Citrus Sinensis ID: 037228

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MCISELANSKASVDNEDEYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPPGHQHLMHMLTGSSSSSEDKRCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVREYFNTSVTVTRFGDPQLLSSPVAPVTVSSSCQSVWQSKLCDNNSVPGLVLAL
cccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHccccEEEEEEccccHHHHHHHHHcccccccccEEEEEEEEEEEEEccEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEcHHHHHHHHccccccccccccccccccccEEEccccccccccccEEEEc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccEEccccccHHHHHHHHccccccccccccEEEEccEEEEcccEEEEEEccccccEEEEEEEEEcccEEEEEEEEEccEEEEEEccccccccccccccccccccccEEEEcccccccccEEEEEc
mciselanskasvdnedeYNIRVVKTLYDALNSFDVKTVHRLLTSDlewwfhgppghqhlmhmltgsssssedkrcftfvplstvafgptviveghskehSVSWVHAWTVTDGIITQVREYFNTSvtvtrfgdpqllsspvapvtvssscqsvwqsklcdnnsvpglvlal
mciselanskasvdnedeYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPPGHQHLMHMLTGSSSSSEDKRCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVREYFNTSVTVTRFGDPQLLSSPVAPVTVSSSCQSvwqsklcdnnsvpglvlal
MCISELANSKASVDNEDEYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPPGHQHLMHMLTGSSSSSEDKRCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVREYFNTSVTVTRFGDPQLLsspvapvtvsssCQSVWQSKLCDNNSVPGLVLAL
*****************EYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPPGHQHLMH************RCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVREYFNTSVTVTRFGDPQLLSSPVAPVTVSSSCQSVWQSKLCDNN*********
**********************VVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPPGHQHLMHMLTGSSSSSEDKRCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVREYFNTSVTVTRF*********************VWQSKLCDNNSVPGLVLAL
************VDNEDEYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPPGHQHLMHML********DKRCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVREYFNTSVTVTRFGDPQLLSSP*************WQSKLCDNNSVPGLVLAL
MCI**L***K*SVDNEDEYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPPGHQHLMHMLTGSSSSSEDKRCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVREYFNTSVTVTRFGD****************CQSVWQSKLCDNNSVPGLVLAL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCISELANSKASVDNEDEYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPPGHQHLMHMLTGSSSSSEDKRCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVREYFNTSVTVTRFGDPQLLSSPVAPVTVSSSCQSVWQSKLCDNNSVPGLVLAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
P20144105 Wound-induced protein 1 O N/A no 0.602 0.980 0.513 2e-20
>sp|P20144|WUN1_SOLTU Wound-induced protein 1 OS=Solanum tuberosum GN=WUN1 PE=2 SV=1 Back     alignment and function desciption
 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 74/113 (65%), Gaps = 10/113 (8%)

Query: 61  MHMLTGSSSSSEDKRCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVRE 120
           M +LTG++    D   F F+  +   FG  V+VEG     S++WVHAWTVTDG+ITQVRE
Sbjct: 1   MQILTGTAKF--DNASFQFLHKTIDVFGSVVLVEGCDPTRSITWVHAWTVTDGVITQVRE 58

Query: 121 YFNTSVTVTRFGDPQLLSSPVAPVTVSSSCQSVWQSKLCD--NNSVPGLVLAL 171
           YFNTS+TVTRFG      S ++ +T +  C SVW+S L +    SVPGLVLAL
Sbjct: 59  YFNTSLTVTRFG-----KSDISSIT-TLHCPSVWESSLPNRVGKSVPGLVLAL 105

Solanum tuberosum (taxid: 4113)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
225434413243 PREDICTED: uncharacterized protein LOC10 0.953 0.670 0.580 2e-46
449499138227 PREDICTED: wound-induced protein 1-like 0.970 0.731 0.536 1e-43
356569272179 PREDICTED: wound-induced protein 1-like 0.935 0.893 0.529 1e-40
359486474268 PREDICTED: uncharacterized protein LOC10 0.964 0.615 0.524 2e-40
255559597204 conserved hypothetical protein [Ricinus 0.970 0.813 0.516 4e-38
357461459200 Wound-induced protein [Medicago truncatu 0.941 0.805 0.514 5e-38
297736533 585 unnamed protein product [Vitis vinifera] 0.918 0.268 0.520 2e-37
6016696 531 unknown protein [Arabidopsis thaliana] 0.894 0.288 0.532 3e-37
356538015169 PREDICTED: wound-induced protein 1-like 0.923 0.934 0.505 9e-37
255559595208 conserved hypothetical protein [Ricinus 0.959 0.788 0.494 7e-36
>gi|225434413|ref|XP_002277465.1| PREDICTED: uncharacterized protein LOC100257036 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 128/174 (73%), Gaps = 11/174 (6%)

Query: 3   ISELANSKASVDNEDEYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPPGHQHLMH 62
           +SELA+++A+++   E + RVV  LY+AL++ DV+TVH+LL  DLEWWFHGPP HQHLM 
Sbjct: 75  VSELAHTEAALE---ESSKRVVGALYEALSTRDVETVHQLLAPDLEWWFHGPPNHQHLMQ 131

Query: 63  MLTGSSSSSEDKRCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVREYF 122
           +LTGSSSS +    F F P+S VAFG TV+VEG+ +  SV+WVHAW VTDGIITQVREYF
Sbjct: 132 LLTGSSSSDDP---FHFDPVSIVAFGSTVLVEGYEERRSVAWVHAWVVTDGIITQVREYF 188

Query: 123 NTSVTVTRFGDP-QLLSSPVAPVTVSSS--CQSVWQSKLCDN--NSVPGLVLAL 171
           NTSVTVTR  +  +    P    T + S  C  VWQSK+C++   SVPGL+LAL
Sbjct: 189 NTSVTVTRLSNTDKAAEGPSTSTTAARSVPCTCVWQSKVCESMGKSVPGLLLAL 242

