCSLFPEDCKIDKIELIECWIGEGFLNG 403
E PGM + + P+LKFSYDSL + + C LYCSLFPED +I K + IE WI EGF+N
Sbjct: 376 GHEFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDSEIPKEKWIEYWICEGFINP 435
Query: 404 YEGAEVH-NQGYYIIGILVHACLLEE 428
+ N GY IIG+LV A LL E
Sbjct: 436 NRYEDGGTNHGYDIIGLLVRAHLLIE 461
|
|
| TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pm.C_LG_I001004 | cc-nbs-lrr resistance protein (880 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 806 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 2e-74 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 3e-06 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 8e-06 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 9e-05 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-04 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 4e-04 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 7e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 0.001 | |
| pfam13401 | 124 | pfam13401, AAA_22, AAA domain | 0.003 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 243 bits (623), Expect = 2e-74
Identities = 110/281 (39%), Positives = 159/281 (56%), Gaps = 24/281 (8%)
Query: 142 STLEKVWRCL--GEERVGIIGLYGMGGVGKTTLLAQINNKFLDTPNDFDVVIWVVVSKDM 199
+E + L + +G++G+ GMGGVGKTTL QI N FD V WVVVSK
Sbjct: 3 DMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDD-SVGGHFDSVAWVVVSKTY 61
Query: 200 QLERIQEKIGERIGLLENRSLE----ERASGIFKILSKKKFLLLLDDVWERIDLTKVGIP 255
R+Q+ I + +GL ++ +E E A I + L +K+FLL+LDDVWE+ D K+G+P
Sbjct: 62 TEFRLQKDILQELGLDDSDWVEKNESELAVKIKEALLRKRFLLVLDDVWEKNDWDKIGVP 121
Query: 256 FPSK-NTSKVVFTTRLI------------FKVECLRDKEAWELFLDKVGEETLDSHLDIP 302
FP N S+V+ TTR +VE L +E+WELF +KV E+ L ++
Sbjct: 122 FPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPCPELE 181
Query: 303 KLAHTLAKECGGLPLALITTG--LGCKKSQEEWSYAIEILRRSASELPGMGKEVYPLLKF 360
++A + ++C GLPLAL G L K + +EW + +E L + G+ EV +L
Sbjct: 182 EVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGL-NEVLSILSL 240
Query: 361 SYDSLSSEIFRSCLLYCSLFPEDCKIDKIELIECWIGEGFL 401
SYD+L + + C LY +LFPED I K +LI+ WI EGF+
Sbjct: 241 SYDNLPMHL-KRCFLYLALFPEDYNIRKEQLIKLWIAEGFV 280
|
Length = 285 |
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|222104 pfam13401, AAA_22, AAA domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 806 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.84 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.83 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.8 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.77 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.76 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.73 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.67 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.66 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.58 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.55 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.47 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.43 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.39 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.38 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.35 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.33 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 99.32 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.24 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 99.24 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 99.23 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.23 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.21 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.18 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 99.15 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 99.14 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.13 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.11 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.07 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 99.01 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 99.0 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 98.95 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.94 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.93 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.87 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.85 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.83 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.81 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.77 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 98.76 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.75 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.73 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.7 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.68 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.67 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 98.65 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.64 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 98.64 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.63 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.62 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 98.62 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.6 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 98.59 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.59 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 98.58 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 98.58 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 98.56 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 98.55 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 98.55 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 98.54 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.54 | |
| PTZ00202 | 550 | tuzin; Provisional | 98.53 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.53 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 98.52 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.52 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.49 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.49 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 98.49 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.49 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 98.48 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.48 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 98.47 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.45 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 98.45 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 98.44 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 98.42 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 98.41 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 98.41 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 98.4 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 98.39 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.38 | |
| PRK09087 | 226 | hypothetical protein; Validated | 98.37 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 98.37 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 98.36 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 98.35 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 98.33 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 98.31 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 98.3 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 98.3 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 98.29 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 98.27 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 98.26 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 98.25 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 98.25 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.25 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 98.24 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 98.24 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 98.24 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 98.24 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 98.19 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 98.19 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.18 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 98.17 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 98.16 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 98.15 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 98.13 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 98.13 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 98.13 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 98.13 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.12 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 98.12 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 98.12 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 98.11 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 98.11 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 98.09 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.09 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 98.09 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.08 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 98.08 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 98.07 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 98.05 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 98.05 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 98.05 | |
| PRK06620 | 214 | hypothetical protein; Validated | 98.05 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 98.04 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.03 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 98.01 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 98.0 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.99 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.97 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 97.97 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 97.94 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.94 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 97.93 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 97.91 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.9 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.9 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.89 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.89 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.88 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.88 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.87 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.86 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.86 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 97.86 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.85 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.85 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.84 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.83 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.83 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 97.82 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.82 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.8 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 97.77 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.77 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 97.77 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.76 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.72 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.72 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 97.71 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.69 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.68 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 97.67 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.67 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 97.65 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.64 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 97.64 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.64 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.63 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 97.56 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.54 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 97.54 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.5 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.48 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 97.48 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 97.46 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.46 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 97.45 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 97.44 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 97.43 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.41 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 97.4 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.4 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.38 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.36 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 97.36 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 97.35 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.34 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 97.32 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 97.3 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 97.28 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.19 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 97.19 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 97.16 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 97.14 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 97.13 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 97.13 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 97.11 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.11 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 97.1 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.1 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.09 | |
| PRK08181 | 269 | transposase; Validated | 97.07 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.06 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 97.02 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.02 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.01 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.99 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 96.99 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.99 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.98 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 96.98 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.96 | |
| PF10443 | 431 | RNA12: RNA12 protein; InterPro: IPR018850 Mitochon | 96.94 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.93 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 96.92 | |
| PRK06526 | 254 | transposase; Provisional | 96.9 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.9 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 96.89 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.88 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 96.88 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 96.87 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.86 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 96.83 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 96.81 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 96.81 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 96.8 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 96.8 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 96.8 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 96.79 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.77 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.76 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.75 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 96.74 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.72 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 96.71 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 96.71 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 96.69 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.69 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.68 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 96.67 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 96.67 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 96.65 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 96.65 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 96.64 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 96.63 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.59 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 96.57 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 96.57 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 96.56 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 96.55 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 96.54 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 96.54 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 96.53 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 96.47 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 96.44 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 96.44 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.44 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 96.43 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 96.42 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.42 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 96.39 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 96.37 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 96.34 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 96.32 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 96.32 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.3 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 96.28 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 96.28 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 96.27 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 96.27 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 96.25 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 96.23 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 96.22 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.2 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 96.17 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 96.17 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 96.16 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 96.16 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 96.15 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 96.15 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.14 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.14 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 96.13 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 96.12 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 96.08 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 96.07 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 96.06 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 96.06 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 96.05 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 96.05 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 96.0 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.98 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.96 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 95.94 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 95.91 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 95.9 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 95.88 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 95.87 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 95.86 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 95.86 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.85 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 95.85 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 95.85 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 95.85 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.84 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 95.84 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 95.83 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 95.83 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 95.82 | |
| PRK07667 | 193 | uridine kinase; Provisional | 95.81 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 95.81 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 95.8 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 95.8 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 95.78 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 95.75 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 95.75 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 95.75 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 95.73 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 95.72 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 95.7 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 95.7 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.69 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 95.69 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 95.68 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 95.66 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 95.66 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 95.65 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 95.64 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 95.64 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 95.63 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 95.62 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 95.62 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 95.58 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 95.56 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 95.56 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.56 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 95.56 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 95.55 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 95.54 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 95.53 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 95.51 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 95.49 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 95.49 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 95.49 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 95.47 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 95.45 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 95.42 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 95.41 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 95.37 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 95.37 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 95.36 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 95.36 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.36 | |
| KOG2170 | 344 | consensus ATPase of the AAA+ superfamily [General | 95.35 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 95.35 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 95.34 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 95.34 | |
| PRK03839 | 180 | putative kinase; Provisional | 95.3 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 95.27 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 95.26 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 95.26 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 95.25 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 95.25 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 95.24 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 95.22 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 95.2 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 95.2 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 95.19 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 95.18 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 95.18 | |
| PTZ00494 | 664 | tuzin-like protein; Provisional | 95.17 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 95.17 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 95.17 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 95.16 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 95.14 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 95.11 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 95.11 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 95.1 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 95.1 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 95.09 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 95.09 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 95.06 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 95.05 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 95.01 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 94.99 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 94.98 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 94.98 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 94.97 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 94.97 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 94.95 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 94.94 | |
| PRK06217 | 183 | hypothetical protein; Validated | 94.93 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 94.92 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 94.92 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 94.91 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 94.91 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.9 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 94.89 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 94.88 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 94.88 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 94.88 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 94.87 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 94.87 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 94.87 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 94.86 | |
| PHA02774 | 613 | E1; Provisional | 94.8 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.76 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 94.75 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 94.72 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 94.72 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 94.7 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 94.7 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 94.7 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 94.7 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 94.7 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 94.7 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 94.69 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.69 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 94.68 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 94.66 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 94.65 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 94.63 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 94.62 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 94.61 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 94.61 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 94.59 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 94.59 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 94.58 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 94.58 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 94.58 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 94.58 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 94.58 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 94.57 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 94.56 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 94.55 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 94.55 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 94.53 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 94.52 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 94.52 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 94.5 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 94.48 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 94.46 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.45 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 94.45 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 94.44 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 94.43 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 94.42 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 94.41 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 94.41 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 94.41 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 94.4 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 94.4 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 94.4 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 94.4 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 94.4 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 94.38 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 94.37 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 94.35 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 94.35 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 94.35 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 94.34 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 94.34 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 94.32 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 94.31 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 94.29 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 94.27 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 94.26 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 94.26 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.26 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 94.23 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 94.19 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 94.18 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 94.14 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 94.14 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 94.09 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 94.08 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 94.08 | |
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 94.08 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 94.07 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 94.07 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 94.06 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 94.06 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 94.06 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 94.05 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 94.04 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 94.03 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 94.03 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 94.01 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 94.01 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 94.0 | |
| PLN02924 | 220 | thymidylate kinase | 93.99 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 93.95 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 93.94 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 93.94 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 93.91 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 93.9 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 93.86 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.4e-95 Score=835.35 Aligned_cols=774 Identities=42% Similarity=0.690 Sum_probs=634.2
Q ss_pred ccccchhchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhchHHHHHHHHHHHHHHHHHHHHHHhhHHHHhh----
Q 037138 4 GKAAYISELEDNLDALLTELQKLIEAKNDVMTRVVNAEQQQQLRRLNKVQGWLSRVEGAETEIGELITDSTREIQK---- 79 (806)
Q Consensus 4 ~~~~~~~~~~~~~~~l~~~l~~l~~~l~~i~~~~~~ae~~~~~~~~~~v~~Wl~~l~~~~~~~~d~ld~~~~~~~~---- 79 (806)
++...+.++.+++..|++++..|+.++. +|+.+ + .....+..|.+.++++.|+++|+++.+..+...
T Consensus 18 ~~~~~~~~~~~~i~~Lk~~L~~l~~~l~-------d~~a~-~-~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~ 88 (889)
T KOG4658|consen 18 RESECLDGKDNYILELKENLKALQSALE-------DLDAK-R-DDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKAN 88 (889)
T ss_pred HHHHHHhchHHHHHHHHHHHHHHHHHHH-------HHHhh-c-chHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 4556677777788888888888888854 45555 2 345678899999999999999999998654421
Q ss_pred ------------hhcCCccCCCchhhhhHHHHHHHHHHHHHHHHhcCCcceecc-cCCCccccCCCCCCcc-ccchHHHH
Q 037138 80 ------------LCLGGYCSKNCKSSYKFGKKVAKKLHLVVTLMGEGAFELVAE-KVPLAAVDARPVEPTI-VGLNSTLE 145 (806)
Q Consensus 80 ------------~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~-~gr~~~~~ 145 (806)
-|..++|.+.....+.+++++.+.+++++.+..++.|..+.. ..|......+|..+.. ||.+..++
T Consensus 89 ~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~VG~e~~~~ 168 (889)
T KOG4658|consen 89 DLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQSESDVGLETMLE 168 (889)
T ss_pred HHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccCCCCccccccHHHHHH
Confidence 233455666777788899999999999999988877776654 2233333444444433 99999999
Q ss_pred HHHHHhcCCCceEEEEEccCCCCHHHHHHHHHhhcCCCCCCCCeEEEEEeCCcccHHHHHHHHHHHhCCCC----CCCHH
Q 037138 146 KVWRCLGEERVGIIGLYGMGGVGKTTLLAQINNKFLDTPNDFDVVIWVVVSKDMQLERIQEKIGERIGLLE----NRSLE 221 (806)
Q Consensus 146 ~l~~~l~~~~~~vi~I~G~~GiGKTtLa~~v~~~~~~~~~~F~~~~wv~~s~~~~~~~~~~~i~~~l~~~~----~~~~~ 221 (806)
++++.|.+++..+++|+||||+||||||++++|+...++.+||.++||+||++++..+++++|++.++... ....+
T Consensus 169 kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~ 248 (889)
T KOG4658|consen 169 KLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEED 248 (889)
T ss_pred HHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchhhHH
Confidence 99999998888999999999999999999999998438999999999999999999999999999998744 33447
Q ss_pred HHHHHHHHHhCCCcEEEEEecCCCccCcccccccCCC-CCCcEEEEecCC------------ceecccCChHHHHHHHHh
Q 037138 222 ERASGIFKILSKKKFLLLLDDVWERIDLTKVGIPFPS-KNTSKVVFTTRL------------IFKVECLRDKEAWELFLD 288 (806)
Q Consensus 222 ~~~~~l~~~l~~k~~LlvlDdv~~~~~~~~~~~~~~~-~~~s~iivTtr~------------~~~l~~L~~~e~~~lf~~ 288 (806)
+.+..+.+.|++|||+|||||||+..+|+.++.++|. .+||+|++|||+ .++++.|+++|||.||++
T Consensus 249 ~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~ 328 (889)
T KOG4658|consen 249 ELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQK 328 (889)
T ss_pred HHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHH
Confidence 8899999999999999999999999999999999999 799999999999 689999999999999999
Q ss_pred hhCCCccCCCCChHHHHHHHHHHhCCchHHHHHhh--hcCCCCHHHHHHHHHHHhhc-ccCCCCCccchhhhhhhchhcC
Q 037138 289 KVGEETLDSHLDIPKLAHTLAKECGGLPLALITTG--LGCKKSQEEWSYAIEILRRS-ASELPGMGKEVYPLLKFSYDSL 365 (806)
Q Consensus 289 ~~~~~~~~~~~~~~~~~~~i~~~c~GlPlai~~~g--~~~~~~~~~w~~~l~~l~~~-~~~~~~~~~~~~~~l~~sy~~L 365 (806)
.++......++.++++|++|+++|+|+|||++++| |+.+.+..+|+.+.+.+.+. ..+.+++.+.+++++++|||.|
T Consensus 329 ~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L 408 (889)
T KOG4658|consen 329 KVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNL 408 (889)
T ss_pred hhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhh
Confidence 99987656667799999999999999999999999 89999999999999999887 5566677789999999999999
Q ss_pred ChhhHHHHHhhhcCCCCCCcccHHHHHHHHHHcCCccCCC-chhHHHhHHHHHHHHHHcccceeeC----CCcEEehHHH
Q 037138 366 SSEIFRSCLLYCSLFPEDCKIDKIELIECWIGEGFLNGYE-GAEVHNQGYYIIGILVHACLLEEVG----SDHVRMHDAI 440 (806)
Q Consensus 366 ~~~~~k~cfl~~~~fp~~~~i~~~~li~~Wia~g~i~~~~-~~~~~~~~~~~~~~L~~~sll~~~~----~~~~~mHdlv 440 (806)
|+ ++|.||+|||+|||||.|+++.||.+||||||+.+.. ...+++.|+.|+.+|++++|++..+ ..+|+|||+|
T Consensus 409 ~~-~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvv 487 (889)
T KOG4658|consen 409 PE-ELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVV 487 (889)
T ss_pred hH-HHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHH
Confidence 95 8999999999999999999999999999999999965 8889999999999999999999864 3789999999
Q ss_pred HHHHHHHHhhhhhcccceEE------------------EEEeeecccccccCCCCCCCccccccccccc--hhcchhHhh
Q 037138 441 RDMTLWIACEVEKEKENVLR------------------RRISLMRNKIEKLSDTPTCPHLLSLFPNINR--LKTIARRFF 500 (806)
Q Consensus 441 ~d~a~~~~~~~~~~~~~~~~------------------~~ls~~~~~~~~~~~~~~~~~L~~L~l~~n~--l~~~~~~~~ 500 (806)
|++|.+++++.+.++++..+ |+++++++.+..++....+++|++|.+..|. +..++..+|
T Consensus 488 Re~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff 567 (889)
T KOG4658|consen 488 REMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFF 567 (889)
T ss_pred HHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHH
Confidence 99999999976654444322 9999999999999999999999999999995 888999999
Q ss_pred ccCCcccEEEccCCCcccccCcccCCCCCCCEEEecCCCccccChhhhcCCCCcEEecCCCccccccccccccCCCCCcE
Q 037138 501 DFMPSLTVLNLSNNGFLTKLRPGISKLVSLQYLNLSKTSIRELPKELKALVNLKYLNLEHSRYLHTIPRQLICSFSMLHV 580 (806)
Q Consensus 501 ~~l~~L~~L~Ls~~~~~~~lp~~i~~l~~L~~L~Ls~n~l~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~~~~~l~~L~~ 580 (806)
..|+.|++|||++|...+.+|.+|+.|.+||||+++++.++.+|.++++|..|.+||+..+..+..+| ++...|++|++
T Consensus 568 ~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~-~i~~~L~~Lr~ 646 (889)
T KOG4658|consen 568 RSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIP-GILLELQSLRV 646 (889)
T ss_pred hhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheecccccccccccc-chhhhcccccE
Confidence 99999999999999888999999999999999999999999999999999999999999998666665 44677999999
Q ss_pred EEeecccCCCCCCCCccccCCccchHHHhcCCCCCCeeeEEecchhhHHHhhhchhhccccccceeccCCCCCccccccc
Q 037138 581 LRMVNCDYSGKIPLDSILFGGCESLVEELISLKHLNVLTIALKSFFALQRFLSSHELQNCTKSLNLRYYDDSKSFNIYSL 660 (806)
Q Consensus 581 L~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~~L~l~~~~~~~~~~~~~~~~l~~~~~~l~L~~~~~~~~~~~~~l 660 (806)
|.+....... ......++..|.+|+.+.+.......+..+.....+..+...+.+.. ........++
T Consensus 647 L~l~~s~~~~-----------~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~--~~~~~~~~~~ 713 (889)
T KOG4658|consen 647 LRLPRSALSN-----------DKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQSLSIEG--CSKRTLISSL 713 (889)
T ss_pred EEeecccccc-----------chhhHHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhHhhhhcc--cccceeeccc
Confidence 9998765221 23455778888888888887655433344443444444444444322 2222233467
Q ss_pred ccccccceEeeccccCcc----------------ccceeeecccCCcCCCCccccCCCcceEeeecCccchhhhcccccC
Q 037138 661 ADLKHLDKLDLIYCRNLE----------------EFKKVMIDFCIKLREVTWLVFAPNLKSIHIANCHFMQEIISARKLG 724 (806)
Q Consensus 661 ~~l~~L~~L~L~~~~~~~----------------~L~~L~l~~c~~l~~~~~l~~l~~L~~L~L~~~~~~~~i~~~~~~~ 724 (806)
..+.+|+.|.+.+|...+ .+..+.+.+|...+.+.|....|+|+.|.+..|..++++++.....
T Consensus 714 ~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~ 793 (889)
T KOG4658|consen 714 GSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKAL 793 (889)
T ss_pred ccccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccccccccchhhccCcccEEEEecccccccCCCHHHHh
Confidence 889999999999998743 2445566688889999999999999999999999988887643211
Q ss_pred c-cccccCCCCccccccee-cccccccccccccCCCCCchHHHH-HccCCCCCCCCCCCCcccccc---eeEeeeecccC
Q 037138 725 E-VPELIGNLKPFAKLQYL-HLRALPSLKSIYWNALPSHIWKKL-IMGCAGLKKLPLDSNSRKEHR---LVNRERRQKSG 798 (806)
Q Consensus 725 ~-ip~~~~~~~~~~~L~~L-~L~~~~~L~~l~~~~~~~~~L~~l-l~~c~~L~~L~l~~n~~~~~l---~~i~~~~~~~~ 798 (806)
. ... ....|.++..+ .+.+.+.++.+.+....++.++.+ +..||+|..+|...-..+... .......+|-.
T Consensus 794 ~~l~~---~i~~f~~~~~l~~~~~l~~l~~i~~~~l~~~~l~~~~ve~~p~l~~~P~~~~~~i~~~~~~~~~~~~~~~~~ 870 (889)
T KOG4658|consen 794 LELKE---LILPFNKLEGLRMLCSLGGLPQLYWLPLSFLKLEELIVEECPKLGKLPLLSTLTIVGCEEKLKEYPDGEWLE 870 (889)
T ss_pred hhccc---EEecccccccceeeecCCCCceeEecccCccchhheehhcCcccccCccccccceeccccceeecCCcccee
Confidence 1 111 12346677777 588888888888888899999999 999999999998754432221 12223345556
Q ss_pred CCcccc
Q 037138 799 GKSFDE 804 (806)
Q Consensus 799 ~~~~~~ 804 (806)
..+|++
T Consensus 871 ~v~~~~ 876 (889)
T KOG4658|consen 871 GVYWED 876 (889)
T ss_pred eEEehh
Confidence 666654
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PTZ00494 tuzin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 806 | ||||
| 2o6s_A | 208 | Structural Diversity Of The Hagfish Variable Lympho | 5e-04 | ||
| 3rfs_A | 272 | Design Of A Binding Scaffold Based On Variable Lymp | 6e-04 |
| >pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 | Back alignment and structure |
|
| >pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 806 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 4e-51 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 2e-50 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-42 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 8e-21 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-20 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-14 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-13 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-11 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 9e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-18 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-15 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-11 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-08 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-17 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-16 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-15 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-13 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-09 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-15 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 9e-15 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-14 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 6e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-15 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-11 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-11 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-09 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 4e-15 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 4e-15 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 1e-11 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 5e-09 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-15 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-11 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-11 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-11 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 7e-09 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-15 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 7e-14 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-12 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-10 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 5e-15 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 3e-12 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 1e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-15 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 8e-13 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-07 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 5e-15 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-14 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-13 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-13 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-14 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-13 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 8e-12 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 6e-10 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-04 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 4e-14 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 7e-07 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 7e-14 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-13 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 7e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 7e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 9e-14 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-13 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-13 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-13 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-12 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-11 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-13 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-08 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-13 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-13 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 4e-09 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 5e-13 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-11 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 5e-11 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 8e-13 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-11 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-10 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-08 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 1e-12 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-12 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-11 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-09 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 8e-09 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-12 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 4e-11 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-07 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-12 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-10 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-09 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 4e-12 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-11 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-09 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 5e-12 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 4e-08 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 7e-12 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-11 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 9e-12 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-11 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 5e-11 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-06 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 4e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 9e-12 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-11 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-10 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 4e-07 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 4e-04 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 2e-11 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 1e-10 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 3e-08 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 3e-08 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-11 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 1e-09 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 4e-09 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-09 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 3e-07 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-11 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-11 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-11 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-10 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 3e-11 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 2e-08 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 4e-11 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-10 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 8e-10 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 8e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 6e-11 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 1e-10 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 2e-06 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-10 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 9e-09 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-08 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-08 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-10 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-10 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-10 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-09 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 7e-07 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-10 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-10 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-09 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-06 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 2e-10 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 1e-09 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 3e-10 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 3e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 6e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 4e-04 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 9e-04 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 8e-10 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 4e-08 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 3e-06 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-09 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 5e-09 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 9e-09 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-09 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 3e-09 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 8e-08 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 3e-09 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 9e-08 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 6e-09 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 5e-08 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 7e-04 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 7e-09 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 1e-05 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 3e-08 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 5e-08 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 9e-08 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 2e-07 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 2e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-07 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 6e-07 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 1e-05 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 9e-07 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 3e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-05 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 3e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-04 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 3e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-04 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 2e-04 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 3e-04 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 4e-04 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 4e-04 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 5e-04 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 6e-04 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 9e-04 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
Score = 187 bits (475), Expect = 4e-51
Identities = 78/525 (14%), Positives = 158/525 (30%), Gaps = 69/525 (13%)
Query: 12 LEDNLDALLTELQKLIEAKNDVMTRVVNAEQQ-----QQLRRLNKVQGWLSRVEGAETEI 66
L L+ + + +A + + + E + RL ++ +L +E+
Sbjct: 10 LSTAHTRLIHDF-EPRDALTYLEGKNIFTEDHSELISKMSTRLERIANFLRIYRRQASEL 68
Query: 67 GELITDSTREIQKLCLGGYCSKNCKSSYKFGKKVAKKLHLVVTLMGEGAFELVAEKVPLA 126
G LI Q + Y L V + + + +++ K+ L
Sbjct: 69 GPLIDFFNYNNQSHL------ADFLEDYIDFAINEPDLLRPVVIAPQFSRQMLDRKLLLG 122
Query: 127 AVDARPVEPTIVGLNSTLEKVWRCL---GEERVGIIGLYGMGGVGKTTLLAQI-NNKFLD 182
V P + T +++V + L + + L+G G GK+ + +Q +
Sbjct: 123 NV---PKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQL 179
Query: 183 TPNDFDVVIWVVVSKD------MQLERIQEKIGERIGLLENRSLEERASGIFKI------ 230
++D ++W+ S I + LL S+E S + K
Sbjct: 180 IGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNAL 239
Query: 231 LSKKKFLLLLDDVWERIDLTKVGIPFPSKNTSKVVFTTR------------LIFKVECLR 278
+ + L + DDV + I + + + + TTR +V L
Sbjct: 240 IDRPNTLFVFDDVVQEET-----IRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLE 294
Query: 279 DKEAWELFLDKVGEETLDSHLDIPKLAHTLAKECGGLPLALITTG-LGCKKSQEEWSYAI 337
E ++ + + + + G P L+ K+ E+ +
Sbjct: 295 IDECYDFLEAYGMPMPVGEKE--EDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLN 352
Query: 338 EILRRSA-----SELPGMGKEVYPLLKFSYDSLSSEIFRSCLLYCSLFPEDCKIDKIELI 392
L P K + L+ + LS E RS L + + P I
Sbjct: 353 NKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDED-RSALAFAVVMPPGVDIPVKLWS 411
Query: 393 ECWIGEGFLNGYEGAEVHNQGYYIIGILVHACLLEEVGSDHV---RMHDAIRDMTLWIAC 449
+ N E + ++ + L L V ++ I +
Sbjct: 412 CVIPVDICSNEEEQLD--DEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVD 469
Query: 450 E--VEKEKENVLRRRISLMRNKIEKLSDTPTCPHLLSLFPNINRL 492
+ + +R + + N + H+ S F R
Sbjct: 470 AQTIANGISILEQRLLEIGNNNVSVPER-----HIPSHFQKFRRS 509
|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 806 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 100.0 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 100.0 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 100.0 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 100.0 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.89 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.88 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.87 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.87 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.86 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.86 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.86 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.86 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.86 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.86 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.85 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.85 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.85 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.85 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.85 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.85 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.85 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.85 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.85 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.85 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.85 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.85 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.85 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.84 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.84 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.84 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.84 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.84 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.84 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.84 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.83 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.83 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.83 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.83 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.83 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.82 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.82 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.82 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.81 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.81 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.8 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.8 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.8 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.8 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.8 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.78 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.78 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.77 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.77 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.76 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.76 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.76 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.75 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.75 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.74 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.74 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.73 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.73 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.73 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.73 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.72 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.72 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.72 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.71 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.71 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.71 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.71 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.71 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.7 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.7 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.69 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.69 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.68 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.67 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.67 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.67 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.67 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.66 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.64 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.63 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.63 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.63 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.63 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.63 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.61 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.61 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.59 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.59 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.59 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.59 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.58 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.58 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.57 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.57 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.57 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.57 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 99.57 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.56 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 99.56 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.55 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.54 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.53 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.53 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 99.53 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.53 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.52 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.51 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.49 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.49 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.48 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.47 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.46 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.46 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.45 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.41 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.41 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.41 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.4 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.4 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.38 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.38 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.37 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.36 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.36 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.36 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.36 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.33 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.33 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 99.33 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.32 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.32 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.32 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.29 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.28 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 99.27 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 99.26 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.24 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.22 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 99.21 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.2 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.19 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.18 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 99.15 | |
| 3qfl_A | 115 | MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- | 99.12 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 99.11 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.08 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.04 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.04 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 98.94 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.92 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.87 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 98.85 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 98.83 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.79 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.79 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 98.78 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.74 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.72 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 98.61 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.59 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.58 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 98.57 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 98.51 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 98.42 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 98.4 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 98.38 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 98.33 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 98.29 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.28 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 98.28 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 98.25 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.22 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 98.22 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.22 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.2 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 98.19 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 98.17 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 98.16 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 98.12 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 98.12 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 98.12 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 98.11 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 98.1 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.1 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 98.09 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 98.07 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 98.06 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 98.05 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 98.04 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 98.03 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 98.02 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 98.01 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.98 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 97.97 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.93 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.93 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 97.89 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.86 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 97.84 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.81 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.77 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 97.72 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.71 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.7 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 97.69 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 97.67 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.66 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 97.65 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.63 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 97.63 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 97.63 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 97.61 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.61 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 97.56 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 97.5 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 97.49 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 97.49 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 97.45 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 97.39 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 97.38 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 97.37 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 97.33 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.29 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.25 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 97.23 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 97.22 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 97.21 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.1 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 97.07 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 96.87 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.85 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.83 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 96.77 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.75 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.69 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 96.62 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 96.58 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 96.51 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 96.4 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.3 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 96.17 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 96.15 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 96.14 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.13 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 96.05 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 96.03 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.01 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 96.01 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 95.99 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 95.89 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 95.85 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 95.73 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 95.68 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 95.59 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 95.55 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 95.53 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 95.52 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 95.49 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 95.43 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 95.41 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 95.37 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 95.34 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 95.33 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 95.31 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 95.3 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 95.23 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.22 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 95.18 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 95.18 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 95.17 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 95.14 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 95.11 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 95.11 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 95.1 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 95.1 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 95.06 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 95.04 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 95.01 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 94.99 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 94.98 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 94.97 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 94.97 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 94.91 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 94.9 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 94.83 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 94.81 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 94.81 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 94.79 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 94.77 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 94.69 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 94.68 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 94.66 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 94.66 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 94.65 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 94.64 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 94.63 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 94.6 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 94.57 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 94.57 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 94.55 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 94.53 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 94.53 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 94.53 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 94.52 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 94.49 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 94.48 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 94.46 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 94.44 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 94.43 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 94.42 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 94.41 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 94.4 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 94.4 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 94.39 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 94.38 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 94.37 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 94.37 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 94.37 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 94.34 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 94.33 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 94.3 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 94.3 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 94.28 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 94.27 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 94.26 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 94.25 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 94.25 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 94.23 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 94.22 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 94.17 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 94.17 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 94.16 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 94.11 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 94.11 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 94.06 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 94.05 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 94.02 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 94.01 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 94.01 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 94.01 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 93.98 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 93.95 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 93.94 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 93.91 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 93.91 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 93.91 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 93.88 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 93.86 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 93.85 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 93.84 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 93.8 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 93.78 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 93.78 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 93.77 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 93.77 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 93.76 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 93.7 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 93.7 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 93.69 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 93.63 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 93.62 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 93.56 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 93.55 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 93.53 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 93.52 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 93.45 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 93.45 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 93.44 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 93.42 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 93.4 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 93.37 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 93.35 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 93.32 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 93.31 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 93.29 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 93.23 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 93.19 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 93.14 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 93.11 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 93.08 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 93.08 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 93.07 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 93.03 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 93.03 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 93.03 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.01 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 93.0 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 92.98 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.97 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 92.97 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 92.96 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 92.94 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 92.92 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 92.87 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 92.87 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 92.86 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.77 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 92.75 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.71 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 92.71 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 92.67 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 92.66 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 92.64 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.63 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 92.59 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 92.58 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 92.5 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 92.5 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 92.49 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 92.44 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 92.43 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 92.42 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 92.36 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 92.33 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 92.29 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 92.27 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 92.26 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 92.26 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 92.26 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 92.25 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 92.23 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 92.22 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 92.22 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 92.17 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 92.16 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 92.15 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 92.13 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 92.1 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 92.07 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 92.04 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 92.03 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 91.96 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 91.88 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 91.87 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 91.83 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 91.83 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 91.8 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 91.8 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 91.79 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 91.71 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 91.7 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 91.69 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 91.67 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 91.65 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 91.64 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 91.64 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 91.6 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 91.6 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 91.58 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 91.57 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 91.57 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 91.47 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 91.47 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 91.46 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 91.45 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 91.4 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 91.38 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 91.31 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 91.27 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 91.25 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 91.22 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 91.21 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 91.17 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 91.08 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 91.06 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 91.05 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 91.02 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 90.98 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 90.92 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 90.89 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 90.87 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 90.85 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 90.83 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 90.83 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 90.78 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 90.7 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 90.68 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 90.68 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 90.67 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 90.6 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 90.58 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 90.57 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 90.54 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 90.47 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 90.46 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 90.45 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 90.33 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 90.31 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 90.31 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 90.29 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 90.29 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 90.27 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 90.27 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 90.24 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 90.24 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 90.21 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.3e-47 Score=432.32 Aligned_cols=293 Identities=15% Similarity=0.110 Sum_probs=238.0
Q ss_pred ccchHHHHHHHHHhcCC---CceEEEEEccCCCCHHHHHHHHHh--hcCCCCCCCCeEEEEEeCCcc--cHHHHHHHHHH
Q 037138 138 VGLNSTLEKVWRCLGEE---RVGIIGLYGMGGVGKTTLLAQINN--KFLDTPNDFDVVIWVVVSKDM--QLERIQEKIGE 210 (806)
Q Consensus 138 ~gr~~~~~~l~~~l~~~---~~~vi~I~G~~GiGKTtLa~~v~~--~~~~~~~~F~~~~wv~~s~~~--~~~~~~~~i~~ 210 (806)
|||+.++++|.++|..+ .+++|+|+||||+||||||+++|+ +. ++..+|+.++||++++.+ ++..++..|+.
T Consensus 131 ~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~-~~~~~F~~~~wv~vs~~~~~~~~~~~~~il~ 209 (549)
T 2a5y_B 131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQ-LIGINYDSIVWLKDSGTAPKSTFDLFTDILL 209 (549)
T ss_dssp CCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSS-TBTTTBSEEEEEECCCCSTTHHHHHHHHHHH
T ss_pred CCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhH-HHhccCCcEEEEEECCCCCCCHHHHHHHHHH
Confidence 59999999999999643 689999999999999999999998 44 568999999999999985 89999999999
Q ss_pred HhCCCC---------CCCHHHHHHHHHHHhCCC-cEEEEEecCCCccCcccccccCCCCCCcEEEEecCC----------
Q 037138 211 RIGLLE---------NRSLEERASGIFKILSKK-KFLLLLDDVWERIDLTKVGIPFPSKNTSKVVFTTRL---------- 270 (806)
Q Consensus 211 ~l~~~~---------~~~~~~~~~~l~~~l~~k-~~LlvlDdv~~~~~~~~~~~~~~~~~~s~iivTtr~---------- 270 (806)
+++... ..+.......+++.|+++ |+||||||||+..++ .+ +..+||+||||||+
T Consensus 210 ~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~~----~~~~gs~ilvTTR~~~v~~~~~~~ 284 (549)
T 2a5y_B 210 MLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETI-RW----AQELRLRCLVTTRDVEISNAASQT 284 (549)
T ss_dssp HHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHH-HH----HHHTTCEEEEEESBGGGGGGCCSC
T ss_pred HHhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhh-cc----cccCCCEEEEEcCCHHHHHHcCCC
Confidence 998642 234566788999999996 999999999997644 11 11369999999998
Q ss_pred --ceecccCChHHHHHHHHhhhCCCccCCCCChHHHHHHHHHHhCCchHHHHHhh-hcCCCCHHHHHHHHHHHhhcccCC
Q 037138 271 --IFKVECLRDKEAWELFLDKVGEETLDSHLDIPKLAHTLAKECGGLPLALITTG-LGCKKSQEEWSYAIEILRRSASEL 347 (806)
Q Consensus 271 --~~~l~~L~~~e~~~lf~~~~~~~~~~~~~~~~~~~~~i~~~c~GlPlai~~~g-~~~~~~~~~w~~~l~~l~~~~~~~ 347 (806)
.|++++|+.+|||+||.+.++... .++.+++++++|+++|+|+||||+++| ....+ .|..+ +.+.+..+..
T Consensus 285 ~~~~~l~~L~~~ea~~Lf~~~a~~~~--~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~---~w~~~-~~l~~~l~~~ 358 (549)
T 2a5y_B 285 CEFIEVTSLEIDECYDFLEAYGMPMP--VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK---TFEKM-AQLNNKLESR 358 (549)
T ss_dssp EEEEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS---SHHHH-HHHHHHHHHH
T ss_pred CeEEECCCCCHHHHHHHHHHHhcCCC--CchhHHHHHHHHHHHhCCChHHHHHHHHHhccc---hHHHH-HHhHHHhhcc
Confidence 489999999999999999987653 246788899999999999999999999 33333 35544 4554443321
Q ss_pred CCCccchhhhhhhchhcCChhhHHHHHh-----------hhcCCCCCCcccHHHHHHHHHHc--CCccCCC-chhHHHhH
Q 037138 348 PGMGKEVYPLLKFSYDSLSSEIFRSCLL-----------YCSLFPEDCKIDKIELIECWIGE--GFLNGYE-GAEVHNQG 413 (806)
Q Consensus 348 ~~~~~~~~~~l~~sy~~L~~~~~k~cfl-----------~~~~fp~~~~i~~~~li~~Wia~--g~i~~~~-~~~~~~~~ 413 (806)
. ..++.+++.+||++||+ ++|.||+ |||+||+++.|+ +++|+|+ ||+...+ ....++.+
T Consensus 359 ~--~~~i~~~l~~Sy~~L~~-~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~~~~~~~ 431 (549)
T 2a5y_B 359 G--LVGVECITPYSYKSLAM-ALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQLDDEVA 431 (549)
T ss_dssp C--SSTTCCCSSSSSSSHHH-HHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CCCTHHHH
T ss_pred c--HHHHHHHHhcccccccH-HHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCCCHHHHH
Confidence 1 24799999999999998 8999999 999999999999 8999999 9998765 55566677
Q ss_pred HHHHHHHHHcccceee---CCCcEEehHHHHHHHHHHHhh
Q 037138 414 YYIIGILVHACLLEEV---GSDHVRMHDAIRDMTLWIACE 450 (806)
Q Consensus 414 ~~~~~~L~~~sll~~~---~~~~~~mHdlv~d~a~~~~~~ 450 (806)
+ ++++|+++||++.. ...+|+|||++|++|++++.+
T Consensus 432 ~-~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~ 470 (549)
T 2a5y_B 432 D-RLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDA 470 (549)
T ss_dssp H-HHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCT
T ss_pred H-HHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHH
Confidence 7 99999999999986 345799999999999987754
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 806 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 2e-32 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 8e-08 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 4e-07 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-07 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-06 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-06 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 6e-06 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-07 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 4e-05 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 9e-06 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 1e-05 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 7e-04 | |
| d1m9la_ | 198 | c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree | 1e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 2e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 2e-04 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 3e-04 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 3e-04 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 4e-04 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 0.003 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 9e-04 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.002 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.003 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 0.004 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 124 bits (313), Expect = 2e-32
Identities = 41/287 (14%), Positives = 91/287 (31%), Gaps = 46/287 (16%)
Query: 117 ELVAEKVPLAAVDARPVEPTIVGLNSTLEKVWRCL---GEERVGIIGLYGMGGVGKTTLL 173
+++ K+ L V P + T +++V + L + + L+G G GK+ +
Sbjct: 5 QMLDRKLLLGNV---PKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIA 61
Query: 174 AQI-NNKFLDTPNDFDVVIWVVVSKDMQLERIQEKIGERIGLL------------ENRSL 220
+Q + ++D ++W+ S + L S+
Sbjct: 62 SQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSV 121
Query: 221 EERASGIFKILSKKKFLLLLDDVWERIDLTKVGIPFPSKNTSKVVFTTRL---------- 270
+ ++ + L + DDV + I + + + + TTR
Sbjct: 122 VLKRMICNALIDRPNTLFVFDDVVQEET-----IRWAQELRLRCLVTTRDVEISNAASQT 176
Query: 271 --IFKVECLRDKEAWELFLDKVGEETLDSHLDIPKLAHTLAKECGGLPLALITTG-LGCK 327
+V L E ++ + + + + G P L+
Sbjct: 177 CEFIEVTSLEIDECYDFLEAYGMPMPVGEK--EEDVLNKTIELSSGNPATLMMFFKSCEP 234
Query: 328 KSQEEWSYAIEILRRSASELPGMGKEVYPLLKFSYDSLSSEIFRSCL 374
K+ E+ + L V + +SY SL+ + + C+
Sbjct: 235 KTFEKMAQLNNKLESRGLV------GVECITPYSYKSLAMAL-QRCV 274
|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 806 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 100.0 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.76 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.74 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.7 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.69 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.67 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.64 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.62 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.62 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.61 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.6 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.6 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.59 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.58 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.57 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.53 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.44 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.43 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.41 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.41 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.4 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.39 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.35 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.33 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.32 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.32 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.27 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.23 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.22 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.1 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.05 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 99.03 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.03 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.96 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.9 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 98.86 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.85 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 98.78 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 98.75 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 98.7 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.67 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.61 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 98.6 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 98.56 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 98.52 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 98.46 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.41 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.4 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.33 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.23 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 98.16 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.14 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 98.12 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.06 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.03 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.02 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.01 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.01 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.99 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.95 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.71 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.1 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 96.98 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.86 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.77 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.66 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.62 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.6 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.52 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.45 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.42 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 96.42 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.42 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.37 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 96.36 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 96.34 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 96.3 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.28 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.27 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 96.23 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.11 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 96.1 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.1 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.04 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 96.03 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.01 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 95.99 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.97 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 95.96 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 95.91 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.89 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.86 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.83 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 95.81 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.79 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 95.76 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.75 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 95.72 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.72 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.71 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 95.65 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 95.59 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.55 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 95.52 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.52 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 95.51 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.27 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.15 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 95.13 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 95.12 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 95.1 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 95.08 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 95.04 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.97 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.96 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 94.93 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.86 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 94.71 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 94.68 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 94.67 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 94.6 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 94.49 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 94.48 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 94.47 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 94.46 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 94.42 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 94.36 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 94.36 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 94.36 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 94.27 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 94.25 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 94.2 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 94.19 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 94.11 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 94.0 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 93.64 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 93.62 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 93.41 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 93.34 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 93.32 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 93.2 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 93.15 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 93.15 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 93.06 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 93.04 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 92.96 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 92.93 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 92.8 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 92.76 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 92.75 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 92.72 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 92.72 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 92.69 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 92.65 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 92.65 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 92.59 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.56 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 92.54 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 92.43 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 92.43 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 92.43 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 92.39 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 92.37 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.33 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 92.27 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 92.24 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 92.17 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 91.92 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 91.91 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 91.87 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 91.79 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 91.71 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 91.7 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 91.7 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 91.6 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 91.48 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 91.47 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 91.47 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 91.38 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 91.19 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 91.15 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 91.12 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 91.1 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 91.08 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 91.08 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 91.04 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 90.96 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 90.95 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 90.95 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 90.93 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 90.91 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 90.91 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 90.89 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 90.83 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 90.76 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 90.7 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 90.67 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 90.65 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 90.65 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 90.64 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 90.63 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 90.57 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 90.52 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 90.5 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 90.5 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 90.45 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 90.39 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 90.34 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 90.33 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 90.29 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 90.28 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 90.27 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 90.15 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 90.08 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 90.05 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 89.98 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 89.94 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 89.85 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 89.84 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 89.82 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 89.74 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 89.71 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 89.47 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 89.4 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 89.39 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 89.38 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 89.35 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 89.35 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 89.22 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 89.12 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 89.08 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 89.05 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 88.93 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 88.92 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 88.83 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 88.82 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 88.79 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 88.7 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 88.65 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 88.54 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 88.5 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 88.35 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 88.29 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 88.27 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 88.27 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 88.16 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 88.1 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 87.95 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 87.89 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 87.44 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 87.38 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 86.59 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 86.27 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 86.13 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 85.25 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 85.03 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 84.86 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 84.56 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 84.52 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 83.78 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 83.66 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 83.53 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 83.21 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 83.11 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 82.36 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 82.19 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 82.1 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 81.88 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 80.19 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00 E-value=3.4e-39 Score=329.31 Aligned_cols=230 Identities=16% Similarity=0.107 Sum_probs=187.0
Q ss_pred CCccccchHHHHHHHHHhc---CCCceEEEEEccCCCCHHHHHHHHHhhcC-CCCCCCCeEEEEEeCCcccHHHHHHHHH
Q 037138 134 EPTIVGLNSTLEKVWRCLG---EERVGIIGLYGMGGVGKTTLLAQINNKFL-DTPNDFDVVIWVVVSKDMQLERIQEKIG 209 (806)
Q Consensus 134 ~~~~~gr~~~~~~l~~~l~---~~~~~vi~I~G~~GiGKTtLa~~v~~~~~-~~~~~F~~~~wv~~s~~~~~~~~~~~i~ 209 (806)
.+.++||+.++++|+++|. +.+.++|+|+||||+||||||+++|++.. ....+|++++||+++..++...+...+.
T Consensus 19 ~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~ 98 (277)
T d2a5yb3 19 QMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTD 98 (277)
T ss_dssp CCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHH
T ss_pred CCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHHH
Confidence 4678999999999999984 35688999999999999999999999752 2567899999999999888776666554
Q ss_pred HH---hCCCC---------CCCHHHHHHHHHHHhCCCcEEEEEecCCCccCcccccccCCCCCCcEEEEecCC-------
Q 037138 210 ER---IGLLE---------NRSLEERASGIFKILSKKKFLLLLDDVWERIDLTKVGIPFPSKNTSKVVFTTRL------- 270 (806)
Q Consensus 210 ~~---l~~~~---------~~~~~~~~~~l~~~l~~k~~LlvlDdv~~~~~~~~~~~~~~~~~~s~iivTtr~------- 270 (806)
.. ++... ..........+.+.+.++|+|+||||||+..+|..+. ..||+||||||+
T Consensus 99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~-----~~~srilvTTR~~~v~~~~ 173 (277)
T d2a5yb3 99 ILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ-----ELRLRCLVTTRDVEISNAA 173 (277)
T ss_dssp HHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH-----HTTCEEEEEESBGGGGGGC
T ss_pred HHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhhhc-----ccCceEEEEeehHHHHHhc
Confidence 43 33221 1223334556778899999999999999988777543 248999999997
Q ss_pred -----ceecccCChHHHHHHHHhhhCCCccCCCCChHHHHHHHHHHhCCchHHHHHhh-hcCCCCHHHHHHHHHHHhhcc
Q 037138 271 -----IFKVECLRDKEAWELFLDKVGEETLDSHLDIPKLAHTLAKECGGLPLALITTG-LGCKKSQEEWSYAIEILRRSA 344 (806)
Q Consensus 271 -----~~~l~~L~~~e~~~lf~~~~~~~~~~~~~~~~~~~~~i~~~c~GlPlai~~~g-~~~~~~~~~w~~~l~~l~~~~ 344 (806)
.|++++|+.+|||+||+.+++... ..+..++++++|+++|+|+|||++++| ....++.++|.+..+.+.+..
T Consensus 174 ~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~--~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~ 251 (277)
T d2a5yb3 174 SQTCEFIEVTSLEIDECYDFLEAYGMPMP--VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRG 251 (277)
T ss_dssp CSCEEEEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHC
T ss_pred CCCCceEECCCCCHHHHHHHHHHHhCCcc--CchhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCc
Confidence 589999999999999999887553 234568899999999999999999999 556678999999888887643
Q ss_pred cCCCCCccchhhhhhhchhcCChhhHHHHHhhh
Q 037138 345 SELPGMGKEVYPLLKFSYDSLSSEIFRSCLLYC 377 (806)
Q Consensus 345 ~~~~~~~~~~~~~l~~sy~~L~~~~~k~cfl~~ 377 (806)
. .++..++.+||++||+ ++|.||.++
T Consensus 252 ~------~~v~~il~~sY~~L~~-~lk~c~~~l 277 (277)
T d2a5yb3 252 L------VGVECITPYSYKSLAM-ALQRCVEVL 277 (277)
T ss_dssp S------STTCCCSSSSSSSHHH-HHHHHHHTS
T ss_pred H------HHHHHHHHHHHhcccH-HHHHHHHhC
Confidence 2 4799999999999999 899999764
|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|