Citrus Sinensis ID: 037139
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 135 | ||||||
| 356565647 | 706 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.992 | 0.189 | 0.977 | 5e-74 | |
| 225443496 | 709 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.992 | 0.188 | 0.970 | 8e-74 | |
| 147774689 | 661 | hypothetical protein VITISV_005473 [Viti | 0.992 | 0.202 | 0.970 | 1e-73 | |
| 359475106 | 712 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.992 | 0.188 | 0.962 | 2e-73 | |
| 356522085 | 701 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.992 | 0.191 | 0.970 | 2e-73 | |
| 224135589 | 710 | predicted protein [Populus trichocarpa] | 0.992 | 0.188 | 0.962 | 4e-72 | |
| 297735665 | 688 | unnamed protein product [Vitis vinifera] | 0.985 | 0.193 | 0.954 | 2e-71 | |
| 358347102 | 781 | DEAD-box ATP-dependent RNA helicase [Med | 0.985 | 0.170 | 0.954 | 3e-71 | |
| 449455778 | 715 | PREDICTED: DEAD-box ATP-dependent RNA he | 0.992 | 0.187 | 0.932 | 5e-71 | |
| 449484526 | 715 | PREDICTED: LOW QUALITY PROTEIN: DEAD-box | 0.992 | 0.187 | 0.932 | 5e-71 |
| >gi|356565647|ref|XP_003551050.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 21-like isoform 1 [Glycine max] gi|356565649|ref|XP_003551051.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 21-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 281 bits (720), Expect = 5e-74, Method: Compositional matrix adjust.
Identities = 131/134 (97%), Positives = 133/134 (99%)
Query: 2 GYRVTTLHGGKSQEQREISLEGFRTKRYNVLVATDVAGRGIDIPDVAHVINYDMPGNIEM 61
GYRVTTLHGGKSQEQREISLEGFRTKRYNVLVATDVAGRGIDIPDVAHVINYDMPGNIEM
Sbjct: 573 GYRVTTLHGGKSQEQREISLEGFRTKRYNVLVATDVAGRGIDIPDVAHVINYDMPGNIEM 632
Query: 62 YTHRIGRTGRAGKTGVATTFLTFHDTDVFYDLKQMLIQSNSPVPPELAKHEASKFKPGTI 121
YTHRIGRTGRAGKTGVATTFLT HD+DVFYDLKQMLIQSNSPVPPELA+HEASKFKPGTI
Sbjct: 633 YTHRIGRTGRAGKTGVATTFLTLHDSDVFYDLKQMLIQSNSPVPPELARHEASKFKPGTI 692
Query: 122 PDRPPRRNDTVFAH 135
PDRPPRRNDTVFAH
Sbjct: 693 PDRPPRRNDTVFAH 706
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225443496|ref|XP_002270644.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 21-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147774689|emb|CAN74342.1| hypothetical protein VITISV_005473 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359475106|ref|XP_003631587.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 21-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356522085|ref|XP_003529680.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 21-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224135589|ref|XP_002322111.1| predicted protein [Populus trichocarpa] gi|222869107|gb|EEF06238.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297735665|emb|CBI18352.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|358347102|ref|XP_003637601.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi|355503536|gb|AES84739.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449455778|ref|XP_004145628.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 21-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449484526|ref|XP_004156907.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 21-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 135 | ||||||
| TAIR|locus:2057640 | 733 | AT2G33730 [Arabidopsis thalian | 0.977 | 0.180 | 0.878 | 1.6e-61 | |
| ZFIN|ZDB-GENE-030131-6215 | 807 | ddx23 "DEAD (Asp-Glu-Ala-Asp) | 0.985 | 0.164 | 0.607 | 5.4e-37 | |
| RGD|1308685 | 819 | Ddx23 "DEAD (Asp-Glu-Ala-Asp) | 0.985 | 0.162 | 0.6 | 2e-36 | |
| UNIPROTKB|A6QLB2 | 820 | DDX23 "Uncharacterized protein | 0.985 | 0.162 | 0.6 | 2e-36 | |
| UNIPROTKB|E2RTL6 | 820 | DDX23 "Uncharacterized protein | 0.985 | 0.162 | 0.6 | 2e-36 | |
| UNIPROTKB|Q9BUQ8 | 820 | DDX23 "Probable ATP-dependent | 0.985 | 0.162 | 0.6 | 2e-36 | |
| GENEDB_PFALCIPARUM|PFE0925c | 1123 | PFE0925c "snrnp protein, putat | 0.962 | 0.115 | 0.572 | 7.9e-35 | |
| UNIPROTKB|Q8I0W7 | 1123 | PFE0925c "Snrnp protein, putat | 0.962 | 0.115 | 0.572 | 7.9e-35 | |
| WB|WBGene00017162 | 730 | ddx-23 [Caenorhabditis elegans | 0.977 | 0.180 | 0.559 | 1.2e-33 | |
| FB|FBgn0032690 | 822 | CG10333 [Drosophila melanogast | 0.970 | 0.159 | 0.583 | 1.3e-33 |
| TAIR|locus:2057640 AT2G33730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 629 (226.5 bits), Expect = 1.6e-61, P = 1.6e-61
Identities = 116/132 (87%), Positives = 126/132 (95%)
Query: 2 GYRVTTLHGGKSQEQREISLEGFRTKRYNVLVATDVAGRGIDIPDVAHVINYDMPGNIEM 61
GYRVTTLHGGKSQEQREISLEGFR KRYNVLVATDV GRGIDIPDVAHVINYDMP +IEM
Sbjct: 600 GYRVTTLHGGKSQEQREISLEGFRAKRYNVLVATDVVGRGIDIPDVAHVINYDMPKHIEM 659
Query: 62 YTHRIGRTGRAGKTGVATTFLTFHDTDVFYDLKQMLIQSNSPVPPELAKHEASKFKPGTI 121
YTHRIGRTGRAGK+GVAT+FLT HDT+VFYDLKQML+QSNS VPPELA+HEAS+FKPGT+
Sbjct: 660 YTHRIGRTGRAGKSGVATSFLTLHDTEVFYDLKQMLVQSNSAVPPELARHEASRFKPGTV 719
Query: 122 PDRPPRRNDTVF 133
PDRPPR +DTV+
Sbjct: 720 PDRPPRHSDTVY 731
|
|
| ZFIN|ZDB-GENE-030131-6215 ddx23 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 23" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1308685 Ddx23 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 23" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QLB2 DDX23 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RTL6 DDX23 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BUQ8 DDX23 "Probable ATP-dependent RNA helicase DDX23" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PFE0925c PFE0925c "snrnp protein, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8I0W7 PFE0925c "Snrnp protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00017162 ddx-23 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032690 CG10333 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00029727001 | SubName- Full=Chromosome chr9 scaffold_49, whole genome shotgun sequence; (406 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 135 | |||
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 7e-39 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 3e-35 | |
| cd00079 | 131 | cd00079, HELICc, Helicase superfamily c-terminal d | 1e-34 | |
| pfam00271 | 78 | pfam00271, Helicase_C, Helicase conserved C-termin | 5e-34 | |
| smart00490 | 82 | smart00490, HELICc, helicase superfamily c-termina | 4e-32 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-30 | |
| PRK04837 | 423 | PRK04837, PRK04837, ATP-dependent RNA helicase Rhl | 4e-26 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 4e-25 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 9e-24 | |
| PTZ00424 | 401 | PTZ00424, PTZ00424, helicase 45; Provisional | 2e-23 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 8e-23 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 2e-22 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 1e-20 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 2e-18 | |
| COG0514 | 590 | COG0514, RecQ, Superfamily II DNA helicase [DNA re | 5e-16 | |
| TIGR01389 | 591 | TIGR01389, recQ, ATP-dependent DNA helicase RecQ | 2e-15 | |
| TIGR00614 | 470 | TIGR00614, recQ_fam, ATP-dependent DNA helicase, R | 2e-12 | |
| COG1111 | 542 | COG1111, MPH1, ERCC4-like helicases [DNA replicati | 2e-12 | |
| PRK13766 | 773 | PRK13766, PRK13766, Hef nuclease; Provisional | 8e-12 | |
| PRK11057 | 607 | PRK11057, PRK11057, ATP-dependent DNA helicase Rec | 4e-10 | |
| PLN03137 | 1195 | PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 | 1e-08 | |
| TIGR00580 | 926 | TIGR00580, mfd, transcription-repair coupling fact | 8e-07 | |
| COG1205 | 851 | COG1205, COG1205, Distinct helicase family with a | 2e-06 | |
| COG1061 | 442 | COG1061, SSL2, DNA or RNA helicases of superfamily | 2e-06 | |
| COG1197 | 1139 | COG1197, Mfd, Transcription-repair coupling factor | 2e-05 | |
| PRK09200 | 790 | PRK09200, PRK09200, preprotein translocase subunit | 3e-05 | |
| TIGR03714 | 762 | TIGR03714, secA2, accessory Sec system translocase | 1e-04 | |
| COG1200 | 677 | COG1200, RecG, RecG-like helicase [DNA replication | 7e-04 | |
| COG1201 | 814 | COG1201, Lhr, Lhr-like helicases [General function | 8e-04 | |
| TIGR00643 | 630 | TIGR00643, recG, ATP-dependent DNA helicase RecG | 0.001 | |
| PRK12899 | 970 | PRK12899, secA, preprotein translocase subunit Sec | 0.001 | |
| PRK01172 | 674 | PRK01172, PRK01172, ski2-like helicase; Provisiona | 0.003 |
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Score = 136 bits (344), Expect = 7e-39
Identities = 53/128 (41%), Positives = 75/128 (58%), Gaps = 4/128 (3%)
Query: 1 LGYRVTTLHGGKSQEQREISLEGFRTKRYNVLVATDVAGRGIDIPDVAHVINYDMPGNIE 60
G++V LHG QE+R+ +LE F+ VLVATDVA RG+DIPDV+HVINYD+P + E
Sbjct: 296 RGFKVAALHGDLPQEERDRALEKFKDGELRVLVATDVAARGLDIPDVSHVINYDLPLDPE 355
Query: 61 MYTHRIGRTGRAGKTGVATTFLTFH-DTDVFYDLKQML---IQSNSPVPPELAKHEASKF 116
Y HRIGRTGRAG+ GVA +F+T + +++ L + S +P + +
Sbjct: 356 DYVHRIGRTGRAGRKGVAISFVTEEEEVKKLKRIEKRLERKLPSAVLLPLDEPEDAKLLK 415
Query: 117 KPGTIPDR 124
+
Sbjct: 416 TTRPGLEE 423
|
Length = 513 |
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233032 TIGR00580, mfd, transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224118 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|236408 PRK09200, PRK09200, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|163426 TIGR03714, secA2, accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >gnl|CDD|224121 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >gnl|CDD|237254 PRK12899, secA, preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 135 | |||
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 99.95 | |
| KOG0328 | 400 | consensus Predicted ATP-dependent RNA helicase FAL | 99.95 | |
| KOG0331 | 519 | consensus ATP-dependent RNA helicase [RNA processi | 99.94 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.94 | |
| PTZ00110 | 545 | helicase; Provisional | 99.94 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.93 | |
| KOG0330 | 476 | consensus ATP-dependent RNA helicase [RNA processi | 99.93 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.92 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 99.92 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 99.92 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.92 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.91 | |
| KOG0326 | 459 | consensus ATP-dependent RNA helicase [RNA processi | 99.91 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.91 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.91 | |
| KOG0340 | 442 | consensus ATP-dependent RNA helicase [RNA processi | 99.91 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.91 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.91 | |
| KOG0341 | 610 | consensus DEAD-box protein abstrakt [RNA processin | 99.91 | |
| KOG0344 | 593 | consensus ATP-dependent RNA helicase [RNA processi | 99.9 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.9 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.9 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.9 | |
| KOG0332 | 477 | consensus ATP-dependent RNA helicase [RNA processi | 99.9 | |
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 99.89 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.89 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.88 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.87 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.87 | |
| KOG0338 | 691 | consensus ATP-dependent RNA helicase [RNA processi | 99.87 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 99.87 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 99.86 | |
| KOG0348 | 708 | consensus ATP-dependent RNA helicase [RNA processi | 99.85 | |
| KOG0327 | 397 | consensus Translation initiation factor 4F, helica | 99.85 | |
| KOG0350 | 620 | consensus DEAD-box ATP-dependent RNA helicase [RNA | 99.84 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.84 | |
| KOG0343 | 758 | consensus RNA Helicase [RNA processing and modific | 99.83 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.83 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.81 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.81 | |
| KOG0347 | 731 | consensus RNA helicase [RNA processing and modific | 99.81 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 99.8 | |
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 99.8 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.79 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.79 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.78 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.78 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 99.77 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.76 | |
| KOG0334 | 997 | consensus RNA helicase [RNA processing and modific | 99.76 | |
| cd00079 | 131 | HELICc Helicase superfamily c-terminal domain; ass | 99.76 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 99.75 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.73 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 99.73 | |
| KOG0346 | 569 | consensus RNA helicase [RNA processing and modific | 99.73 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.72 | |
| KOG0351 | 941 | consensus ATP-dependent DNA helicase [Replication, | 99.72 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.71 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.7 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 99.69 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.69 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.68 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.68 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.68 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.67 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.66 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.65 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.64 | |
| KOG0352 | 641 | consensus ATP-dependent DNA helicase [Replication, | 99.63 | |
| KOG0349 | 725 | consensus Putative DEAD-box RNA helicase DDX1 [RNA | 99.61 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.6 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.6 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.58 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 99.54 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 99.54 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 99.51 | |
| KOG0337 | 529 | consensus ATP-dependent RNA helicase [RNA processi | 99.51 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.5 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.49 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.49 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.48 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.47 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 99.42 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.41 | |
| KOG0329 | 387 | consensus ATP-dependent RNA helicase [RNA processi | 99.4 | |
| KOG0353 | 695 | consensus ATP-dependent DNA helicase [General func | 99.37 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 99.36 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.34 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.33 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 99.33 | |
| KOG0953 | 700 | consensus Mitochondrial RNA helicase SUV3, DEAD-bo | 99.33 | |
| KOG0950 | 1008 | consensus DNA polymerase theta/eta, DEAD-box super | 99.33 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.3 | |
| KOG0947 | 1248 | consensus Cytoplasmic exosomal RNA helicase SKI2, | 99.24 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.24 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 99.24 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.23 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 99.2 | |
| KOG4150 | 1034 | consensus Predicted ATP-dependent RNA helicase [RN | 99.16 | |
| KOG0948 | 1041 | consensus Nuclear exosomal RNA helicase MTR4, DEAD | 99.16 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 99.15 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.14 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 99.1 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 99.06 | |
| KOG0949 | 1330 | consensus Predicted helicase, DEAD-box superfamily | 99.04 | |
| KOG0922 | 674 | consensus DEAH-box RNA helicase [RNA processing an | 99.02 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 99.01 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 99.01 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 98.97 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 98.95 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 98.95 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 98.94 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 98.93 | |
| KOG0923 | 902 | consensus mRNA splicing factor ATP-dependent RNA h | 98.92 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 98.86 | |
| KOG0920 | 924 | consensus ATP-dependent RNA helicase A [RNA proces | 98.86 | |
| KOG0926 | 1172 | consensus DEAH-box RNA helicase [RNA processing an | 98.81 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 98.62 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 98.43 | |
| KOG0387 | 923 | consensus Transcription-coupled repair protein CSB | 98.35 | |
| KOG0384 | 1373 | consensus Chromodomain-helicase DNA-binding protei | 98.29 | |
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 98.12 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 98.11 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 98.04 | |
| KOG1123 | 776 | consensus RNA polymerase II transcription initiati | 98.02 | |
| KOG0392 | 1549 | consensus SNF2 family DNA-dependent ATPase domain- | 98.01 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 98.0 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 97.91 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 97.91 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 97.87 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 97.84 | |
| PF13871 | 278 | Helicase_C_4: Helicase_C-like | 97.71 | |
| KOG0388 | 1185 | consensus SNF2 family DNA-dependent ATPase [Replic | 97.67 | |
| KOG4439 | 901 | consensus RNA polymerase II transcription terminat | 97.64 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 97.63 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 97.63 | |
| KOG0925 | 699 | consensus mRNA splicing factor ATP-dependent RNA h | 97.6 | |
| PF13307 | 167 | Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 | 97.56 | |
| smart00492 | 141 | HELICc3 helicase superfamily c-terminal domain. | 97.55 | |
| KOG0389 | 941 | consensus SNF2 family DNA-dependent ATPase [Chroma | 97.41 | |
| smart00491 | 142 | HELICc2 helicase superfamily c-terminal domain. | 97.34 | |
| KOG0391 | 1958 | consensus SNF2 family DNA-dependent ATPase [Genera | 97.22 | |
| KOG1000 | 689 | consensus Chromatin remodeling protein HARP/SMARCA | 97.06 | |
| KOG0386 | 1157 | consensus Chromatin remodeling complex SWI/SNF, co | 97.05 | |
| KOG1015 | 1567 | consensus Transcription regulator XNP/ATRX, DEAD-b | 97.04 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.04 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 96.95 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 96.91 | |
| PF10593 | 239 | Z1: Z1 domain; InterPro: IPR018310 This entry repr | 96.78 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 96.77 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 96.77 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 96.68 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 96.64 | |
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 96.63 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.48 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 96.48 | |
| KOG0701 | 1606 | consensus dsRNA-specific nuclease Dicer and relate | 96.36 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 96.07 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 95.58 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 95.58 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 95.5 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 95.43 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 95.28 | |
| KOG1016 | 1387 | consensus Predicted DNA helicase, DEAD-box superfa | 95.19 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 95.16 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 95.1 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 95.08 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 94.97 | |
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 94.89 | |
| KOG0951 | 1674 | consensus RNA helicase BRR2, DEAD-box superfamily | 94.87 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 94.85 | |
| KOG1513 | 1300 | consensus Nuclear helicase MOP-3/SNO (DEAD-box sup | 94.82 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 94.73 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 93.7 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 92.74 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 92.69 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 92.57 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 88.95 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 88.36 | |
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 88.21 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 88.2 | |
| KOG0339 | 731 | consensus ATP-dependent RNA helicase [RNA processi | 87.15 | |
| COG3587 | 985 | Restriction endonuclease [Defense mechanisms] | 85.72 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 85.25 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 84.63 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 84.62 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 83.37 | |
| KOG1133 | 821 | consensus Helicase of the DEAD superfamily [Replic | 82.92 |
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=99.95 E-value=6e-28 Score=183.77 Aligned_cols=133 Identities=64% Similarity=0.952 Sum_probs=124.9
Q ss_pred CCceEEEecCCCCHHHHHHHHHHHhcCCCcEEEecCCCcccccccCCcEEEEecCCCCHHHHHHHhhhcCCCCCCceEEE
Q 037139 1 LGYRVTTLHGGKSQEQREISLEGFRTKRYNVLVATDVAGRGIDIPDVAHVINYDMPGNIEMYTHRIGRTGRAGKTGVATT 80 (135)
Q Consensus 1 ~g~~v~~~hg~~~~~~r~~~~~~f~~g~~~ilv~T~~~~~G~d~~~v~~vi~~d~p~~~~~~~qr~GR~gR~~~~g~~~~ 80 (135)
.|+.+..+||+-++++|+.+++.|++|..+||||||++++|+|+|+|++|||||++++..+|.||+||+||.|+.|.+++
T Consensus 540 ~g~~~~tlHg~k~qeQRe~aL~~fr~~t~dIlVaTDvAgRGIDIpnVSlVinydmaksieDYtHRIGRTgRAGk~GtaiS 619 (673)
T KOG0333|consen 540 AGYKVTTLHGGKSQEQRENALADFREGTGDILVATDVAGRGIDIPNVSLVINYDMAKSIEDYTHRIGRTGRAGKSGTAIS 619 (673)
T ss_pred ccceEEEeeCCccHHHHHHHHHHHHhcCCCEEEEecccccCCCCCccceeeecchhhhHHHHHHHhccccccccCceeEE
Confidence 47899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EeecCChhHHHHHHHHHh-hCCCCCChHHHHHHHhhCCCCCCCCCCCCCCCcccc
Q 037139 81 FLTFHDTDVFYDLKQMLI-QSNSPVPPELAKHEASKFKPGTIPDRPPRRNDTVFA 134 (135)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~ 134 (135)
|+++.+...++.|+..+. ....-.|..+..+....+++..+.... +.++.||+
T Consensus 620 flt~~dt~v~ydLkq~l~es~~s~~P~Ela~h~~a~~K~~~~~~k~-~~~e~i~~ 673 (673)
T KOG0333|consen 620 FLTPADTAVFYDLKQALRESVKSHCPPELANHPDAQFKPGTIKAKK-REPETIRY 673 (673)
T ss_pred EeccchhHHHHHHHHHHHHhhhccCChhhccChhhccccccccccc-cCcccccC
Confidence 999999999988888776 678889999999999999999999888 66777763
|
|
| >KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >KOG0343 consensus RNA Helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >KOG0347 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >KOG0334 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0346 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF13871 Helicase_C_4: Helicase_C-like | Back alignment and domain information |
|---|
| >KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A | Back alignment and domain information |
|---|
| >smart00492 HELICc3 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00491 HELICc2 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG3587 Restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 135 | ||||
| 2p6n_A | 191 | Human Dead-box Rna Helicase Ddx41, Helicase Domain | 5e-29 | ||
| 2jgn_A | 185 | Ddx3 Helicase Domain Length = 185 | 6e-26 | ||
| 2i4i_A | 417 | Crystal Structure Of Human Dead-Box Rna Helicase Dd | 1e-25 | ||
| 2j0u_A | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 4e-21 | ||
| 2j0u_B | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 4e-21 | ||
| 2hyi_C | 413 | Structure Of The Human Exon Junction Complex With A | 7e-21 | ||
| 2j0q_A | 410 | The Crystal Structure Of The Exon Junction Complex | 7e-21 | ||
| 2hxy_A | 391 | Crystal Structure Of Human Apo-Eif4aiii Length = 39 | 7e-21 | ||
| 2xb2_A | 411 | Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar | 7e-21 | ||
| 2db3_A | 434 | Structural Basis For Rna Unwinding By The Dead-Box | 1e-20 | ||
| 2hjv_A | 163 | Structure Of The Second Domain (Residues 207-368) O | 3e-19 | ||
| 1hv8_A | 367 | Crystal Structure Of A Dead Box Protein From The Hy | 3e-19 | ||
| 2yjt_D | 170 | Crystal Structure Of E. Coli Dead-Box Protein Srmb | 3e-18 | ||
| 3pey_A | 395 | S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length | 6e-17 | ||
| 3pew_A | 395 | S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 | 6e-17 | ||
| 2kbf_A | 187 | Solution Structure Of Carboxyl-Terminal Domain Of D | 2e-16 | ||
| 3gfp_A | 189 | Structure Of The C-Terminal Domain Of The Dead-Box | 2e-16 | ||
| 3peu_A | 188 | S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To | 2e-16 | ||
| 2z0m_A | 337 | Crystal Structure Of Hypothetical Atp-Dependent Rna | 4e-16 | ||
| 2wax_A | 193 | Structure Of The Human Ddx6 C-Terminal Domain In Co | 2e-15 | ||
| 1s2m_A | 400 | Crystal Structure Of The Dead Box Protein Dhh1p Len | 2e-15 | ||
| 3fmp_B | 479 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 1e-14 | ||
| 3ews_A | 445 | Human Dead-Box Rna-Helicase Ddx19 In Complex With A | 2e-14 | ||
| 3g0h_A | 424 | Human Dead-box Rna Helicase Ddx19, In Complex With | 2e-14 | ||
| 3fht_A | 412 | Crystal Structure Of Human Dbp5 In Complex With Amp | 2e-14 | ||
| 3fho_B | 508 | Structure Of S. Pombe Dbp5 Length = 508 | 2e-13 | ||
| 1t5i_A | 172 | Crystal Structure Of The C-Terminal Domain Of Uap56 | 2e-13 | ||
| 1xti_A | 391 | Structure Of Wildtype Human Uap56 Length = 391 | 2e-13 | ||
| 1xtk_A | 390 | Structure Of Decd To Dead Mutation Of Human Uap56 L | 2e-13 | ||
| 1xtj_A | 386 | Structure Of Human Uap56 In Complex With Adp Length | 2e-13 | ||
| 2rb4_A | 175 | Crystal Structure Of The Helicase Domain Of Human D | 3e-13 | ||
| 4db4_A | 256 | Mss116p Dead-Box Helicase Domain 2 Bound To A Chima | 4e-12 | ||
| 4db2_C | 257 | Mss116p Dead-Box Helicase Domain 2 Bound To An Rna | 4e-12 | ||
| 4db2_A | 257 | Mss116p Dead-Box Helicase Domain 2 Bound To An Rna | 4e-12 | ||
| 3eiq_A | 414 | Crystal Structure Of Pdcd4-eif4a Length = 414 | 7e-12 | ||
| 2zu6_A | 388 | Crystal Structure Of The Eif4a-Pdcd4 Complex Length | 7e-12 | ||
| 3sqx_A | 512 | Structure Of Mss116p (Nte And C-Tail Double Deletio | 8e-12 | ||
| 3sqw_A | 579 | Structure Of Mss116p (Nte Deletion) Bound To Ssrna | 1e-11 | ||
| 3i5x_A | 563 | Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len | 1e-11 | ||
| 2vso_A | 395 | Crystal Structure Of A Translation Initiation Compl | 2e-11 | ||
| 1fuk_A | 165 | Crystal Structure Of The Carboxy Terminal Domain Of | 2e-11 | ||
| 3i32_A | 300 | Dimeric Structure Of A Hera Helicase Fragment Inclu | 3e-11 | ||
| 3eaq_A | 212 | Novel Dimerization Motif In The Dead Box Rna Helica | 6e-11 | ||
| 1fuu_A | 394 | Yeast Initiation Factor 4a Length = 394 | 7e-11 | ||
| 1oyy_A | 523 | Structure Of The Recq Catalytic Core Bound To Atp-G | 6e-08 | ||
| 1oyw_A | 523 | Structure Of The Recq Catalytic Core Length = 523 | 1e-07 | ||
| 2fwr_A | 472 | Structure Of Archaeoglobus Fulgidis Xpb Length = 47 | 9e-07 | ||
| 2fzl_A | 219 | Structure Of C-Terminal Domain Of Archaeoglobus Ful | 1e-06 | ||
| 1wp9_A | 494 | Crystal Structure Of Pyrococcus Furiosus Hef Helica | 7e-06 | ||
| 2v1x_A | 591 | Crystal Structure Of Human Recq-Like Dna Helicase L | 3e-05 | ||
| 1gm5_A | 780 | Structure Of Recg Bound To Three-Way Dna Junction L | 5e-05 | ||
| 2va8_A | 715 | Dna Repair Helicase Hel308 Length = 715 | 1e-04 |
| >pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 | Back alignment and structure |
|
| >pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 | Back alignment and structure |
| >pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 | Back alignment and structure |
| >pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 | Back alignment and structure |
| >pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 | Back alignment and structure |
| >pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 | Back alignment and structure |
| >pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 | Back alignment and structure |
| >pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 | Back alignment and structure |
| >pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 | Back alignment and structure |
| >pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 | Back alignment and structure |
| >pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 | Back alignment and structure |
| >pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 | Back alignment and structure |
| >pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 | Back alignment and structure |
| >pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 | Back alignment and structure |
| >pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 | Back alignment and structure |
| >pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 | Back alignment and structure |
| >pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 | Back alignment and structure |
| >pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 | Back alignment and structure |
| >pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 | Back alignment and structure |
| >pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 | Back alignment and structure |
| >pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 | Back alignment and structure |
| >pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 | Back alignment and structure |
| >pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 | Back alignment and structure |
| >pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 | Back alignment and structure |
| >pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 | Back alignment and structure |
| >pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 | Back alignment and structure |
| >pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 | Back alignment and structure |
| >pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 | Back alignment and structure |
| >pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 | Back alignment and structure |
| >pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 | Back alignment and structure |
| >pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 | Back alignment and structure |
| >pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 | Back alignment and structure |
| >pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 | Back alignment and structure |
| >pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 | Back alignment and structure |
| >pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 | Back alignment and structure |
| >pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 | Back alignment and structure |
| >pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 | Back alignment and structure |
| >pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 | Back alignment and structure |
| >pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 | Back alignment and structure |
| >pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 | Back alignment and structure |
| >pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 | Back alignment and structure |
| >pdb|2FWR|A Chain A, Structure Of Archaeoglobus Fulgidis Xpb Length = 472 | Back alignment and structure |
| >pdb|2FZL|A Chain A, Structure Of C-Terminal Domain Of Archaeoglobus Fulgidus Xpb Length = 219 | Back alignment and structure |
| >pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 | Back alignment and structure |
| >pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 | Back alignment and structure |
| >pdb|1GM5|A Chain A, Structure Of Recg Bound To Three-Way Dna Junction Length = 780 | Back alignment and structure |
| >pdb|2VA8|A Chain A, Dna Repair Helicase Hel308 Length = 715 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 135 | |||
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 3e-64 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 2e-61 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 1e-60 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 6e-56 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 3e-44 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 4e-44 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 1e-42 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 2e-42 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 2e-42 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 5e-42 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 1e-41 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 3e-41 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 2e-40 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 3e-40 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 3e-40 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 4e-40 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 4e-40 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 2e-39 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 3e-39 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 3e-39 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 5e-39 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 2e-38 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 3e-37 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 2e-36 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 9e-25 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 4e-22 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 6e-16 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 5e-14 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 7e-14 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 1e-13 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 1e-12 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 1e-12 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 2e-12 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 2e-10 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 4e-09 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 5e-09 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 1e-07 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 1e-04 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 4e-04 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 7e-04 |
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
Score = 193 bits (492), Expect = 3e-64
Identities = 57/110 (51%), Positives = 73/110 (66%), Gaps = 1/110 (0%)
Query: 2 GYRVTTLHGGKSQEQREISLEGFRTKRYNVLVATDVAGRGIDIPDVAHVINYDMPGNIEM 61
G +HGGK QE+R ++E FR + +VLVATDVA +G+D P + HVINYDMP IE
Sbjct: 78 GVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGLDFPAIQHVINYDMPEEIEN 137
Query: 62 YTHRIGRTGRAGKTGVATTFLTFH-DTDVFYDLKQMLIQSNSPVPPELAK 110
Y HRIGRTG +G TG+ATTF+ D V DLK +L+++ VPP L
Sbjct: 138 YVHRIGRTGCSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQV 187
|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Length = 1151 | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 135 | |||
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 99.95 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 99.95 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 99.95 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 99.94 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 99.94 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 99.94 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 99.94 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.94 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.93 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.93 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 99.85 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.91 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.91 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.91 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.9 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.9 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.89 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.89 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.89 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.88 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.88 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.88 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.87 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.87 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.86 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.84 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.83 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.82 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.81 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 99.81 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.81 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 99.81 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.8 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.8 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.79 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.79 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.79 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.79 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.79 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.79 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.78 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.78 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.77 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.77 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.77 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 99.77 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.76 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.75 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.74 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.74 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.73 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.73 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 99.72 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.72 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.72 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.71 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.7 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.7 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.7 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.7 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.69 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 99.69 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.66 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.65 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.64 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 99.64 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.63 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.59 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 99.57 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.18 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 97.8 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 97.42 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 96.77 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 95.15 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 94.56 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 94.42 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 90.15 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 89.97 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 84.09 |
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.95 E-value=4.7e-28 Score=166.22 Aligned_cols=112 Identities=46% Similarity=0.792 Sum_probs=93.6
Q ss_pred CceEEEecCCCCHHHHHHHHHHHhcCCCcEEEecCCCcccccccCCcEEEEecCCCCHHHHHHHhhhcCCCCCCceEEEE
Q 037139 2 GYRVTTLHGGKSQEQREISLEGFRTKRYNVLVATDVAGRGIDIPDVAHVINYDMPGNIEMYTHRIGRTGRAGKTGVATTF 81 (135)
Q Consensus 2 g~~v~~~hg~~~~~~r~~~~~~f~~g~~~ilv~T~~~~~G~d~~~v~~vi~~d~p~~~~~~~qr~GR~gR~~~~g~~~~~ 81 (135)
|+.+..+||+|++.+|..++++|++|+++|||||+++++|+|+|++++||++|+|++...|+||+||+||.|+.|.++++
T Consensus 70 g~~~~~lhg~~~~~~r~~~~~~f~~g~~~vLvaT~~~~~Gldi~~~~~VI~~d~p~s~~~~~Qr~GR~~R~g~~g~~~~~ 149 (185)
T 2jgn_A 70 GYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSF 149 (185)
T ss_dssp TCCEEEEC--------CHHHHHHHHTSSSEEEEEC------CCCSBSEEEESSCCSSHHHHHHHHTTBCCTTSCEEEEEE
T ss_pred CCceEEEeCCCCHHHHHHHHHHHHcCCCeEEEEcChhhcCCCcccCCEEEEeCCCCCHHHHHHHccccCCCCCCcEEEEE
Confidence 68899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eecCChhHHHHHHHHHhhCCCCCChHHHHHHH
Q 037139 82 LTFHDTDVFYDLKQMLIQSNSPVPPELAKHEA 113 (135)
Q Consensus 82 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~ 113 (135)
+.+.+...++.+.+.+.....++|+++..+..
T Consensus 150 ~~~~~~~~~~~l~~~l~~~~~~~~~~l~~~a~ 181 (185)
T 2jgn_A 150 FNERNINITKDLLDLLVEAKQEVPSWLENMAY 181 (185)
T ss_dssp ECGGGGGGHHHHHHHHHHTTCCCCHHHHHHHC
T ss_pred EchhhHHHHHHHHHHHHhccCCCCHHHHHHHH
Confidence 99999999999999999999999999887643
|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 135 | ||||
| d1a1va2 | 299 | c.37.1.14 (A:326-624) HCV helicase domain {Human h | 3e-26 | |
| d1wp9a2 | 286 | c.37.1.19 (A:201-486) putative ATP-dependent RNA h | 1e-23 | |
| d1gkub2 | 248 | c.37.1.16 (B:251-498) Helicase-like "domain" of re | 3e-23 | |
| d1fuka_ | 162 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 2e-22 | |
| d2j0sa2 | 168 | c.37.1.19 (A:244-411) Probable ATP-dependent RNA h | 8e-19 | |
| d2fwra1 | 200 | c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar | 1e-17 | |
| d1t5la2 | 181 | c.37.1.19 (A:415-595) Nucleotide excision repair e | 2e-16 | |
| d1hv8a2 | 155 | c.37.1.19 (A:211-365) Putative DEAD box RNA helica | 2e-16 | |
| d2p6ra4 | 201 | c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob | 4e-13 | |
| d1s2ma2 | 171 | c.37.1.19 (A:252-422) Putative ATP-dependent RNA h | 8e-13 | |
| d1oywa3 | 200 | c.37.1.19 (A:207-406) RecQ helicase domain {Escher | 1e-12 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 2e-12 | |
| d2rb4a1 | 168 | c.37.1.19 (A:307-474) ATP-dependent RNA helicase D | 3e-11 | |
| d1c4oa2 | 174 | c.37.1.19 (A:410-583) Nucleotide excision repair e | 1e-10 | |
| d1jr6a_ | 138 | c.37.1.14 (A:) HCV helicase domain {Human hepatiti | 2e-10 | |
| d1t5ia_ | 168 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 4e-07 | |
| d1yksa2 | 299 | c.37.1.14 (A:325-623) YFV helicase domain {Yellow | 7e-07 | |
| d2eyqa5 | 211 | c.37.1.19 (A:779-989) Transcription-repair couplin | 2e-05 | |
| d1tf5a4 | 175 | c.37.1.19 (A:396-570) Translocation ATPase SecA, n | 2e-05 | |
| d1z3ix1 | 346 | c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi | 0.003 |
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RNA helicase domain: HCV helicase domain species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]
Score = 97.7 bits (243), Expect = 3e-26
Identities = 17/95 (17%), Positives = 27/95 (28%), Gaps = 14/95 (14%)
Query: 1 LGYRVTTLHGGKSQEQREIS----------LEGFRTKRYNVLVATDVAGRGIDIPD---V 47
LG + G S L T ++ ++ +
Sbjct: 59 LGINAVAYYRGLDVSVIPTSGDVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPT 118
Query: 48 AHVINYDMPGNIEMYTHRIGRTGRAGKTGVATTFL 82
+ +P + T R GRTGR GK G+
Sbjct: 119 FTIETTTLPQDAVSRTQRRGRTGR-GKPGIYRFVA 152
|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Length = 211 | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Length = 175 | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 135 | |||
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.97 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.96 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.96 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.96 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 99.95 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.95 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.95 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 99.93 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 99.92 | |
| d1gm5a4 | 206 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.9 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.85 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.84 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 99.83 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.82 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.79 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.72 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.66 | |
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 99.48 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 99.43 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.33 | |
| d1yksa2 | 299 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.32 | |
| d1tf5a4 | 175 | Translocation ATPase SecA, nucleotide-binding doma | 98.82 | |
| d1nkta4 | 219 | Translocation ATPase SecA, nucleotide-binding doma | 97.87 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 97.69 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 97.02 |
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Initiation factor 4a species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.97 E-value=5.5e-31 Score=175.97 Aligned_cols=111 Identities=35% Similarity=0.635 Sum_probs=101.0
Q ss_pred CCceEEEecCCCCHHHHHHHHHHHhcCCCcEEEecCCCcccccccCCcEEEEecCCCCHHHHHHHhhhcCCCCCCceEEE
Q 037139 1 LGYRVTTLHGGKSQEQREISLEGFRTKRYNVLVATDVAGRGIDIPDVAHVINYDMPGNIEMYTHRIGRTGRAGKTGVATT 80 (135)
Q Consensus 1 ~g~~v~~~hg~~~~~~r~~~~~~f~~g~~~ilv~T~~~~~G~d~~~v~~vi~~d~p~~~~~~~qr~GR~gR~~~~g~~~~ 80 (135)
.|+.+..+||+|++.+|..+++.|+.|+.+|||||+++++|+|+|+|++||+||+|+++..|+||+||+||.|+.|.+++
T Consensus 50 ~~~~~~~~~~~~~~~~r~~~l~~f~~~~~~iLv~Tdv~~rGiDi~~v~~VI~~d~P~~~~~yihR~GR~gR~g~~g~~i~ 129 (162)
T d1fuka_ 50 DKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAIN 129 (162)
T ss_dssp TTCCEEEECTTSCHHHHHHHHHHHHTTSCSEEEEEGGGTTTCCCCSCSEEEESSCCSSGGGGGGSSCSCC-----CEEEE
T ss_pred cCceEEEeccCCchhhHHHHHHHHhhcccceeeccccccccccCCCceEEEEeccchhHHHHHhhccccccCCCccEEEE
Confidence 37889999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EeecCChhHHHHHHHHHhhCCCCCChHHHHH
Q 037139 81 FLTFHDTDVFYDLKQMLIQSNSPVPPELAKH 111 (135)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ 111 (135)
++++.+...++.+++.++....++|.++.+.
T Consensus 130 ~~~~~d~~~~~~i~~~~~~~~~~ip~~~~~l 160 (162)
T d1fuka_ 130 FVTNEDVGAMRELEKFYSTQIEELPSDIATL 160 (162)
T ss_dssp EEETTTHHHHHHHHHHSSCCCEECCSCCTTT
T ss_pred EcCHHHHHHHHHHHHHHcCcCCCCChHHHHh
Confidence 9999999999999999999999999887653
|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|