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449499138|ref|XP_004160733.1| PREDICTED: wound-induced protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356569272|ref|XP_003552827.1| PREDICTED: wound-induced protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|359486474|ref|XP_003633449.1| PREDICTED: uncharacterized protein LOC100853125 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255559597|ref|XP_002520818.1| conserved hypothetical protein [Ricinus communis] gi|223539949|gb|EEF41527.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357461459|ref|XP_003601011.1| Wound-induced protein [Medicago truncatula] gi|355490059|gb|AES71262.1| Wound-induced protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297736533|emb|CBI25404.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|6016696|gb|AAF01523.1|AC009991_19 unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356538015|ref|XP_003537500.1| PREDICTED: wound-induced protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|255559595|ref|XP_002520817.1| conserved hypothetical protein [Ricinus communis] gi|223539948|gb|EEF41526.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
TAIR|locus:1006230220110 SAG20 "AT3G10985" [Arabidopsis 0.631 0.981 0.504 5.5e-22
TAIR|locus:2181072162 AT5G01740 "AT5G01740" [Arabido 0.818 0.864 0.375 4.4e-20
TAIR|locus:1006230220 SAG20 "AT3G10985" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 256 (95.2 bits), Expect = 5.5e-22, P = 5.5e-22
 Identities = 57/113 (50%), Positives = 68/113 (60%)

Query:    61 MHMLTGSSSSSEDKRCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVRE 120
             M +LTG  S S     F FVPLS V+FG TVI EG     S+SW+HAWTV +GIITQVRE
Sbjct:     1 MRVLTGGVSPSSSS--FEFVPLSVVSFGSTVIAEGCDAATSISWIHAWTVANGIITQVRE 58

Query:   121 YFNTSVTVTRFGDPQLLXXXXXXXXXXXXCQSVWQSKLCDN--NSVPGLVLAL 171
             Y NTS+TVTR G+  +             C SVW+S+        VPGLVLA+
Sbjct:    59 YSNTSLTVTRIGNV-VAGRRSAEIAPPSHCSSVWESQFSGRAGKPVPGLVLAI 110
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0007568 "aging" evidence=IEP
GO:0009620 "response to fungus" evidence=IEP
TAIR|locus:2181072 AT5G01740 "AT5G01740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
pfam07107109 pfam07107, WI12, Wound-induced protein WI12 2e-36
pfam12680101 pfam12680, SnoaL_2, SnoaL-like domain 9e-10
COG3631133 COG3631, COG3631, Ketosteroid isomerase-related pr 5e-08
>gnl|CDD|191688 pfam07107, WI12, Wound-induced protein WI12 Back     alignment and domain information 
 Score =  121 bits (305), Expect = 2e-36
 Identities = 61/113 (53%), Positives = 70/113 (61%), Gaps = 6/113 (5%)

Query: 61  MHMLTGSSSSSEDKRCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVRE 120
           M +LTG+S SS     F F PLS  AFG TVI EG     S+ WVHAWTV DG+ITQVRE
Sbjct: 1   MRLLTGASPSSSS---FRFEPLSVDAFGSTVIAEGCDATRSIYWVHAWTVGDGVITQVRE 57

Query: 121 YFNTSVTVTRFGDPQLLSSPVAPVTVSSSCQSVWQSKLCD--NNSVPGLVLAL 171
           YFNTS+TVTR G               S C SVW+S+L D    S+PGLVLA+
Sbjct: 58  YFNTSLTVTRLGLGA-AGWDATASAPCSHCCSVWESRLPDRAGKSLPGLVLAI 109

This family consists of several plant wound-induced protein sequences related to WI12 from Mesembryanthemum crystallinum. Wounding, methyl jasmonate, and pathogen infection is known to induce local WI12 expression. WI12 expression is also thought to be developmentally controlled in the placenta and developing seeds. WI12 preferentially accumulates in the cell wall and it has been suggested that it plays a role in the reinforcement of cell wall composition after wounding and during plant development. This family seems partly related to the NTF2-like superfamily. Length = 109
>gnl|CDD|221707 pfam12680, SnoaL_2, SnoaL-like domain Back     alignment and domain information
>gnl|CDD|226158 COG3631, COG3631, Ketosteroid isomerase-related protein [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
PF07107109 WI12: Wound-induced protein WI12; InterPro: IPR009 99.84
COG3631133 Ketosteroid isomerase-related protein [General fun 99.78
TIGR02096129 conserved hypothetical protein, steroid delta-isom 99.75
PF07858125 LEH: Limonene-1,2-epoxide hydrolase catalytic doma 99.72
PRK08241339 RNA polymerase factor sigma-70; Validated 99.71
PF07366126 SnoaL: SnoaL-like polyketide cyclase; InterPro: IP 99.63
cd00781122 ketosteroid_isomerase ketosteroid isomerase: Many 99.61
TIGR02960324 SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa 99.61
PF12680102 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 99.59
COG4308130 LimA Limonene-1,2-epoxide hydrolase [Secondary met 99.39
PRK09636293 RNA polymerase sigma factor SigJ; Provisional 99.32
TIGR02957281 SigX4 RNA polymerase sigma-70 factor, TIGR02957 fa 99.11
COG4922129 Uncharacterized protein conserved in bacteria [Fun 99.1
COG5485131 Predicted ester cyclase [General function predicti 99.05
PRK09635290 sigI RNA polymerase sigma factor SigI; Provisional 98.77
PF03284162 PHZA_PHZB: Phenazine biosynthesis protein A/B; Int 98.7
PF14534107 DUF4440: Domain of unknown function (DUF4440); PDB 98.47
COG4538112 Uncharacterized conserved protein [Function unknow 98.42
PF13474121 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE 98.42
TIGR02246128 conserved hypothetical protein. This family consis 98.4
cd00531124 NTF2_like Nuclear transport factor 2 (NTF2-like) s 97.87
COG4319137 Ketosteroid isomerase homolog [Function unknown] 97.86
PF12893116 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BL 97.77
PF13577127 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF 97.15
PF08332128 CaMKII_AD: Calcium/calmodulin dependent protein ki 96.73
PF10184113 DUF2358: Uncharacterized conserved protein (DUF235 95.89
PF07080143 DUF1348: Protein of unknown function (DUF1348); In 95.58
PF11533125 DUF3225: Protein of unknown function (DUF3225); In 95.34
PF12870111 Lumazine_bd: Lumazine-binding domain; InterPro: IP 94.23
PF02136118 NTF2: Nuclear transport factor 2 (NTF2) domain; In 92.09
PRK10069183 3-phenylpropionate dioxygenase subunit beta; Provi 90.89
cd00667160 ring_hydroxylating_dioxygenases_beta Ring hydroxyl 89.64
cd00780119 NTF2 Nuclear transport factor 2 (NTF2) domain play 86.98
TIGR03231155 anthran_1_2_B anthranilate 1,2-dioxygenase, small 85.2
TIGR03232155 benzo_1_2_benB benzoate 1,2-dioxygenase, small sub 80.12
>PF07107 WI12: Wound-induced protein WI12; InterPro: IPR009798 This entry consists of several plant wound-induced protein sequences related to WI12 from Mesembryanthemum crystallinum (Common ice plant) (Q9XES3 from SWISSPROT) Back     alignment and domain information 
Probab=99.84  E-value=4.8e-21  Score=136.99  Aligned_cols=96  Identities=60%  Similarity=0.922  Sum_probs=80.8

Q ss_pred             ceeEEEEeEEEEeCCEEEEEEEeCceeeeEEEEEEEeCCeEEEEEEecChHHHHHHhCCCCCCCCCCCCccCCCCCceee
Q 037228           75 RCFTFVPLSTVAFGPTVIVEGHSKEHSVSWVHAWTVTDGIITQVREYFNTSVTVTRFGDPQLLSSPVAPVTVSSSCQSVW  154 (171)
Q Consensus        75 ~~~~~~~~~via~Gd~Vvveg~~~g~~~~~v~vf~v~DGkI~~~~~Y~Dt~~~~~~lg~p~~~~~~~~~~~~~~~~~~~~  154 (171)
                      ..|+|.|.++.+-|+.|++||...+....|||+|+++||+|+++||||||.....-++....=.+ -+.--.++-|+|||
T Consensus        12 ~sF~F~P~sV~afG~~ViaEG~~~~~~~yWVHaWTV~dGiITqlREYFNT~ltVt~l~~~~~~~~-~~~~~~~~~~~~vW   90 (109)
T PF07107_consen   12 SSFRFVPRSVDAFGSTVIAEGCDETRSVYWVHAWTVKDGIITQLREYFNTSLTVTRLGPGASGSS-SSDSAPSSHCPCVW   90 (109)
T ss_pred             CcEEEeccEEEEECCEEEEecccCcCcEEEEEEEEecCCEEEeeeeeeeeEEEEEeccccCCccc-ccccccCCCCCcee
Confidence            47899999999999999999987788999999999999999999999999999888885222111 11122238899999


Q ss_pred             eeecCC--CCCccceeeeC
Q 037228          155 QSKLCD--NNSVPGLVLAL  171 (171)
Q Consensus       155 ~~~~~~--~~~~~~~~~~~  171 (171)
                      |++++|  ++|+|||+||+
T Consensus        91 qS~~~d~~~~SlPGLVLAI  109 (109)
T PF07107_consen   91 QSRLPDRAGKSLPGLVLAI  109 (109)
T ss_pred             cccccccccCCcCCEEEeC
Confidence            999988  89999999996

Wounding, methyl jasmonate, and pathogen infection is known to induce local WI12 expression. WI12 expression is also thought to be developmentally controlled in the placenta and developing seeds. WI12 preferentially accumulates in the cell wall and it has been suggested that it plays a role in the reinforcement of cell wall composition after wounding and during plant development [].
>COG3631 Ketosteroid isomerase-related protein [General function prediction only] Back     alignment and domain information
>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related Back     alignment and domain information
>PF07858 LEH: Limonene-1,2-epoxide hydrolase catalytic domain; InterPro: IPR013100 Epoxide hydrolases catalyse the hydrolysis of epoxides to corresponding diols, which is important in detoxification, synthesis of signal molecules, or metabolism Back     alignment and domain information
>PRK08241 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>PF07366 SnoaL: SnoaL-like polyketide cyclase; InterPro: IPR009959 This domain is found in SnoaL [] a polyketide cyclase involved in nogalamycin biosynthesis Back     alignment and domain information
>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon Back     alignment and domain information
>TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family Back     alignment and domain information
>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A Back     alignment and domain information
>COG4308 LimA Limonene-1,2-epoxide hydrolase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09636 RNA polymerase sigma factor SigJ; Provisional Back     alignment and domain information
>TIGR02957 SigX4 RNA polymerase sigma-70 factor, TIGR02957 family Back     alignment and domain information
>COG4922 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5485 Predicted ester cyclase [General function prediction only] Back     alignment and domain information
>PRK09635 sigI RNA polymerase sigma factor SigI; Provisional Back     alignment and domain information
>PF03284 PHZA_PHZB: Phenazine biosynthesis protein A/B; InterPro: IPR004964 The phenazine biosynthesis proteins A and B are involved in the biosynthesis of this antibiotic Back     alignment and domain information
>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A Back     alignment and domain information
>COG4538 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B Back     alignment and domain information
>TIGR02246 conserved hypothetical protein Back     alignment and domain information
>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information
>COG4319 Ketosteroid isomerase homolog [Function unknown] Back     alignment and domain information
>PF12893 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C Back     alignment and domain information
>PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B Back     alignment and domain information
>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF10184 DUF2358: Uncharacterized conserved protein (DUF2358); InterPro: IPR018790 This entry represents a family of conserved proteins Back     alignment and domain information
>PF07080 DUF1348: Protein of unknown function (DUF1348); InterPro: IPR009783 This family consists of several highly conserved hypothetical proteins of around 150 residues in length Back     alignment and domain information
>PF11533 DUF3225: Protein of unknown function (DUF3225); InterPro: IPR024507 This family of proteins has no known function Back     alignment and domain information
>PF12870 Lumazine_bd: Lumazine-binding domain; InterPro: IPR024267 This entry represents a lumazine-binding domain found in a family of putative lipoproteins from bacteria Back     alignment and domain information
>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein Back     alignment and domain information
>PRK10069 3-phenylpropionate dioxygenase subunit beta; Provisional Back     alignment and domain information
>cd00667 ring_hydroxylating_dioxygenases_beta Ring hydroxylating dioxygenase beta subunit Back     alignment and domain information
>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information
>TIGR03231 anthran_1_2_B anthranilate 1,2-dioxygenase, small subunit Back     alignment and domain information
>TIGR03232 benzo_1_2_benB benzoate 1,2-dioxygenase, small subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
3ebt_A132 Uncharacterized NTF2-like protein; structural geno 1e-21
3fgy_A135 Uncharacterized NTF2-like protein; structural geno 3e-21
3ec9_A140 Uncharacterized NTF2-like protein; structural geno 2e-18
1s5a_A150 Hypothetical protein YESE; structural genomics, PS 3e-17
3grd_A134 Uncharacterized NTF2-superfamily protein; NP_97724 5e-16
1nww_A149 Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R 3e-14
2bng_A149 MB2760; epoxide hydrolase, limonene, hydrolase, st 4e-14
1tuh_A156 BAL32A, hypothetical protein EGC068; unknown funct 1e-13
3dm8_A143 Uncharacterized protein RPA4348; siras, putative i 4e-13
3g8z_A148 Protein of unknown function with cystatin-like FO; 2e-11
1z1s_A163 Hypothetical protein PA3332; beta barrel, conserve 3e-11
3k0z_A159 Putative polyketide cyclase; structural genomics, 3e-07
3i0y_A140 Putative polyketide cyclase; cystatin-like fold, s 2e-06
2gey_A158 ACLR protein; alpha+beta barrel, oxidoreductase; H 3e-06
3f7x_A151 Putative polyketide cyclase; structural genomics, 1e-05
3f8h_A150 Putative polyketide cyclase; structural genomics, 2e-05
1sjw_A144 Nogalonic acid methyl ester cyclase; anthracycline 4e-05
3f40_A114 Uncharacterized NTF2-like protein; YP_677363.1, NT 8e-05
3en8_A128 Uncharacterized NTF-2 like protein; YP_553245.1, N 3e-04
3kkg_A146 Putative snoal-like polyketide cyclase; structural 5e-04
>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Length = 132 Back     alignment and structure
 Score = 83.8 bits (207), Expect = 1e-21
 Identities = 22/122 (18%), Positives = 45/122 (36%), Gaps = 20/122 (16%)

Query: 20  NIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPP----------GHQHLMHMLTGSSS 69
           N++ V+  Y+A +  D+  V   L  D+ W                GH  ++  +    +
Sbjct: 5   NMQTVRESYEAFHRRDLPGVLAALAPDVRWTHPDGMSPYGLGGTKHGHDEVIAFIRHVPT 64

Query: 70  SSEDKRCFTFVPLSTVAFGPTVIVEGHSKEHSVS-------WVHAWTVTDGIITQVREYF 122
              +       P   +  G  ++V G  +  +V+       +VH W   +G      ++F
Sbjct: 65  HIAE---MRLAPDEFIESGERIVVLGTRRVTAVNGRSATLKFVHVWRFENGRAVTFEDHF 121

Query: 123 NT 124
           +T
Sbjct: 122 DT 123
>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} Length = 135 Back     alignment and structure
>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Length = 140 Back     alignment and structure
>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Length = 150 Back     alignment and structure
>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} Length = 134 Back     alignment and structure
>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Length = 149 Back     alignment and structure
>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Length = 149 Back     alignment and structure
>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Length = 156 Back     alignment and structure
>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Length = 143 Back     alignment and structure
>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Length = 148 Back     alignment and structure
>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 Length = 163 Back     alignment and structure
>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Length = 159 Back     alignment and structure
>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Length = 140 Back     alignment and structure
>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 Length = 158 Back     alignment and structure
>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} Length = 151 Back     alignment and structure
>3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} Length = 150 Back     alignment and structure
>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 Length = 144 Back     alignment and structure
>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406} Length = 114 Back     alignment and structure
>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 Length = 128 Back     alignment and structure
>3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP} Length = 146 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
4h3u_A158 Hypothetical protein; structural genomics, PSI-bio 99.91
3ebt_A132 Uncharacterized NTF2-like protein; structural geno 99.89
3dm8_A143 Uncharacterized protein RPA4348; siras, putative i 99.89
3ec9_A140 Uncharacterized NTF2-like protein; structural geno 99.88
3fgy_A135 Uncharacterized NTF2-like protein; structural geno 99.87
3kkg_A146 Putative snoal-like polyketide cyclase; structural 99.86
3k0z_A159 Putative polyketide cyclase; structural genomics, 99.86
1nww_A149 Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R 99.85
3grd_A134 Uncharacterized NTF2-superfamily protein; NP_97724 99.84
3f14_A112 Uncharacterized NTF2-like protein; YP_680363.1, NT 99.84
3g8z_A148 Protein of unknown function with cystatin-like FO; 99.84
2gey_A158 ACLR protein; alpha+beta barrel, oxidoreductase; H 99.83
1sjw_A144 Nogalonic acid methyl ester cyclase; anthracycline 99.83
3f9s_A146 Putative polyketide cyclase; structural genomics, 99.83
2gex_A152 SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St 99.83
2f99_A153 Aklanonic acid methyl ester cyclase, AKNH; anthrac 99.83
3dmc_A134 NTF2-like protein; structural genomics, joint cent 99.83
2bng_A149 MB2760; epoxide hydrolase, limonene, hydrolase, st 99.83
3i0y_A140 Putative polyketide cyclase; cystatin-like fold, s 99.82
3ehc_A128 Snoal-like polyketide cyclase; structural genomics 99.81
1s5a_A150 Hypothetical protein YESE; structural genomics, PS 99.81
2k54_A123 Protein ATU0742; protein of unknown function, stru 99.81
1z1s_A163 Hypothetical protein PA3332; beta barrel, conserve 99.81
3f40_A114 Uncharacterized NTF2-like protein; YP_677363.1, NT 99.81
3jum_A185 Phenazine biosynthesis protein A/B; chirality, dru 99.8
1tuh_A156 BAL32A, hypothetical protein EGC068; unknown funct 99.8
3fh1_A129 Uncharacterized NTF2-like protein; structural geno 99.79
3en8_A128 Uncharacterized NTF-2 like protein; YP_553245.1, N 99.79
3f7x_A151 Putative polyketide cyclase; structural genomics, 99.78
3f8h_A150 Putative polyketide cyclase; structural genomics, 99.78
3ff2_A117 Uncharacterized cystatin fold protein (YP_497570. 99.75
1ohp_A125 Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 99.74
3g16_A156 Uncharacterized protein with cystatin-like fold; Y 99.74
3g0k_A148 Putative membrane protein; snoal-like polyketide c 99.74
3ff0_A163 Phenazine biosynthesis protein PHZB 2; cystatin-li 99.73
1oh0_A131 Steroid delta-isomerase; ketosteroid isomerase, KS 99.72
2a15_A139 Hypothetical protein RV0760C; beta-alpha-barrel, s 99.67
3h3h_A122 Uncharacterized snoal-like protein; structural gen 99.62
3lyg_A120 NTF2-like protein of unknown function; structural 99.61
3hk4_A136 MLR7391 protein; NTF2-like protein, structural gen 99.58
3mso_A143 Steroid delta-isomerase; structural genomics, join 99.57
3er7_A131 Uncharacterized NTF2-like protein; YP_001812677.1, 99.54
3flj_A155 Uncharacterized protein conserved in bacteria WIT 99.51
3f8x_A148 Putative delta-5-3-ketosteroid isomerase; structur 99.49
3rga_A283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 99.47
3rga_A 283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 99.46
3dxo_A121 Uncharacterized snoal-like protein; putative isome 99.43
3hx8_A129 MLR2180 protein, putative ketosteroid isomerase; s 99.18
3d9r_A135 Ketosteroid isomerase-like protein; YP_049581.1, s 99.07
3h51_A156 Putative calcium/calmodulin dependent protein KIN 98.77
3f7s_A142 Uncharacterized NTF2-like protein; structural geno 98.7
2gxf_A142 Hypothetical protein YYBH; alpha-beta protein., st 98.68
3rob_A139 Uncharacterized conserved protein; structural geno 98.68
3cu3_A172 Domain of unknown function with A cystatin-like F; 98.59
3gwr_A144 Putative calcium/calmodulin-dependent protein KIN 98.59
4i4k_A143 Uncharacterized protein SGCJ; structural genomics, 98.51
3b7c_A122 Uncharacterized protein; NTF-2 like protein, struc 98.42
2chc_A170 Protein RV3472; hypothetical protein; 1.69A {Mycob 98.41
3bb9_A148 Putative orphan protein; structural genomics, join 98.29
2ux0_A143 Calcium-calmodulin dependent protein kinase (CAM I 98.28
2rgq_A144 Domain of unknown function with A cystatin-like F; 98.24
3gzb_A154 Putative snoal-like polyketide cyclase; YP_0011826 98.23
3ecf_A130 NTF2-like protein; structural genomics, joint cent 98.1
2r4i_A123 Uncharacterized protein; NTF2-like protein, struct 98.09
3cnx_A170 Uncharacterized protein; putative dehydratase, NTF 98.07
3blz_A128 NTF2-like protein of unknown function; structural 98.06
3mg1_A323 OCP, orange carotenoid protein; carotenoid binding 98.04
3b8l_A163 Uncharacterized protein; putative aromatic ring hy 98.01
3gzr_A146 Uncharacterized protein with A NTF2-like fold; str 97.99
3a76_A176 Gamma-hexachlorocyclohexane dehydrochlorinase; bar 97.97
3fsd_A134 NTF2-like protein of unknown function in nutrient; 97.95
1tp6_A128 Hypothetical protein PA1314; structural genomics, 97.92
2f86_B143 Hypothetical protein K11E8.1D; UNC-43, oligomeriza 97.74
2rfr_A155 Uncharacterized protein; structural genomics, join 97.74
3ejv_A179 Uncharacterized protein with cystatin-like fold; s 97.65
3ke7_A134 Putative ketosteroid isomerase; structural genomic 97.57
3soy_A145 NTF2-like superfamily protein; structural genomics 97.51
3duk_A125 NTF2-like protein of unknown function; structural 97.45
2rcd_A129 Uncharacterized protein; structural genomics, join 97.42
3ksp_A129 Calcium/calmodulin-dependent kinase II associatio; 97.39
3fka_A120 Uncharacterized NTF-2 like protein; structural gen 97.33
3ef8_A150 Putative scyalone dehydratase; YP_496742.1, struct 97.31
4gb5_A159 Uncharacterized protein; structural genomics, PSI- 97.04
2owp_A129 Hypothetical protein BXE_B1374; cystatin-like fold 96.91
2imj_A166 Hypothetical protein DUF1348; alpha beta protein, 95.76
2gbw_B174 Biphenyl 2,3-dioxygenase beta subunit; rieske oxyg 94.34
2b1x_B172 Naphthalene dioxygenase small subunit; rieske non- 92.32
3e99_A164 Benzoate 1,2-dioxygenase beta subunit; structural 91.69
3eby_A163 Beta subunit of A putative aromatic-ring-hydroxyl 90.94
1wql_B186 Ethylbenzene dioxygenase small subunit; biphenyl d 90.44
1uli_B187 Biphenyl dioxygenase small subunit; alpha3 BETA3 h 90.21
4hyz_A114 Uncharacterized protein; PF13026 family protein, D 90.01
3gzx_B186 Biphenyl dioxygenase subunit beta; rieskie, non-he 89.03
2bmo_B194 Oxygenase-beta NBDO; nitrobenzene dioxygenase, nit 87.45
1idp_A172 Scytalone dehydratase; lyase, melanine biosynthesi 85.15
>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} Back     alignment and structure
Probab=99.91  E-value=1.4e-23  Score=157.81  Aligned_cols=124  Identities=13%  Similarity=0.125  Sum_probs=102.8

Q ss_pred             CCccchHHHHHHHHHHHHhcCCHHHHHhhccCCeEEEecCCC----cHHHHHHHHhcCCCCCCCcceeEEEEeEEEEeCC
Q 037228           14 DNEDEYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPP----GHQHLMHMLTGSSSSSEDKRCFTFVPLSTVAFGP   89 (171)
Q Consensus        14 ~~~~~~n~evV~~~~~A~~~gD~da~~~lla~Dvvw~~~gp~----G~~~~~~~l~~~~~~~~~~~~~~~~~~~via~Gd   89 (171)
                      ++..++++++|++|++||++||++++.+||+||++|+.|+.+    |++++.+++......   ..++++++..++++||
T Consensus        21 ~~~~mt~~eiv~~y~~A~n~~D~d~~~~l~a~D~v~~d~~~g~~~~Greai~~~~~~~~~~---~~d~~~~v~~~~~~gd   97 (158)
T 4h3u_A           21 QSNAMTTPEIVTAWAAAWTGTNPNALGTLFAADGTYVDHAIGATMTGREQISGWKARTDAM---IENVHVTITKAYRAGD   97 (158)
T ss_dssp             ----CCCCHHHHHHHHHHHSSCHHHHHTTEEEEEEEEETTTTEEEESHHHHHHHHHHHHHH---EEEEEEEEEEEEEETT
T ss_pred             ccCCCCHHHHHHHHHHHHHcCCHHHHHHHhcccceEeccCCCceEecchhhhhhhhhhhcc---CCccceeEeEEeecCc
Confidence            455667789999999999999999999999999999987632    888888877665432   3467899999999999


Q ss_pred             EEEEEEEeCc------e--eeeEEEEEEEeCCeEEEEEEecChHHHHHHhCCCCCCCCC
Q 037228           90 TVIVEGHSKE------H--SVSWVHAWTVTDGIITQVREYFNTSVTVTRFGDPQLLSSP  140 (171)
Q Consensus        90 ~Vvveg~~~g------~--~~~~v~vf~v~DGkI~~~~~Y~Dt~~~~~~lg~p~~~~~~  140 (171)
                      +|+++++.+|      +  .+.++.+|+|+||||+++++|+|+..+.+|+|+|.+...|
T Consensus        98 ~v~~~~~~~gt~~~tG~~~~~~~~~v~~~~dGkI~~~~~y~D~~~ll~QlGlp~~w~pa  156 (158)
T 4h3u_A           98 HVTIEAVYGGHIKGAPTPFAVPMATLLRTRGEEITSDQDYYSLSSVLAQSGLPADWTPS  156 (158)
T ss_dssp             EEEEEEEEEEEETTSSSCEEEEEEEEEEEETTEEEEEEEEECHHHHHHHHTCCTTCCC-
T ss_pred             eEEEEEEEEEEecCccCcceeeeEEEEEEECCEEEEEEEEECHHHHHHHcCCCCCCCCC
Confidence            9999877543      2  6778899999999999999999999999999999887654
>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Back     alignment and structure
>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Back     alignment and structure
>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Back     alignment and structure
>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 Back     alignment and structure
>3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP} Back     alignment and structure
>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Back     alignment and structure
>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Back     alignment and structure
>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} SCOP: d.17.4.0 Back     alignment and structure
>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Back     alignment and structure
>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 Back     alignment and structure
>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} Back     alignment and structure
>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* Back     alignment and structure
>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10 Back     alignment and structure
>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Back     alignment and structure
>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Back     alignment and structure
>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} Back     alignment and structure
>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Back     alignment and structure
>2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29 Back     alignment and structure
>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 Back     alignment and structure
>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* Back     alignment and structure
>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Back     alignment and structure
>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 Back     alignment and structure
>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} Back     alignment and structure
>3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} Back     alignment and structure
>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A Back     alignment and structure
>3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} Back     alignment and structure
>3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... Back     alignment and structure
>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A Back     alignment and structure
>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} Back     alignment and structure
>3lyg_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE GOL; 1.61A {Colwellia psychrerythraea} Back     alignment and structure
>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti} Back     alignment and structure
>3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} Back     alignment and structure
>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 Back     alignment and structure
>3flj_A Uncharacterized protein conserved in bacteria WIT cystatin-like fold; YP_168589.1; HET: MSE; 2.00A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 Back     alignment and structure
>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Back     alignment and structure
>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Back     alignment and structure
>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} Back     alignment and structure
>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Back     alignment and structure
>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 Back     alignment and structure
>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} Back     alignment and structure
>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 Back     alignment and structure
>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Back     alignment and structure
>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} Back     alignment and structure
>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 Back     alignment and structure
>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 Back     alignment and structure
>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 Back     alignment and structure
>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* Back     alignment and structure
>2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25 Back     alignment and structure
>3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A* Back     alignment and structure
>3ecf_A NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Anabaena variabilis atcc 29413} SCOP: d.17.4.21 Back     alignment and structure
>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 Back     alignment and structure
>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 Back     alignment and structure
>3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14 Back     alignment and structure
>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* Back     alignment and structure
>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} Back     alignment and structure
>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis} Back     alignment and structure
>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0 Back     alignment and structure
>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12 Back     alignment and structure
>2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7 Back     alignment and structure
>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3ejv_A Uncharacterized protein with cystatin-like fold; structural genomics, joint center for ST genomics, JCSG; HET: MSE PGE; 1.40A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.28 Back     alignment and structure
>3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0 Back     alignment and structure
>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 Back     alignment and structure
>3ksp_A Calcium/calmodulin-dependent kinase II associatio; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG; HET: MSE NHE; 2.59A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28 Back     alignment and structure
>4gb5_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, snoal-like domain, unknown function; HET: PGE; 1.55A {Kribbella flavida} Back     alignment and structure
>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 Back     alignment and structure
>2imj_A Hypothetical protein DUF1348; alpha beta protein, structural genomics, PSI-2, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} SCOP: d.17.4.23 Back     alignment and structure
>2gbw_B Biphenyl 2,3-dioxygenase beta subunit; rieske oxygenase, oxidoreductase, non heme iron; 1.70A {Sphingobium yanoikuyae} PDB: 2gbx_B* 2ckf_B Back     alignment and structure
>2b1x_B Naphthalene dioxygenase small subunit; rieske non-heme iron oxygenase, oxidoreductase; 2.00A {Rhodococcus SP} SCOP: d.17.4.4 PDB: 2b24_B Back     alignment and structure
>3e99_A Benzoate 1,2-dioxygenase beta subunit; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Burkholderia mallei atcc 23344} SCOP: d.17.4.4 Back     alignment and structure
>3eby_A Beta subunit of A putative aromatic-ring-hydroxyl dioxygenase; YP_001165631.1; 1.75A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.4 Back     alignment and structure
>1wql_B Ethylbenzene dioxygenase small subunit; biphenyl dioxygenase, cumene dioxygenase; 2.20A {Pseudomonas fluorescens} SCOP: d.17.4.4 Back     alignment and structure
>1uli_B Biphenyl dioxygenase small subunit; alpha3 BETA3 hetero hexamer, oxidoreductase; 2.20A {Rhodococcus SP} SCOP: d.17.4.4 PDB: 1ulj_B* 3en1_B* 3eqq_B Back     alignment and structure
>4hyz_A Uncharacterized protein; PF13026 family protein, DUF3887, structural genomics, joint for structural genomics, JCSG; 2.25A {Ruminococcus gnavus} Back     alignment and structure
>3gzx_B Biphenyl dioxygenase subunit beta; rieskie, non-heme iron, 2Fe-2S, aromatic hydroc catabolism, iron, iron-sulfur, metal-binding, NAD; HET: BNL MES; 1.58A {Comamonas testosteroni} SCOP: d.17.4.4 PDB: 3gzy_B* 2yfi_B 2xr8_B* 2xrx_B* 2xsh_B 2xso_B 2yfj_B* 2yfl_B* Back     alignment and structure
>2bmo_B Oxygenase-beta NBDO; nitrobenzene dioxygenase, nitroarene, rieske non-heme dioxygenase, substrate specificity iron- sulfur, metal-binding, NAD; 1.2A {Comamonas SP} SCOP: d.17.4.4 PDB: 2bmq_B 2bmr_B* 1o7n_B 1ndo_B 1o7g_B* 1o7h_B 1o7m_B 1eg9_B 1o7p_B* 1o7w_B 1uuv_B 1uuw_B 2hmj_B 2hmk_B* 2hml_B* 2hmm_B* 2hmn_B* 2hmo_B* Back     alignment and structure
>1idp_A Scytalone dehydratase; lyase, melanine biosynthesis; 1.45A {Magnaporthe grisea} SCOP: d.17.4.1 PDB: 2std_A* 1std_A* 3std_A* 6std_A* 4std_A* 5std_A* 7std_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 171
d1tuha_131 d.17.4.11 (A:) Hypothetical protein egc068 from a 5e-15
d3ebta1131 d.17.4.9 (A:1-131) Uncharacterized protein BPSS013 2e-12
d3dm8a1135 d.17.4.20 (A:1-135) Uncharacterized protein Rpa434 2e-11
d1s5aa_139 d.17.4.10 (A:) Hypothetical protein YesE {Bacillus 2e-11
d3dmca1133 d.17.4.10 (A:1-133) Uncharacterized protein Ava226 2e-11
d1nwwa_145 d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhod 3e-11
d1z1sa1129 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 4e-11
d2bnga1132 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 2e-10
d3ec9a1130 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0 1e-09
d3en8a1127 d.17.4.20 (A:1-127) Uncharacterized protein BxeB20 3e-09
d2a15a1132 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {M 7e-06
d1ohpa1125 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase 1e-05
d1sjwa_142 d.17.4.9 (A:) Nogalonic acid methyl ester cyclase 2e-04
d2f99a1140 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyc 3e-04
>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Length = 131 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: Hypothetical protein egc068 from a soil-derived mobile gene cassette
domain: Hypothetical protein egc068 from a soil-derived mobile gene cassette
species: uncultured organism [TaxId: 155900]

 Score = 65.7 bits (159), Expect = 5e-15
 Identities = 27/129 (20%), Positives = 38/129 (29%), Gaps = 12/129 (9%)

Query: 15  NEDEYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPPGHQHLM-----HMLTGSSS 69
           NE E N   V+  Y A NS D+KT+  L   +  W   G                     
Sbjct: 1   NEAEQNAETVRRGYAAFNSGDMKTLTELFDENASWHTPGRSRIAGDHKGREAIFAQFGRY 60

Query: 70  SSEDKRCFTFVPLSTVAFGPTVIVEGHS-------KEHSVSWVHAWTVTDGIITQVREYF 122
             E    F  V L  +      ++  H        K   V     +   +G +   RE+F
Sbjct: 61  GGETGGTFKAVLLHVLKSDDGRVIGIHRNTAERGGKRLDVGCCIVFEFKNGRVIDGREHF 120

Query: 123 NTSVTVTRF 131
                   F
Sbjct: 121 YDLYAWDEF 129
>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Length = 131 Back     information, alignment and structure
>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 135 Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Length = 139 Back     information, alignment and structure
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Length = 133 Back     information, alignment and structure
>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Length = 145 Back     information, alignment and structure
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Length = 129 Back     information, alignment and structure
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 132 Back     information, alignment and structure
>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Length = 130 Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Length = 127 Back     information, alignment and structure
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 132 Back     information, alignment and structure
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Length = 125 Back     information, alignment and structure
>d1sjwa_ d.17.4.9 (A:) Nogalonic acid methyl ester cyclase SnoaL {Streptomyces nogalater [TaxId: 38314]} Length = 142 Back     information, alignment and structure
>d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d2bnga1132 Uncharacterized protein Mb2760 {Mycobacterium tube 99.89
d1nwwa_145 Limonene-1,2-epoxide hydrolase {Rhodococcus erythr 99.89
d3ebta1131 Uncharacterized protein BPSS0132 {Burkholderia pse 99.89
d3dm8a1135 Uncharacterized protein Rpa4348 {Rhodopseudomonas 99.86
d3ec9a1130 Uncharacterized protein BTHI0051 {Burkholderia tha 99.86
d2geya1144 Putative hydroxylase AclR {Streptomyces galilaeus 99.85
d1z1sa1129 Uncharacterized protein PA3332 {Pseudomonas aerugi 99.84
d3dmca1133 Uncharacterized protein Ava2261 {Anabaena variabil 99.84
d1tuha_131 Hypothetical protein egc068 from a soil-derived mo 99.83
d1s5aa_139 Hypothetical protein YesE {Bacillus subtilis [TaxI 99.83
d2gexa1138 Nogalamycin biosynthesis protein SnoL {Streptomyce 99.82
d3en8a1127 Uncharacterized protein BxeB2092 {Burkholderia xen 99.82
d2f99a1140 Aklanonic acid methyl ester cyclase, AknH {Strepto 99.82
d1sjwa_142 Nogalonic acid methyl ester cyclase SnoaL {Strepto 99.81
d2k54a1123 Uncharacterized protein Atu0742 {Agrobacterium tum 99.77
d1ohpa1125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 99.7
d2a15a1132 Hypothetical protein Rv0760c {Mycobacterium tuberc 99.69
d1oh0a_125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 99.65
d3dxoa1117 Uncharacterized protein Atu0744 {Agrobacterium tum 99.45
d1m98a2142 Orange carotenoid protein, C-terminal domain {Cyan 99.15
d2gxfa1128 Hypothetical protein YybH {Bacillus subtilis [TaxI 98.85
d3d9ra1132 Uncharacterized protein ECA1476 {Pectobacterium at 98.77
d2r4ia1122 Uncharacterized protein CHU142 {Cytophaga hutchins 98.65
d3b7ca1121 Uncharacterized protein SO0125 {Shewanella oneiden 98.48
d3cu3a1162 Uncharacterized protein NpunR1993 {Nostoc punctifo 98.46
d2ux0a1135 Association domain of calcium/calmodulin-dependent 98.45
d3cnxa1153 Uncharacterized protein SAV4671 {Streptomyces aver 98.37
d3bb9a1121 Uncharacterized protein Sfri1973 {Shewanella frigi 98.33
d2rcda1127 Uncharacterized protein ECA3500 {Pectobacterium at 98.19
d2rgqa1133 Uncharacterized protein NpunR3134 {Nostoc punctifo 98.15
d2f86b1129 Association domain of calcium/calmodulin-dependent 98.08
d2owpa1128 Hypothetical protein BxeB1374 {Burkholderia xenovo 97.98
d2chca1167 Uncharacterized protein Rv3472 {Mycobacterium tube 97.88
d3blza1124 Uncharacterized protein Sbal0622 {Shewanella balti 97.79
d3ejva1159 Uncharacterized protein Saro2766 {Novosphingobium 97.74
d3ef8a1149 Uncharacterized protein Saro1465 {Novosphingobium 97.45
d3b8la1144 Uncharacterized protein Saro3538 {Novosphingobium 97.44
d3ecfa1128 Uncharacterized protein Ava4193 {Anabaena variabil 97.01
d2rfra1153 Uncharacterized protein Saro3722 {Novosphingobium 97.0
d3er7a1118 Uncharacterized protein Exig0174 {Exiguobacterium 96.87
d3ebya1157 Putative hydroxylase subunit Saro3860 {Novosphingo 96.67
d2imja1155 Hypothetical protein PFL3262 {Pseudomonas fluoresc 95.19
d3e99a1163 Benzoate 1,2-dioxygenase beta subunit BenB {Burkho 94.11
d1ulib_177 Biphenyl dioxygenase small subunit BphA2 {Rhodococ 91.69
d2b1xb1167 Naphthalene 1,2-dioxygenase beta subunit {Rhodococ 91.47
d1wqlb1182 Small subunit of cumene dioxygenase CumA2 {Pseudom 90.87
d1jkga_139 NTF2-related export protein 1 (p15) {Human (Homo s 90.56
d1idpa_147 Scytalone dehydratase {Fungus (Magnaporthe grisea) 90.39
d1tp6a_126 Hypothetical protein PA1314 {Pseudomonas aeruginos 84.12
d1zo2a1117 Nuclear transport factor-2 (NTF2) {Cryptosporidium 83.45
d1gy7a_121 Nuclear transport factor-2 (NTF2) {Baker's yeast ( 82.23
d1gy6a_125 Nuclear transport factor-2 (NTF2) {Rat (Rattus nor 80.18
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: Limonene-1,2-epoxide hydrolase-like
domain: Uncharacterized protein Mb2760
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=99.89  E-value=5.5e-23  Score=148.90  Aligned_cols=118  Identities=25%  Similarity=0.250  Sum_probs=101.4

Q ss_pred             cchHHHHHHHHHHHHhcCCHHHHHhhccCCeEEEecCCC---cHHHHHHHHhcCCCCCCCcceeEEEEeEEEEeCCEEEE
Q 037228           17 DEYNIRVVKTLYDALNSFDVKTVHRLLTSDLEWWFHGPP---GHQHLMHMLTGSSSSSEDKRCFTFVPLSTVAFGPTVIV   93 (171)
Q Consensus        17 ~~~n~evV~~~~~A~~~gD~da~~~lla~Dvvw~~~gp~---G~~~~~~~l~~~~~~~~~~~~~~~~~~~via~Gd~Vvv   93 (171)
                      +++++++|++||+|++++|++++.++++||++|+.++.+   |++.+.+++......    .++++++..+.++||.|++
T Consensus         2 t~e~~~~V~~f~~A~~~~D~d~~~~~~a~D~v~~~~~~~~~~G~~~~~~~~~~~~~~----~~~~~~~~~~~~~gd~v~~   77 (132)
T d2bnga1           2 TTEAIRAVEAFLNALQNEDFDTVDAALGDDLVYENVGFSRIRGGRRTATLLRRMQGR----VGFEVKIHRIGADGAAVLT   77 (132)
T ss_dssp             HHHHHHHHHHHHHHHHHTCHHHHHHHEEEEEEEEETTTEEEECHHHHHHHHHTTTTT----CEEEEEEEEEEEETTEEEE
T ss_pred             cchHHHHHHHHHHHHHccCHHHHHHHhccchheeccccCCcchHHHHHHHHHhcccc----cCcceEEEEeeccCCceEE
Confidence            467899999999999999999999999999999998743   888888888776542    3578899999999999999


Q ss_pred             EEEeC----ce--eeeEEEEEEEeCCeEEEEEEecChHHHHHHh--CCCCCCC
Q 037228           94 EGHSK----EH--SVSWVHAWTVTDGIITQVREYFNTSVTVTRF--GDPQLLS  138 (171)
Q Consensus        94 eg~~~----g~--~~~~v~vf~v~DGkI~~~~~Y~Dt~~~~~~l--g~p~~~~  138 (171)
                      ++..+    |.  ..+++++|+|+||||+++++|+|+..+.+||  |.|..|.
T Consensus        78 ~~~~~~~~~g~~~~~~~~~~~~v~dGkI~~~~~y~D~~~~~~~l~~g~~~~~~  130 (132)
T d2bnga1          78 ERTDALIIGPLRVQFWVCGVFEVDDGRITLWRDYFDVYDMFKGLLRGLVALVV  130 (132)
T ss_dssp             EEEEEEEETTEEEEEEEEEEEEEETTEEEEEEEECCHHHHHHHHHHHHHHTTS
T ss_pred             EEEEEEEECCcEEEEEEEEEEEEcCCEEEEEEEEeCHHHHHHHHHHhhhhccC
Confidence            86643    32  7778899999999999999999999999999  6677764
>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Back     information, alignment and structure
>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d1sjwa_ d.17.4.9 (A:) Nogalonic acid methyl ester cyclase SnoaL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Back     information, alignment and structure
>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} Back     information, alignment and structure
>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]} Back     information, alignment and structure
>d3ejva1 d.17.4.28 (A:2-160) Uncharacterized protein Saro2766 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3b8la1 d.17.4.28 (A:1-144) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3ecfa1 d.17.4.21 (A:2-129) Uncharacterized protein Ava4193 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3er7a1 d.17.4.24 (A:5-122) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]} Back     information, alignment and structure
>d3ebya1 d.17.4.4 (A:6-162) Putative hydroxylase subunit Saro3860 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d2imja1 d.17.4.23 (A:5-159) Hypothetical protein PFL3262 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d3e99a1 d.17.4.4 (A:1-163) Benzoate 1,2-dioxygenase beta subunit BenB {Burkholderia mallei [TaxId: 13373]} Back     information, alignment and structure
>d1ulib_ d.17.4.4 (B:) Biphenyl dioxygenase small subunit BphA2 {Rhodococcus sp. (strain RHA1) [TaxId: 101510]} Back     information, alignment and structure
>d2b1xb1 d.17.4.4 (B:513-679) Naphthalene 1,2-dioxygenase beta subunit {Rhodococcus sp. ncimb12038 [TaxId: 92694]} Back     information, alignment and structure
>d1wqlb1 d.17.4.4 (B:5-186) Small subunit of cumene dioxygenase CumA2 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1idpa_ d.17.4.1 (A:) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1tp6a_ d.17.4.12 (A:) Hypothetical protein PA1314 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure