Citrus Sinensis ID: 037195

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500--
MTLRNLSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIPDIFTNLTRLSYLGLGGNQLIGSIPSSIFELLNLTFAISVAAWMWDIGVHTLIYLELSRNFLTNIDHLPWKNLEYLHLDSNLLQGSLLNLPPHMREFSISRNNLTGEIPSSFCNLSYIRFFDSSNNSLSGQILQCLGNSTLDTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRSNRFRGPIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLHGNDIQMERILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVRPGGPQFNTFGNDSYSGNSGLCGFPLSKSCSTDEAPEPTTPTGFIEGDDASSWFDWKLAKLGYASGVVIGLSIGYMAFVTGRPQ
ccEEEccccccEEEccccHHHccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEcccccccccccHHHHHcccccccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccccccccccccccccccEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHcccHHHHHHHHccccEEEcccccccccccHHHHccccccEEccccccccccccHHHHccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHEEEEEEEcccc
ccEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccEEEEccccccccccccccccccEEEccccccccccccccccccEEEccccEEEEEccHHHHHccccEEEEcccccccccccHHHcccccHHEccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccccEEEEEccccccccccHHHcccccHHHHHHcccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
mtlrnlsssyfmgsipaslgnditqLAYLDlsfnsfsghipssfsnLQQLRLLDLRynnfvgkipdiftnLTRLSylglggnqligsiPSSIFELLNLTFAISVAAWMWDIGVHTLIYLELSRNfltnidhlpwknleylhldsnllqgsllnlpphmrefsisrnnltgeipssfcnlsyirffdssnnslsGQILQclgnstldtlDLGMNnfqdmrmnkfsgslpqtfAKSCVLVSLNlngnrlegplppslvncrhlevidvgnnqindtfphwldvlpeLQVLTlrsnrfrgpiddtktrvpfpklriidlsynrftgvlpiwylhgndiqMERILTTFATidlssnrfQGEILEVLGKLNslkslnishnnltggipsslrnltelesldlssnklagriptqlaslnylsvrpggpqfntfgndsysgnsglcgfplskscstdeapepttptgfiegddasswfDWKLAKLGYASGVVIGLSIGYMAFVTGRPQ
MTLRNLSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIPDIFTNLTRLSYLGLGGNQLIGSIPSSIFELLNLTFAISVAAWMWDIGVHTLIYLELSRNFLTNIDHLPWKNLEYLHLDSNLLQGSLLNLPPHMREFSISRNNLTGEIPSSFCNLSYIRFFDSSNNSLSGQILQCLGNSTLDTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLrsnrfrgpiddtktrvpfpklriIDLSYNRFTGVLPIWYLHGNDIQMERILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVRPGGPQFNTFGNDSYSGNSGLCGFPLSKSCSTDEAPEPTTPTGFIEGDDASSWFDWKLAKLGYASGVVIGLSIGYMAFVTGRPQ
MTLRNLSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIPDIFTNLTRLSYLGLGGNQLIGSIPSSIFELLNLTFAISVAAWMWDIGVHTLIYLELSRNFLTNIDHLPWKNLEYLHLDSNLLQGSLLNLPPHMREFSISRNNLTGEIPSSFCNLSYIRFFDSSNNSLSGQILQCLGNSTLDTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRSNRFRGPIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLHGNDIQMERILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVRPGGPQFNTFGNDSYSGNSGLCGFPLSKSCSTDEAPEPTTPTGFIEGDDASSWFDWKLAKLGYASGVVIGLSIGYMAFVTGRPQ
*********YFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIPDIFTNLTRLSYLGLGGNQLIGSIPSSIFELLNLTFAISVAAWMWDIGVHTLIYLELSRNFLTNIDHLPWKNLEYLHLDSNLLQGSLLNLPPHMREFSISRNNLTGEIPSSFCNLSYIRFFDSSNNSLSGQILQCLGNSTLDTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRSNRFRGPIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLHGNDIQMERILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISHNNLTGGI********************AGRIPTQLASLNYLSVRPGGPQFNTFG********GLCGF*******************FIEGDDASSWFDWKLAKLGYASGVVIGLSIGYMAFVT****
MTLRNLSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIPDIFTNLTRLSYLGLGGNQLIGSIPSSIFELLNLTFAISVAAWMWDIGVHTLIYLELSRNFLTNIDHLPWKNLEYLHLDSNLLQGSLLNLPPHMREFSISRNNLTGEIPSSFCNLSYIRFFDSSNNSLSGQILQCLGNSTLDTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRSNRFRGPIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLHGNDIQMERILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVRPGGPQFNTFGNDSYSGNSGLCGFPL***************************FDWKLAKLGYASGVVIGLSIGYMAFVTGRP*
MTLRNLSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIPDIFTNLTRLSYLGLGGNQLIGSIPSSIFELLNLTFAISVAAWMWDIGVHTLIYLELSRNFLTNIDHLPWKNLEYLHLDSNLLQGSLLNLPPHMREFSISRNNLTGEIPSSFCNLSYIRFFDSSNNSLSGQILQCLGNSTLDTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRSNRFRGPIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLHGNDIQMERILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVRPGGPQFNTFGNDSYSGNSGLCGFPLSK***********TPTGFIEGDDASSWFDWKLAKLGYASGVVIGLSIGYMAFVTGRPQ
MTLRNLSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIPDIFTNLTRLSYLGLGGNQLIGSIPSSIFELLNLTFAISVAAWMWDIGVHTLIYLELSRNFLTNIDHLPWKNLEYLHLDSNLLQGSLLNLPPHMREFSISRNNLTGEIPSSFCNLSYIRFFDSSNNSLSGQILQCLGNSTLDTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRSNRFRGPIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLHGNDIQMERILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVRPGGPQFNTFGNDSYSGNSGLCGFPLSKSCSTDEAPE************ASSWFDWKLAKLGYASGVVIGLSIGYMAFVTG***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLRNLSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIPDIFTNLTRLSYLGLGGNQLIGSIPSSIFELLNLTFAISVAAWMWDIGVHTLIYLELSRNFLTNIDHLPWKNLEYLHLDSNLLQGSLLNLPPHMREFSISRNNLTGEIPSSFCNLSYIRFFDSSNNSLSGQILQCLGNSTLDTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRSNRFRGPIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLHGNDIQMERILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVRPGGPQFNTFGNDSYSGNSGLCGFPLSKSCSTDEAPEPTTPTGFIEGDDASSWFDWKLAKLGYASGVVIGLSIGYMAFVTGRPQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query502 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.940 0.557 0.367 2e-69
Q8VZG8 1045 Probable LRR receptor-lik no no 0.725 0.348 0.363 6e-44
C0LGQ5 1249 LRR receptor-like serine/ no no 0.810 0.325 0.328 9e-44
Q9SYQ8 980 Receptor protein kinase C no no 0.830 0.425 0.303 2e-41
Q9LRT1 1016 Probably inactive leucine no no 0.958 0.473 0.313 4e-41
Q9LP24 1120 Probable leucine-rich rep no no 0.780 0.35 0.352 6e-41
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.866 0.426 0.311 3e-40
O22938 890 Leucine-rich repeat recep no no 0.814 0.459 0.311 4e-40
Q9FRS6 1029 Leucine-rich repeat recep no no 0.804 0.392 0.327 2e-39
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.824 0.330 0.283 3e-39
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  263 bits (673), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 203/552 (36%), Positives = 274/552 (49%), Gaps = 80/552 (14%)

Query: 6   LSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIP 65
           LSS+ F  + P  +      L Y D+S+NSFSG  P S   +  L  + L+ N F G I 
Sbjct: 285 LSSNNFTSTFPFDMS-IFHNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIE 343

Query: 66  DIFTNL---TRLSYLGLGGNQLIGSIPSSIFELLNLT-FAISVAAWMWDI-----GVHTL 116
             F N    T+L  L LG N+L G IP SI  LLNL    IS   +   I      +  L
Sbjct: 344 --FANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLVNL 401

Query: 117 IYLELSRNFLT-NIDHLPWKNLEYLHLDSNLLQGSLLNLPPH---MREFSISRNNLTGEI 172
           ++L+LS+N L   +    W+ L  + L  N    S  N       + E  ++ N+  G I
Sbjct: 402 LHLDLSKNNLEGEVPACLWR-LNTMVLSHNSF-SSFENTSQEEALIEELDLNSNSFQGPI 459

Query: 173 PSSFCNLSYIRFFDSSNNSLSGQILQCLGN--STLDTLDLGMNNFQDMRMNKFSGSLPQT 230
           P   C LS + F D SNN  SG I  C+ N   ++  L+LG NNF        SG+LP  
Sbjct: 460 PYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNF--------SGTLPDI 511

Query: 231 FAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTL 290
           F+K+  LVSL+++ N+LEG  P SL+NC+ LE+++V +N+I D FP WL+ LP L VL L
Sbjct: 512 FSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNL 571

Query: 291 RSNRFRGPIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYL-------------------- 330
           RSN+F GP+      + F  LRIID+S+N F+G LP +Y                     
Sbjct: 572 RSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEF 631

Query: 331 ---------------HGNDIQMERILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISH 375
                           G D+  ERI   F  ID S N+  G I E LG L  L+ LN+S 
Sbjct: 632 WRYADSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSG 691

Query: 376 NNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSVR-----------PGGPQ 424
           N  T  IP  L NLT+LE+LD+S NKL+G+IP  LA+L++LS             P G Q
Sbjct: 692 NAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQ 751

Query: 425 FNTFGNDSYSGNSGLCGFPLSKSCSTDEAPEPTT--PTGFIEGDDASSWFDWKLAKLGYA 482
           F      S+  N GL G  L   C    A  PT+  P    E ++  + F+W  A + Y 
Sbjct: 752 FQRQKCSSFLDNPGLYG--LEDICRDTGALNPTSQLPEDLSEAEE--NMFNWVAAAIAYG 807

Query: 483 SGVVIGLSIGYM 494
            GV+ GL IG+ 
Sbjct: 808 PGVLCGLVIGHF 819
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 Back     alignment and function description
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|O22938|Y2182_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 OS=Arabidopsis thaliana GN=At2g41820 PE=1 SV=1 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query502
296082718 745 unnamed protein product [Vitis vinifera] 0.940 0.633 0.468 1e-113
359493546 985 PREDICTED: LRR receptor-like serine/thre 0.920 0.469 0.481 1e-111
359493544 978 PREDICTED: receptor-like protein 12-like 0.968 0.496 0.445 1e-111
359493479 814 PREDICTED: receptor-like protein 12-like 0.936 0.577 0.469 1e-110
225462116 1001 PREDICTED: receptor-like protein 12-like 0.892 0.447 0.433 1e-110
359493539 1001 PREDICTED: receptor-like protein 12-like 0.962 0.482 0.429 1e-109
225455498 980 PREDICTED: receptor-like protein 12-like 0.930 0.476 0.461 1e-106
225459979 979 PREDICTED: receptor-like protein 12-like 0.964 0.494 0.445 1e-105
224116970 921 predicted protein [Populus trichocarpa] 0.922 0.502 0.436 1e-104
147793123 951 hypothetical protein VITISV_032542 [Viti 0.918 0.484 0.462 1e-104
>gi|296082718|emb|CBI21723.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  415 bits (1067), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 256/546 (46%), Positives = 334/546 (61%), Gaps = 74/546 (13%)

Query: 14  SIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIPDIFTNLTR 73
           SIP+ LGN +TQ+ +LDLS N F G I + F+ +++L +LDL  N+F G+      NLT 
Sbjct: 188 SIPSVLGN-LTQITHLDLSRNQFDGEISNVFNKIRKLIVLDLSSNSFRGQFIASLDNLTE 246

Query: 74  LSYLGLGGNQLIGSIPSSIFELLNLT--------FAISVAAWMWDIGVHTLIYLELSRNF 125
           LS+L L  N L G IPS + EL +L+           ++ +W++ +   +LI L+LS N 
Sbjct: 247 LSFLDLSNNNLEGIIPSHVKELSSLSDIHLSNNLLNGTIPSWLFSLP--SLIRLDLSHNK 304

Query: 126 LT-NIDHLPWKNLEYLHLDSNLLQG----SLLNLPPHMREFSISRNNLTGEIPSSFCNLS 180
           L  +ID     +LE + L SN L G    S+  L  ++    +S NNL G +PS  C +S
Sbjct: 305 LNGHIDEFQSPSLESIDLSSNELDGPVPSSIFELV-NLTYLQLSSNNL-GPLPSLICEMS 362

Query: 181 YIRFFDSSNNSLSGQILQCLGN--STLDTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVLV 238
           YI   D SNN+LSG I QCLGN   +L  LDL        RMN+  G++P+TF+K   + 
Sbjct: 363 YISVLDFSNNNLSGLIPQCLGNFSESLSVLDL--------RMNQLHGNIPETFSKGNFIR 414

Query: 239 SLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRSNRFRGP 298
           +L  NGN+LEGPLP SL+NCR L+V+D+GNN+INDTFP+WL+ LPELQVL LRSNRF G 
Sbjct: 415 NLGFNGNQLEGPLPRSLINCRRLQVLDLGNNRINDTFPYWLETLPELQVLILRSNRFHGH 474

Query: 299 IDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLHGNDIQME-------------------- 338
           I  +  + PFPKLRI+DLS N F+G LP  YL      M                     
Sbjct: 475 ISGSNFQFPFPKLRIMDLSRNDFSGSLPEMYLKNFKAMMNVTEDKMKLKYMGEYYYRDSI 534

Query: 339 -----------RILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISHNNLTGGIPSSLR 387
                       IL+TF TIDLSSNRFQGEIL+ +G L+SL+ LN+SHNNLTG IPSSL 
Sbjct: 535 MGTIKGFDFEFVILSTFTTIDLSSNRFQGEILDFIGSLSSLRELNLSHNNLTGHIPSSLG 594

Query: 388 NLTELESLDLSSNKLAGRIPTQLASLNYLSVR-----------PGGPQFNTFGNDSYSGN 436
           NL  LESLDLSSNKL+GRIP +L SL +L V            P G QF+TF N+SYSGN
Sbjct: 595 NLMVLESLDLSSNKLSGRIPRELTSLTFLEVLNLSKNHLTGVIPRGNQFDTFANNSYSGN 654

Query: 437 SGLCGFPLSKSCSTDEAPEPTTPTGFIEGDDASSWFDWKLAKLGYASGVVIGLSIGYMAF 496
            GLCG PLSK C  DEAP+P       E  ++ + FDWK+  +GY  G+V+GL +G + F
Sbjct: 655 IGLCGLPLSKKCVVDEAPQPPKE----EEVESDTGFDWKVILMGYGCGLVVGLFMGCLVF 710

Query: 497 VTGRPQ 502
           +T +P+
Sbjct: 711 LTRKPK 716

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359493546|ref|XP_002267585.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493544|ref|XP_002267509.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493479|ref|XP_003634609.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462116|ref|XP_002263233.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493539|ref|XP_002267388.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225455498|ref|XP_002264793.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225459979|ref|XP_002267546.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147793123|emb|CAN75335.1| hypothetical protein VITISV_032542 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query502
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.796 0.472 0.363 6.9e-53
TAIR|locus:2090754711 RLP43 "receptor like protein 4 0.962 0.679 0.312 1.9e-51
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.942 0.530 0.327 1.2e-49
TAIR|locus:2094603835 RLP37 "receptor like protein 3 0.812 0.488 0.338 2.2e-48
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.782 0.484 0.354 1.8e-47
TAIR|locus:2040035671 RLP20 "receptor like protein 2 0.780 0.584 0.334 2.6e-47
TAIR|locus:2094563595 RLP36 "receptor like protein 3 0.810 0.684 0.336 8.8e-47
TAIR|locus:2825389784 RLP11 "AT1G71390" [Arabidopsis 0.774 0.496 0.346 2.4e-45
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.713 0.351 0.357 1.8e-44
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.788 0.444 0.339 2.5e-44
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 552 (199.4 bits), Expect = 6.9e-53, P = 6.9e-53
 Identities = 158/435 (36%), Positives = 225/435 (51%)

Query:     6 LSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIP 65
             LSS+ F  + P  + +    L Y D+S+NSFSG  P S   +  L  + L+ N F G I 
Sbjct:   285 LSSNNFTSTFPFDM-SIFHNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIE 343

Query:    66 DIFTNL-TRLSYLGLGGNQLIGSIPSSIFELLNLT-FAISVAAWMWDIG-----VHTLIY 118
                T+  T+L  L LG N+L G IP SI  LLNL    IS   +   I      +  L++
Sbjct:   344 FANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLVNLLH 403

Query:   119 LELSRNFLTN-IDHLPWKNLEYLHLDSNLLQGSLLNLPPH---MREFSISRNNLTGEIPS 174
             L+LS+N L   +    W+ L  + L  N    S  N       + E  ++ N+  G IP 
Sbjct:   404 LDLSKNNLEGEVPACLWR-LNTMVLSHNSFS-SFENTSQEEALIEELDLNSNSFQGPIPY 461

Query:   175 SFCNLSYIRFFDSSNNSLSGQILQCLGN--STLDTLDLGMNNFQDMRMNKFSGSLPQTFA 232
               C LS + F D SNN  SG I  C+ N   ++  L+LG NNF        SG+LP  F+
Sbjct:   462 MICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNF--------SGTLPDIFS 513

Query:   233 KSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRS 292
             K+  LVSL+++ N+LEG  P SL+NC+ LE+++V +N+I D FP WL+ LP L VL LRS
Sbjct:   514 KATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRS 573

Query:   293 NRFRGPIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLHG-NDI-----QMERILTTF-A 345
             N+F GP+      + F  LRIID+S+N F+G LP +Y     D+     +M++ +T F  
Sbjct:   574 NKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFWR 633

Query:   346 TIDLSSNRFQ----GEILEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNK 401
               D   +  +    G  +         ++++ S N + G IP SL  L EL  L+LS N 
Sbjct:   634 YADSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNA 693

Query:   402 LAGRIPTQLASLNYL 416
                 IP  LA+L  L
Sbjct:   694 FTSVIPRFLANLTKL 708
GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC;RCA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094603 RLP37 "receptor like protein 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040035 RLP20 "receptor like protein 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094563 RLP36 "receptor like protein 36" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query502
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-54
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-29
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 8e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  195 bits (498), Expect = 4e-54
 Identities = 149/466 (31%), Positives = 209/466 (44%), Gaps = 81/466 (17%)

Query: 6   LSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIP 65
           L+S+  +G IP  LG  +  L ++ L +N+ SG IP     L  L  LDL YNN  G IP
Sbjct: 195 LASNQLVGQIPRELGQ-MKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIP 253

Query: 66  DIFTNLTRLSYLGLGGNQLIGSIPSSIFELLNLTFAISVAAWMWDIGVHTLIYLELSRNF 125
               NL  L YL L  N+L G IP SIF L  L                  I L+LS N 
Sbjct: 254 SSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKL------------------ISLDLSDNS 295

Query: 126 LT-NIDHL--PWKNLEYLHLDSNLLQGSLLNLPPHMREFSISRNNLTGEIPSSFCNLSYI 182
           L+  I  L    +NLE LHL SN                     N TG+IP +  +L  +
Sbjct: 296 LSGEIPELVIQLQNLEILHLFSN---------------------NFTGKIPVALTSLPRL 334

Query: 183 RFFDSSNNSLSGQILQCLG-NSTLDTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVLVSLN 241
           +     +N  SG+I + LG ++ L  LDL  NN         +G +P+    S  L  L 
Sbjct: 335 QVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNL--------TGEIPEGLCSSGNLFKLI 386

Query: 242 LNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRSNRFRGPIDD 301
           L  N LEG +P SL  CR L  + + +N  +   P     LP +  L + +N  +G I+ 
Sbjct: 387 LFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINS 446

Query: 302 TKTRVPFPKLRIIDLSYNRFTGVLPIWY----LHGNDIQMERI----------LTTFATI 347
            K  +P   L+++ L+ N+F G LP  +    L   D+   +           L+    +
Sbjct: 447 RKWDMP--SLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQL 504

Query: 348 DLSSNRFQGEILEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIP 407
            LS N+  GEI + L     L SL++SHN L+G IP+S   +  L  LDLS N+L+G IP
Sbjct: 505 KLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIP 564

Query: 408 TQLASLNYL------------SVRPGGPQFNTFGNDSYSGNSGLCG 441
             L ++  L            S+   G  F      + +GN  LCG
Sbjct: 565 KNLGNVESLVQVNISHNHLHGSLPSTG-AFLAINASAVAGNIDLCG 609

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 502
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.95
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
KOG4237498 consensus Extracellular matrix protein slit, conta 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
PLN03150623 hypothetical protein; Provisional 99.59
PLN03150623 hypothetical protein; Provisional 99.2
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.19
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.02
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.97
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.86
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.83
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.82
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.68
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.55
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.16
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.1
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.09
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.08
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.07
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
PRK15386 426 type III secretion protein GogB; Provisional 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.02
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.98
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.95
PRK15386426 type III secretion protein GogB; Provisional 97.88
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.73
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.64
KOG4341483 consensus F-box protein containing LRR [General fu 97.43
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.21
KOG4341483 consensus F-box protein containing LRR [General fu 97.21
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.1
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.07
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.77
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.76
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.53
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.45
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.74
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.72
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 94.58
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.76
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.26
KOG1947482 consensus Leucine rich repeat proteins, some prote 92.65
smart0037026 LRR Leucine-rich repeats, outliers. 92.03
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.03
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 91.32
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.13
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.11
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.99
smart0037026 LRR Leucine-rich repeats, outliers. 89.99
KOG4308478 consensus LRR-containing protein [Function unknown 89.35
KOG1947482 consensus Leucine rich repeat proteins, some prote 88.68
KOG4308478 consensus LRR-containing protein [Function unknown 88.59
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.0
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.81
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 81.7
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 81.58
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 80.66
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.7e-51  Score=449.50  Aligned_cols=428  Identities=32%  Similarity=0.508  Sum_probs=287.0

Q ss_pred             CCEEEecCCCCcccCChhhhhCCCCCcEEEccCCcccccCCcCCCCCCCCCEEeccCCcCCccCCcccCCCCCCCEEEcc
Q 037195            1 MTLRNLSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIPDIFTNLTRLSYLGLG   80 (502)
Q Consensus         1 l~~L~Ls~n~~~~~ip~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~L~   80 (502)
                      |++|+|++|.+++.+|..+. .+++|++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|..++++++|++|+++
T Consensus       142 L~~L~Ls~n~~~~~~p~~~~-~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~  220 (968)
T PLN00113        142 LETLDLSNNMLSGEIPNDIG-SFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLG  220 (968)
T ss_pred             CCEEECcCCcccccCChHHh-cCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECc
Confidence            34555555555555555555 56666666666665555555556666666666666666655556666666666666666


Q ss_pred             cCcCcccCChhhhcccCCee--------ccccchhhhhhccCcccEEECCCCcCcccCC---CCCCCCceEeCcCCcCCc
Q 037195           81 GNQLIGSIPSSIFELLNLTF--------AISVAAWMWDIGVHTLIYLELSRNFLTNIDH---LPWKNLEYLHLDSNLLQG  149 (502)
Q Consensus        81 ~n~l~~~~p~~~~~l~~L~~--------~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~---~~~~~L~~L~l~~n~l~~  149 (502)
                      +|.+.+.+|..++.+.+|+.        .+.+|..+..+  ++|++|++++|.+++..+   ..+++|++|++++|.+.+
T Consensus       221 ~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l--~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~  298 (968)
T PLN00113        221 YNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNL--KNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSG  298 (968)
T ss_pred             CCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCC--CCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeecc
Confidence            66665556666655555554        23455555555  666666666666554433   245566666666666665


Q ss_pred             cCCCC---CCCccEEEccCCcCcccCCccccCCCCCCEEECCCCcCcccccccccccc-ccEEEccCCccCC--------
Q 037195          150 SLLNL---PPHMREFSISRNNLTGEIPSSFCNLSYIRFFDSSNNSLSGQILQCLGNST-LDTLDLGMNNFQD--------  217 (502)
Q Consensus       150 ~~~~~---~~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~-L~~L~l~~n~~~~--------  217 (502)
                      ..+..   +++|+.|++++|.+++..|..+..+++|+.|++++|.+.+..+..++... |+.+++++|.+..        
T Consensus       299 ~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~  378 (968)
T PLN00113        299 EIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCS  378 (968)
T ss_pred             CCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhC
Confidence            55432   55666666666666666666666666677777776666666665555544 6777776655431        


Q ss_pred             --------CCCCeeeccCccchhcCCCccEEeccCCccccCCCccccCCCCCcEEEccCCccCccCCcccCCCCCCCEEE
Q 037195          218 --------MRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLT  289 (502)
Q Consensus       218 --------~~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~  289 (502)
                              +..+.+.+.+|..+..+++|+.|++++|.+++..|..+..++.|+.|++++|.+.+..+..+..+++|+.|+
T Consensus       379 ~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~  458 (968)
T PLN00113        379 SGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLS  458 (968)
T ss_pred             cCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEE
Confidence                    122334445555555556666666666666655555566666666666666666655555555566666666


Q ss_pred             ccCCcCcccCCCCCCCCCCCCccEEEccCccCCCCCchhhhcCCchhHHHHhcccCeeeccCCcccccchhhhcCCCCCC
Q 037195          290 LRSNRFRGPIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLHGNDIQMERILTTFATIDLSSNRFQGEILEVLGKLNSLK  369 (502)
Q Consensus       290 l~~n~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~  369 (502)
                      +++|.+.+..|..+   ..++|+.|++++|++.+..|..+         ..+++|++|+|++|++.+.+|..++.+++|+
T Consensus       459 L~~n~~~~~~p~~~---~~~~L~~L~ls~n~l~~~~~~~~---------~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~  526 (968)
T PLN00113        459 LARNKFFGGLPDSF---GSKRLENLDLSRNQFSGAVPRKL---------GSLSELMQLKLSENKLSGEIPDELSSCKKLV  526 (968)
T ss_pred             CcCceeeeecCccc---ccccceEEECcCCccCCccChhh---------hhhhccCEEECcCCcceeeCChHHcCccCCC
Confidence            66666655555433   23566667777777666666543         4589999999999999999999999999999


Q ss_pred             EEeCcCCcCCCCCchhccCCCCCCEEeCCCCCCCccCchhcccCCCCCc-----------cCCCCCCCccCCCcccCCCC
Q 037195          370 SLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSV-----------RPGGPQFNTFGNDSYSGNSG  438 (502)
Q Consensus       370 ~L~L~~N~l~~~~p~~l~~l~~L~~L~ls~n~l~~~~p~~~~~l~~L~~-----------~~~~~~~~~~~~~~~~~n~~  438 (502)
                      .|+|++|.+++.+|..+..+++|+.||+++|++++.+|..+..++.|+.           +|...++.++...++.||+.
T Consensus       527 ~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~  606 (968)
T PLN00113        527 SLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNID  606 (968)
T ss_pred             EEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCcc
Confidence            9999999999999999999999999999999999999999988877764           67777888888889999999


Q ss_pred             CCCCC
Q 037195          439 LCGFP  443 (502)
Q Consensus       439 lc~~~  443 (502)
                      +|+.+
T Consensus       607 lc~~~  611 (968)
T PLN00113        607 LCGGD  611 (968)
T ss_pred             ccCCc
Confidence            99854

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query502
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-29
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-29
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-12
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-06
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 2e-05
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 7e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 7e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 8e-05
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 8e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 9e-05
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-04
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 1e-04
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 1e-04
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 5e-04
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 5e-04
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 6e-04
3fxi_A 605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 8e-04
4g8a_A 635 Crystal Structure Of Human Tlr4 Polymorphic Variant 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 146/528 (27%), Positives = 218/528 (41%), Gaps = 111/528 (21%)
Query: 1   MTLRNLSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSN-LQQLRLLDLRYNN 59
           + L N+SS+ F+G IP      +  L YL L+ N F+G IP   S     L  LDL  N+
Sbjct: 249 LKLLNISSNQFVGPIPPL---PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNH 305
Query: 60  FVGKIPDIFTNLTRLSYLGLGGNQLIGSIPSSIFELLNLTFAISVAAWMWDIGVHTLIYL 119
           F G +P  F + + L  L L  N   G +P            +     M  + V  L + 
Sbjct: 306 FYGAVPPFFGSCSLLESLALSSNNFSGELP------------MDTLLKMRGLKVLDLSFN 353
Query: 120 ELSRNFLTNIDHLPWKNLEYLHLDSNLLQGSLL-----NLPPHMREFSISRNNLTGEIPS 174
           E S     ++ +L   +L  L L SN   G +L     N    ++E  +  N  TG+IP 
Sbjct: 354 EFSGELPESLTNLS-ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP 412
Query: 175 SFCNLSYIRFFDSSNNSLSGQILQCLGNSTLDTLDLGMNNFQDMRM--NKFSGSLPQTFA 232
           +  N S +     S N LSG I   LG+         ++  +D+++  N   G +PQ   
Sbjct: 413 TLSNCSELVSLHLSFNYLSGTIPSSLGS---------LSKLRDLKLWLNMLEGEIPQELM 463
Query: 233 KSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRS 292
               L +L L+ N L G +P  L NC +L  I + NN++    P W+  L  L +L L +
Sbjct: 464 YVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSN 523
Query: 293 NRFRG--PIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLH------------------- 331
           N F G  P +    R     L  +DL+ N F G +P                        
Sbjct: 524 NSFSGNIPAELGDCR----SLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIK 579
Query: 332 -----------GNDIQMERI-------LTTFATIDLSSNRFQGE---------------- 357
                      GN ++ + I       L+T    +++S  + G                 
Sbjct: 580 NDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDM 639
Query: 358 --------ILEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAGRIPTQ 409
                   I + +G +  L  LN+ HN+++G IP  + +L  L  LDLSSNKL GRIP  
Sbjct: 640 SYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQA 699
Query: 410 LASLNYLSV------RPGGP-----QFNTFGNDSYSGNSGLCGFPLSK 446
           +++L  L+          GP     QF TF    +  N GLCG+PL +
Sbjct: 700 MSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPR 747
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query502
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-99
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-97
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-82
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-78
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-76
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-76
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-63
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-28
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-65
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-56
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-54
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-46
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-46
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-26
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-17
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-51
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-48
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-43
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-41
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-41
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-45
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-44
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-40
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-35
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-29
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-29
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-30
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-31
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-34
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-31
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-27
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-17
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-08
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 9e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  314 bits (806), Expect = 5e-99
 Identities = 118/432 (27%), Positives = 167/432 (38%), Gaps = 68/432 (15%)

Query: 5   NLSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKI 64
           +L+ + F G IP  L      L  LDLS N F G +P  F +   L  L L  NNF G++
Sbjct: 275 SLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGEL 334

Query: 65  P-DIFTNLTRLSYLGLGGNQLIGSIPSSIFELLNLTFAISVAAWMWDIGVHTLIYLELSR 123
           P D    +  L  L L  N+  G +P S+  L                            
Sbjct: 335 PMDTLLKMRGLKVLDLSFNEFSGELPESLTNL---------------------------- 366

Query: 124 NFLTNIDHLPWKNLEYLHLDSNLLQGSL-----LNLPPHMREFSISRNNLTGEIPSSFCN 178
                       +L  L L SN   G +      N    ++E  +  N  TG+IP +  N
Sbjct: 367 ----------SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN 416

Query: 179 LSYIRFFDSSNNSLSGQILQCLGN-STLDTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVL 237
            S +     S N LSG I   LG+ S L  L L +N           G +PQ       L
Sbjct: 417 CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNM--------LEGEIPQELMYVKTL 468

Query: 238 VSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRSNRFRG 297
            +L L+ N L G +P  L NC +L  I + NN++    P W+  L  L +L L +N F G
Sbjct: 469 ETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSG 528

Query: 298 PIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWY-----------LHGNDIQMERILTTFAT 346
            I           L  +DL+ N F G +P              + G      +       
Sbjct: 529 NIPAELGD--CRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKE 586

Query: 347 IDLSSN--RFQGEILEVLGKLNSLKSLNISHNNLTGGIPSSLRNLTELESLDLSSNKLAG 404
              + N   FQG   E L +L++    NI+     G    +  N   +  LD+S N L+G
Sbjct: 587 CHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSG 646

Query: 405 RIPTQLASLNYL 416
            IP ++ S+ YL
Sbjct: 647 YIPKEIGSMPYL 658
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query502
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.41
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.37
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.36
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.19
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.12
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.1
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.07
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.95
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.84
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.81
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.72
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.49
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.38
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.33
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.95
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.91
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.28
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.18
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.09
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.98
2k9y_A41 Ephrin type-A receptor 2; receptor tyrosine kinase 87.66
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 85.64
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 81.73
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 80.5
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.8e-55  Score=465.67  Aligned_cols=437  Identities=33%  Similarity=0.506  Sum_probs=333.3

Q ss_pred             CCEEEecCCCCcccCChhhhhCCCCCcEEEccCCcccccCCcCCCCCCCCCEEeccCCcCC-------------------
Q 037195            1 MTLRNLSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFV-------------------   61 (502)
Q Consensus         1 l~~L~Ls~n~~~~~ip~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~~~-------------------   61 (502)
                      |++|+|++|.+++.+|. +. .+++|++|++++|.+++.+|..|.++++|++|++++|.+.                   
T Consensus       202 L~~L~Ls~n~l~~~~~~-l~-~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n  279 (768)
T 3rgz_A          202 LEFLDVSSNNFSTGIPF-LG-DCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAEN  279 (768)
T ss_dssp             CCEEECCSSCCCSCCCB-CT-TCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSS
T ss_pred             CCEEECcCCcCCCCCcc-cc-cCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCC
Confidence            45566666666555554 44 5566666666666555555555555555555555555544                   


Q ss_pred             ---ccCCcccCCC-CCCCEEEcccCcCcccCChhhhcccCCee--------ccccchh-hhhhccCcccEEECCCCcCcc
Q 037195           62 ---GKIPDIFTNL-TRLSYLGLGGNQLIGSIPSSIFELLNLTF--------AISVAAW-MWDIGVHTLIYLELSRNFLTN  128 (502)
Q Consensus        62 ---~~~~~~~~~l-~~L~~L~L~~n~l~~~~p~~~~~l~~L~~--------~~~~~~~-~~~~~~~~L~~L~l~~n~l~~  128 (502)
                         +.+|..+... ++|++|++++|.+++.+|..++.+.+|+.        .+.+|.. +..+  ++|++|++++|.+++
T Consensus       280 ~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l--~~L~~L~Ls~n~l~~  357 (768)
T 3rgz_A          280 KFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKM--RGLKVLDLSFNEFSG  357 (768)
T ss_dssp             EEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTC--TTCCEEECCSSEEEE
T ss_pred             ccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcC--CCCCEEeCcCCccCc
Confidence               4455555443 66666666666666666666666665555        2345544 4544  666666666666664


Q ss_pred             cCCC---CCC-CCceEeCcCCcCCccCCCC-----CCCccEEEccCCcCcccCCccccCCCCCCEEECCCCcCccccccc
Q 037195          129 IDHL---PWK-NLEYLHLDSNLLQGSLLNL-----PPHMREFSISRNNLTGEIPSSFCNLSYIRFFDSSNNSLSGQILQC  199 (502)
Q Consensus       129 ~~~~---~~~-~L~~L~l~~n~l~~~~~~~-----~~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~  199 (502)
                      ..+.   .+. +|++|++++|.+++..+..     +++|++|++++|.+++.+|..+..+++|+.|++++|.+++..+..
T Consensus       358 ~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~  437 (768)
T 3rgz_A          358 ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSS  437 (768)
T ss_dssp             CCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGG
T ss_pred             cccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHH
Confidence            4332   233 6777777777666554443     456777777777777777777777778888888888777777777


Q ss_pred             ccccc-ccEEEccCCccCCCCCCeeeccCccchhcCCCccEEeccCCccccCCCccccCCCCCcEEEccCCccCccCCcc
Q 037195          200 LGNST-LDTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHW  278 (502)
Q Consensus       200 ~~~~~-L~~L~l~~n~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~  278 (502)
                      +.... |+.|++++|        .+.+.+|..+..+++|++|++++|.+++..|..+..+++|++|++++|++.+.+|.+
T Consensus       438 l~~l~~L~~L~L~~n--------~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~  509 (768)
T 3rgz_A          438 LGSLSKLRDLKLWLN--------MLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKW  509 (768)
T ss_dssp             GGGCTTCCEEECCSS--------CCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGG
T ss_pred             HhcCCCCCEEECCCC--------cccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChH
Confidence            66655 788887554        445578888999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCEEEccCCcCcccCCCCCCCCCCCCccEEEccCccCCCCCchhhhcCCc------------------------
Q 037195          279 LDVLPELQVLTLRSNRFRGPIDDTKTRVPFPKLRIIDLSYNRFTGVLPIWYLHGND------------------------  334 (502)
Q Consensus       279 ~~~l~~L~~L~l~~n~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~------------------------  334 (502)
                      +..+++|++|++++|++.+.+|..+  ..+++|+.|++++|++.+.+|..+.....                        
T Consensus       510 ~~~l~~L~~L~L~~N~l~~~~p~~l--~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  587 (768)
T 3rgz_A          510 IGRLENLAILKLSNNSFSGNIPAEL--GDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKEC  587 (768)
T ss_dssp             GGGCTTCCEEECCSSCCEEECCGGG--GGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTC
T ss_pred             HhcCCCCCEEECCCCcccCcCCHHH--cCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccc
Confidence            9999999999999999999888776  67899999999999999999876542100                        


Q ss_pred             -------------------------------------hhHHHHhcccCeeeccCCcccccchhhhcCCCCCCEEeCcCCc
Q 037195          335 -------------------------------------IQMERILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISHNN  377 (502)
Q Consensus       335 -------------------------------------~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~N~  377 (502)
                                                           ...++.+++|+.|||++|+++|.+|..++.++.|+.|+|++|+
T Consensus       588 ~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~  667 (768)
T 3rgz_A          588 HGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHND  667 (768)
T ss_dssp             CSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSC
T ss_pred             cccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCc
Confidence                                                 0012335789999999999999999999999999999999999


Q ss_pred             CCCCCchhccCCCCCCEEeCCCCCCCccCchhcccCCCCCc-----------cCCCCCCCccCCCcccCCCCCCCCCCCC
Q 037195          378 LTGGIPSSLRNLTELESLDLSSNKLAGRIPTQLASLNYLSV-----------RPGGPQFNTFGNDSYSGNSGLCGFPLSK  446 (502)
Q Consensus       378 l~~~~p~~l~~l~~L~~L~ls~n~l~~~~p~~~~~l~~L~~-----------~~~~~~~~~~~~~~~~~n~~lc~~~~~~  446 (502)
                      ++|.+|..++.+++|++||+++|+++|.+|..+..++.|+.           +|.+.+|.++...+|.|||++||.|+. 
T Consensus       668 l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-  746 (768)
T 3rgz_A          668 ISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-  746 (768)
T ss_dssp             CCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-
T ss_pred             cCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-
Confidence            99999999999999999999999999999999999998875           888999999999999999999999987 


Q ss_pred             CCCCCC
Q 037195          447 SCSTDE  452 (502)
Q Consensus       447 ~c~~~~  452 (502)
                      .|....
T Consensus       747 ~C~~~~  752 (768)
T 3rgz_A          747 RCDPSN  752 (768)
T ss_dssp             CCCSCC
T ss_pred             CCCCCc
Confidence            887543
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2k9y_A Ephrin type-A receptor 2; receptor tyrosine kinase, membrane protein, dimeric transmembrane domain, ephrin receptor, ATP-binding, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 502
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-21
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.004
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 95.8 bits (237), Expect = 4e-22
 Identities = 73/395 (18%), Positives = 132/395 (33%), Gaps = 44/395 (11%)

Query: 29  LDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIPDI--FTNLTRLSYLGLGGNQLIG 86
             L   + +  +  S ++L Q+  L          I  I     L  L+ +    NQL  
Sbjct: 27  TVLGKTNVTDTV--SQTDLDQVTTLQADRLG----IKSIDGVEYLNNLTQINFSNNQLTD 80

Query: 87  SIP-SSIFELLNLTFAISVAAWMWDIGVHTLIYLELSRNFLTNIDHLPWKNLEYLHLDSN 145
             P  ++ +L+++    +  A +  +   T +      N                 L+ +
Sbjct: 81  ITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELS 140

Query: 146 LLQGSLLNLPPHMREFSISRNNLTGEIPSSFCNLSYIRFFDSSNNSLSGQILQCLGNSTL 205
               S ++    +                   NL+ +   D S+N +S   +        
Sbjct: 141 SNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLA------ 194

Query: 206 DTLDLGMNNFQDMRMNKFSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVID 265
               L          N+ S   P     +  L  L+LNGN+L+     +L +  +L  +D
Sbjct: 195 ---KLTNLESLIATNNQISDITPLGILTN--LDELSLNGNQLKDI--GTLASLTNLTDLD 247

Query: 266 VGNNQINDTFPHWLDVLPELQVLTLRSNRFRGPIDDTKTRVPFPKLRIIDLSYNRFTGVL 325
           + NNQI++  P  L  L +L  L L +N+                  I  L+       L
Sbjct: 248 LANNQISNLAP--LSGLTKLTELKLGANQISN---------------ISPLAGLTALTNL 290

Query: 326 PIWYLHGNDIQMERILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISHNNLTGGIPSS 385
            +      DI     L     + L  N      +  +  L  L+ L  ++N ++    SS
Sbjct: 291 ELNENQLEDISPISNLKNLTYLTLYFNNISD--ISPVSSLTKLQRLFFANNKVSD--VSS 346

Query: 386 LRNLTELESLDLSSNKLAGRIP-TQLASLNYLSVR 419
           L NLT +  L    N+++   P   L  +  L + 
Sbjct: 347 LANLTNINWLSAGHNQISDLTPLANLTRITQLGLN 381
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query502
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.3
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.17
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.11
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.19
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.77
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.96  E-value=5.8e-27  Score=227.58  Aligned_cols=332  Identities=24%  Similarity=0.325  Sum_probs=204.0

Q ss_pred             ecCCCCcccCChhhhhCCCCCcEEEccCCcccccCCcCCCCCCCCCEEeccCCcCCccCCcccCCCCCCCEEEcccCcCc
Q 037195            6 LSSSYFMGSIPASLGNDITQLAYLDLSFNSFSGHIPSSFSNLQQLRLLDLRYNNFVGKIPDIFTNLTRLSYLGLGGNQLI   85 (502)
Q Consensus         6 Ls~n~~~~~ip~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~   85 (502)
                      +..+.+++.+..  . ++.+|++|+++++.|+. + +.+..+++|++|++++|++++. + .++++++|++|++++|++.
T Consensus        29 l~~~~~~~~~~~--~-~l~~l~~L~l~~~~I~~-l-~gl~~L~nL~~L~Ls~N~l~~l-~-~l~~L~~L~~L~L~~n~i~  101 (384)
T d2omza2          29 LGKTNVTDTVSQ--T-DLDQVTTLQADRLGIKS-I-DGVEYLNNLTQINFSNNQLTDI-T-PLKNLTKLVDILMNNNQIA  101 (384)
T ss_dssp             TTCSSTTSEECH--H-HHTTCCEEECCSSCCCC-C-TTGGGCTTCCEEECCSSCCCCC-G-GGTTCTTCCEEECCSSCCC
T ss_pred             hCCCCCCCccCH--H-HhCCCCEEECCCCCCCC-c-cccccCCCCCEEeCcCCcCCCC-c-cccCCcccccccccccccc
Confidence            344555555543  2 56789999999998874 3 4588899999999999999854 3 3899999999999999987


Q ss_pred             ccCChhhhcccCCeeccccchhhhhhccCcccEEECCCCcCcccCCC-CCCCCceEeCcCCcCCccCCCC----------
Q 037195           86 GSIPSSIFELLNLTFAISVAAWMWDIGVHTLIYLELSRNFLTNIDHL-PWKNLEYLHLDSNLLQGSLLNL----------  154 (502)
Q Consensus        86 ~~~p~~~~~l~~L~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~-~~~~L~~L~l~~n~l~~~~~~~----------  154 (502)
                      + ++. ++.+                  ++|+.|+++++.+++.... ....+.......+.+.......          
T Consensus       102 ~-i~~-l~~l------------------~~L~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~  161 (384)
T d2omza2         102 D-ITP-LANL------------------TNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSF  161 (384)
T ss_dssp             C-CGG-GTTC------------------TTCCEEECCSSCCCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEE
T ss_pred             c-ccc-cccc------------------cccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            3 432 5554                  8889999998888776552 3345555555444433211111          


Q ss_pred             ------------CCCccEEEccCCcCcccCCccccCCCCCCEEECCCCcCccccccccccccccEEEccCCccCCCCCCe
Q 037195          155 ------------PPHMREFSISRNNLTGEIPSSFCNLSYIRFFDSSNNSLSGQILQCLGNSTLDTLDLGMNNFQDMRMNK  222 (502)
Q Consensus       155 ------------~~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~  222 (502)
                                  .+.........+...  ....+..+++++.+++++|.+++..+. .....|+.+++++|.++++    
T Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~l~~~~~l~l~~n~i~~~~~~-~~~~~L~~L~l~~n~l~~~----  234 (384)
T d2omza2         162 GNQVTDLKPLANLTTLERLDISSNKVS--DISVLAKLTNLESLIATNNQISDITPL-GILTNLDELSLNGNQLKDI----  234 (384)
T ss_dssp             EESCCCCGGGTTCTTCCEEECCSSCCC--CCGGGGGCTTCSEEECCSSCCCCCGGG-GGCTTCCEEECCSSCCCCC----
T ss_pred             ccccchhhhhccccccccccccccccc--cccccccccccceeeccCCccCCCCcc-cccCCCCEEECCCCCCCCc----
Confidence                        112222222222221  223445566677777777766654432 2222367777766655532    


Q ss_pred             eeccCccchhcCCCccEEeccCCccccCCCccccCCCCCcEEEccCCccCccCCcccCCCCCCCEEEccCCcCcccCCCC
Q 037195          223 FSGSLPQTFAKSCVLVSLNLNGNRLEGPLPPSLVNCRHLEVIDVGNNQINDTFPHWLDVLPELQVLTLRSNRFRGPIDDT  302 (502)
Q Consensus       223 ~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~  302 (502)
                            ..+..+++|+.+++++|.+++..  .+..+++|++|+++++.+.+..  .+..++.++.+++..|.+.+...  
T Consensus       235 ------~~l~~l~~L~~L~l~~n~l~~~~--~~~~~~~L~~L~l~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~~~~--  302 (384)
T d2omza2         235 ------GTLASLTNLTDLDLANNQISNLA--PLSGLTKLTELKLGANQISNIS--PLAGLTALTNLELNENQLEDISP--  302 (384)
T ss_dssp             ------GGGGGCTTCSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCCSCCGG--
T ss_pred             ------chhhcccccchhccccCccCCCC--cccccccCCEeeccCcccCCCC--ccccccccccccccccccccccc--
Confidence                  13455566777777777666433  2566667777777777665432  25566667777777776654321  


Q ss_pred             CCCCCCCCccEEEccCccCCCCCchhhhcCCchhHHHHhcccCeeeccCCcccccchhhhcCCCCCCEEeCcCCcCCCCC
Q 037195          303 KTRVPFPKLRIIDLSYNRFTGVLPIWYLHGNDIQMERILTTFATIDLSSNRFQGEILEVLGKLNSLKSLNISHNNLTGGI  382 (502)
Q Consensus       303 ~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~  382 (502)
                      +  ..+++++.|++++|++++..+.           ..+++|++|++++|++++ ++ .++.+++|++|++++|++++..
T Consensus       303 ~--~~~~~l~~L~ls~n~l~~l~~l-----------~~l~~L~~L~L~~n~l~~-l~-~l~~l~~L~~L~l~~N~l~~l~  367 (384)
T d2omza2         303 I--SNLKNLTYLTLYFNNISDISPV-----------SSLTKLQRLFFANNKVSD-VS-SLANLTNINWLSAGHNQISDLT  367 (384)
T ss_dssp             G--GGCTTCSEEECCSSCCSCCGGG-----------GGCTTCCEEECCSSCCCC-CG-GGGGCTTCCEEECCSSCCCBCG
T ss_pred             c--chhcccCeEECCCCCCCCCccc-----------ccCCCCCEEECCCCCCCC-Ch-hHcCCCCCCEEECCCCcCCCCh
Confidence            1  3456677777777766654321           236667777777777664 22 4666777777777777776443


Q ss_pred             chhccCCCCCCEEeCCCC
Q 037195          383 PSSLRNLTELESLDLSSN  400 (502)
Q Consensus       383 p~~l~~l~~L~~L~ls~n  400 (502)
                      |  +.++++|+.|++++|
T Consensus       368 ~--l~~l~~L~~L~L~~N  383 (384)
T d2omza2         368 P--LANLTRITQLGLNDQ  383 (384)
T ss_dssp             G--GTTCTTCSEEECCCE
T ss_pred             h--hccCCCCCEeeCCCC
Confidence            3  666677777777665
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure