Citrus Sinensis ID: 037249

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
MLVGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLGNLSNLQSLDLSLNYLYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRLSNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQLSVADRPRRIPRSMASLCNLRTIYLSGCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWVPPFQLVQLGLRSFYLDLFNNSFSGSISHFCYQNLMLLTLSNNKFTGNLPNSLGSLTSLVSLHLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSNQFRGLLPT
cccEEccccccccccccEEEccccccccccccHHHcccccccEEcccccccEEcccccccccccccEEEccccccEEcccHHHHccccccEEEEEcEEEcccccHHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccccccccccHHHHcccccccEEcccccccccccccccccccEEEcccccccccccEEEcccccEEcccccccccccccEEEcccccccccccHHHHccccccEEEccccEEEEEEcHHHHcccccccEEEccccEEEEEEccccccccccccccccccEEEcccccccccccHHHHHccccEEcccccccccccccHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccc
cccccccHHHcccccccEEEccccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHcccccccEEEEEccccccccccHHHccccccEEEEEcccccccccccccccccHHHcccccccEEEcccccccccHHHcccccccEEEcccccccccEEEEEccccccccccHHHcccccccEEEcccccccccHHHcHccccccEEEEEccccccccccHHHHcccccccEEEcccccccccccHHHcccHHHHHHHccccEEEcccccccccccHHHHHHccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHHHHcccEEEcccccccccccc
mlvgkvnpslldlnhlsylglsfndfqgvqiprfIGSIRnlrylnlsdtqfvgmippplgnlsnlqsldlslnYLYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRLsncqlhhlppltisnfsslTVLDLsfsqfdnslipgwgpipswlyrlthfeqlsvadrprriprsMASLCNLRTIYLSGCVSKELEILVLQSssisghlteqighfknldtldlgnnsivglvplslnELSKLrilhlpdnklngtLFEIHFVNLTKLSVSsvnennltlkvnhdwvppfqlVQLGLRSFYLDLfnnsfsgsisHFCYQNLMLLTlsnnkftgnlpnslgSLTSLVSLHLHknifsgtipislknCTALMIldvgenefvGNISTWFGERFSRVVVLILRSnqfrgllpt
mlvgkvnpsllDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLGNLSNLQSLDLSLNYLYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRLSNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQlsvadrprriPRSMASLCNLRTIYLSGCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWVPPFQLVQLGLRSFYLDLFNNSFSGSISHFCYQNLMLLTLSNNKFTGNLPNSLGSLTSLVSLHLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILrsnqfrgllpt
MLVGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPlgnlsnlqsldlslnylYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRLSNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQLSVADRPRRIPRSMASLCNLRTIYLSGCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWVPPFQLVQLGLRSFYLDLFNNSFSGSISHFCYQNLMLLTLSNNKFTGNLPNSLGSLTSLVSLHLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSNQFRGLLPT
********SLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLGNLSNLQSLDLSLNYLYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRLSNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQLSVADRPRRIPRSMASLCNLRTIYLSGCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWVPPFQLVQLGLRSFYLDLFNNSFSGSISHFCYQNLMLLTLSNNKFTGNLPNSLGSLTSLVSLHLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSNQFR*****
MLVGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLGNLSNLQSLDLSLNYLYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRLSNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQLSVADRPRRIPRSMASLCNLRTIYLSGCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWVPPFQLVQLGLRSFYLDLFNNSFSGSISHFCYQNLMLLTLSNNKFTGNLPNSLGSLTSLVSLHLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSNQFRGLLP*
MLVGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLGNLSNLQSLDLSLNYLYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRLSNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQLSVADRPRRIPRSMASLCNLRTIYLSGCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWVPPFQLVQLGLRSFYLDLFNNSFSGSISHFCYQNLMLLTLSNNKFTGNLPNSLGSLTSLVSLHLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSNQFRGLLPT
**VGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLGNLSNLQSLDLSLNYLYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRLSNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQLSVADRPRRIPRSMASLCNLRTIYLSGCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWVPPFQLVQLGLRSFYLDLFNNSFSGSISHFCYQNLMLLTLSNNKFTGNLPNSLGSLTSLVSLHLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSNQFR*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLGNLSNLQSLDLSLNYLYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRLSNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQLSVADRPRRIPRSMASLCNLRTIYLSGCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWVPPFQLVQLGLRSFYLDLFNNSFSGSISHFCYQNLMLLTLSNNKFTGNLPNSLGSLTSLVSLHLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSNQFRGLLPT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query420 2.2.26 [Sep-21-2011]
Q9LHP4 1141 Receptor-like protein kin no no 0.869 0.319 0.325 1e-31
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.964 0.323 0.316 1e-31
C0LGQ5 1249 LRR receptor-like serine/ no no 0.923 0.310 0.313 2e-30
Q9C9H7 847 Receptor-like protein 12 no no 0.914 0.453 0.307 7e-29
Q9SHI2 1101 Leucine-rich repeat recep no no 0.952 0.363 0.300 4e-28
Q9LVP0 1102 Probable leucine-rich rep no no 0.952 0.362 0.292 1e-27
C0LGV1 1135 LRR receptor-like serine/ no no 0.888 0.328 0.295 2e-26
Q9LYN8 1192 Leucine-rich repeat recep no no 0.902 0.317 0.280 2e-26
O22938 890 Leucine-rich repeat recep no no 0.830 0.392 0.293 3e-26
Q9FL28 1173 LRR receptor-like serine/ no no 0.861 0.308 0.296 4e-26
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function desciption
 Score =  138 bits (347), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 138/424 (32%), Positives = 200/424 (47%), Gaps = 59/424 (13%)

Query: 1   MLVGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLG 60
           M+ G++   L + + L  L L  N   G  IPR IG +  L  L L     VG IP  +G
Sbjct: 261 MISGEIPSDLGNCSELVDLFLYENSLSG-SIPREIGQLTKLEQLFLWQNSLVGGIPEEIG 319

Query: 61  NLSNLQSLDLSLNYLYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRL 120
           N SNL+ +DLSLN L       +  LSFLE+  +   N    S    ++N   SLV+L+L
Sbjct: 320 NCSNLKMIDLSLNLLSGSIPSSIGRLSFLEEF-MISDNKFSGSIPTTISNC-SSLVQLQL 377

Query: 121 SNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQLSVADRP- 179
              Q+  L P   S   +LT L L F+ + N L    G IP  L   T  + L ++    
Sbjct: 378 DKNQISGLIP---SELGTLTKLTLFFA-WSNQL---EGSIPPGLADCTDLQALDLSRNSL 430

Query: 180 -RRIPRSMASLCNLRTIYLSGCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNS 238
              IP  +  L NL               L+L S+S+SG + ++IG+  +L  L LG N 
Sbjct: 431 TGTIPSGLFMLRNLTK-------------LLLISNSLSGFIPQEIGNCSSLVRLRLGFNR 477

Query: 239 IVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWVP 298
           I G +P  +  L K+  L    N+L+G + +          + S +E             
Sbjct: 478 ITGEIPSGIGSLKKINFLDFSSNRLHGKVPD---------EIGSCSE------------- 515

Query: 299 PFQLVQLGLRSFYLDLFNNSFSGSISH--FCYQNLMLLTLSNNKFTGNLPNSLGSLTSLV 356
             Q++         DL NNS  GS+ +       L +L +S N+F+G +P SLG L SL 
Sbjct: 516 -LQMI---------DLSNNSLEGSLPNPVSSLSGLQVLDVSANQFSGKIPASLGRLVSLN 565

Query: 357 SLHLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSNQFRG 416
            L L KN+FSG+IP SL  C+ L +LD+G NE  G I +  G+  +  + L L SN+  G
Sbjct: 566 KLILSKNLFSGSIPTSLGMCSGLQLLDLGSNELSGEIPSELGDIENLEIALNLSSNRLTG 625

Query: 417 LLPT 420
            +P+
Sbjct: 626 KIPS 629

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|O22938|Y2182_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 OS=Arabidopsis thaliana GN=At2g41820 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query420
209970622 965 HB06p [Malus floribunda] 0.973 0.423 0.363 4e-67
315436720 1020 verticillium wilt resistance-like protei 0.983 0.404 0.368 1e-63
350284761 915 receptor-like protein [Malus micromalus] 0.983 0.451 0.359 3e-63
350284753 915 receptor-like protein [Malus micromalus] 0.983 0.451 0.359 3e-63
209970631 962 HcrVf4 [Malus floribunda] 0.983 0.429 0.359 4e-63
14330718 915 HcrVf3 protein [Malus floribunda] 0.985 0.452 0.363 2e-62
209970625 974 HB09p [Malus floribunda] 0.990 0.427 0.320 1e-60
147766646 939 hypothetical protein VITISV_020133 [Viti 0.964 0.431 0.350 5e-60
359473600 968 PREDICTED: leucine-rich repeat receptor 0.973 0.422 0.353 1e-59
209970605 974 HB03p [Malus floribunda] 0.990 0.427 0.319 6e-59
>gi|209970622|gb|ACJ03072.1| HB06p [Malus floribunda] Back     alignment and taxonomy information
 Score =  261 bits (668), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 194/534 (36%), Positives = 261/534 (48%), Gaps = 125/534 (23%)

Query: 2   LVGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLGN 61
           L GK+NPSLL L HL+YL LS+N+FQG+QIP F+GS++ LRYLNLS+  F G+IPP LGN
Sbjct: 135 LGGKINPSLLHLKHLNYLDLSYNNFQGMQIPSFLGSLKTLRYLNLSEAGFRGLIPPQLGN 194

Query: 62  LSNLQSLDLSLNYLYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRLS 121
           L+NL  L LS N L VEN  W+S L  L+ LDL  VN+SKAS+WL   N LP LVEL + 
Sbjct: 195 LTNLHFLSLSDN-LKVENLEWISSLFHLKYLDLSSVNVSKASNWLQAINKLPFLVELHMV 253

Query: 122 NCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQL-------- 173
           +CQL H+PPL I NF+SL+VLDLS + FD+ +       P W++ L +   L        
Sbjct: 254 DCQLDHIPPLPIINFTSLSVLDLSENSFDSLM-------PRWVFSLRNLTSLYLENCGFQ 306

Query: 174 -SVADRPRRIPRSMASLCNLRTI----------------YLSGCVSKELEILVLQSSSIS 216
            + +  P+    S+ +LC L  +                 LS C    ++ L L  ++ S
Sbjct: 307 GTFSSHPKEPDLSLDNLCELMDLDLSYNKFNGNASDIFESLSVCGPDRIKSLSLSKNNFS 366

Query: 217 GHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEI------ 270
           GHLTEQ+G F+NL  L++  NSI G +P+SL  LS L  L + DN+ NGTL E+      
Sbjct: 367 GHLTEQVGEFRNLSHLEIYGNSISGPIPISLGNLSCLEFLIISDNRFNGTLPEVLGQLKM 426

Query: 271 ------------------HFVNLTKLSVSSVNENNLTLKVNHDWVPPFQLVQLGLRSFYL 312
                             HF +LTKL       N LTLK + DW+PPFQL +L L  ++L
Sbjct: 427 LSYLEISDNPFEGVVSEAHFSHLTKLKHFIAARNPLTLKTSRDWLPPFQLERLWLDYWHL 486

Query: 313 ------------------------------------------DLFNNSFSGSISHFCYQN 330
                                                     +L +N   G I      +
Sbjct: 487 GPEFPVWLRTQTQLKLLSLPNTEISDTFPTWFWNISSQLWTVNLSSNQLHGEIQGIVGGS 546

Query: 331 LMLLTLSNNKFTGN-------------------------LPNSLGSLTSLVSLHLHKNIF 365
           L  + LS N+F G+                           + +    +LVSLHL  N  
Sbjct: 547 LFSVDLSFNQFNGSLPLVSSSVSSLDLSGSSFSGSLFHFFCDRMNEPKNLVSLHLRDNFL 606

Query: 366 SGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSNQFRGLLP 419
           +G IP  L N   L IL++  N+  GNI +  G     +V L L +N   G LP
Sbjct: 607 TGEIPNCLMNWKRLSILNLNSNKLTGNIPSSIG-YLESLVSLHLHNNHLYGELP 659

Source: Malus floribunda

Species: Malus floribunda

Genus: Malus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|315436720|gb|ADU18533.1| verticillium wilt resistance-like protein [Gossypium barbadense] Back     alignment and taxonomy information
>gi|350284761|gb|AEQ27752.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|350284753|gb|AEQ27748.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|209970631|gb|ACJ03074.1| HcrVf4 [Malus floribunda] Back     alignment and taxonomy information
>gi|14330718|emb|CAC40827.1| HcrVf3 protein [Malus floribunda] Back     alignment and taxonomy information
>gi|209970625|gb|ACJ03073.1| HB09p [Malus floribunda] Back     alignment and taxonomy information
>gi|147766646|emb|CAN76220.1| hypothetical protein VITISV_020133 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473600|ref|XP_002272516.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|209970605|gb|ACJ03065.1| HB03p [Malus floribunda] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query420
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.945 0.317 0.298 3.2e-31
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.697 0.249 0.314 4.4e-31
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.909 0.350 0.275 1.9e-30
TAIR|locus:2044767 905 AT2G34930 "AT2G34930" [Arabido 0.802 0.372 0.348 2.7e-30
TAIR|locus:2825389 784 RLP11 "AT1G71390" [Arabidopsis 0.933 0.5 0.311 3.2e-30
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.952 0.362 0.283 4.5e-29
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.942 0.348 0.292 1.3e-28
TAIR|locus:2206245 720 CLV2 "clavata 2" [Arabidopsis 0.947 0.552 0.291 1.8e-28
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.947 0.318 0.288 1.4e-27
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.940 0.466 0.282 8.1e-27
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 356 (130.4 bits), Expect = 3.2e-31, P = 3.2e-31
 Identities = 130/435 (29%), Positives = 203/435 (46%)

Query:     2 LVGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPXXX 61
             L G +   L  L +L  L L  N F G +IP  +G + +++YLNL   Q  G+IP     
Sbjct:   228 LNGSLPAELNRLKNLQTLNLGDNSFSG-EIPSQLGDLVSIQYLNLIGNQLQGLIPKRLTE 286

Query:    62 XXXXXXXXXXXX--XXYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELR 119
                              +    W   ++ LE L L    LS +    + +N   SL +L 
Sbjct:   287 LANLQTLDLSSNNLTGVIHEEFWR--MNQLEFLVLAKNRLSGSLPKTICSNNT-SLKQLF 343

Query:   120 LSNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQLSVADRP 179
             LS  QL    P  ISN  SL +LDLS    +N+L    G IP  L++L     L + +  
Sbjct:   344 LSETQLSGEIPAEISNCQSLKLLDLS----NNTLT---GQIPDSLFQLVELTNLYLNNNS 396

Query:   180 RR--IPRSMASLCNLR--TIY---LSGCVSKE------LEILVLQSSSISGHLTEQIGHF 226
                 +  S+++L NL+  T+Y   L G V KE      LEI+ L  +  SG +  +IG+ 
Sbjct:   397 LEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGEMPVEIGNC 456

Query:   227 KNLDTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNEN 286
               L  +D   N + G +P S+  L  L  LHL +N+L G +      N  +++V  + +N
Sbjct:   457 TRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNI-PASLGNCHQMTVIDLADN 515

Query:   287 NLTLKVNHDWVPPFQLVQLGLRSFYLDLFNNSFSGSI--SHFCYQNLMLLTLSNNKFTGN 344
              L+  +      P     L     ++ ++NNS  G++  S    +NL  +  S+NKF G+
Sbjct:   516 QLSGSI------PSSFGFLTALELFM-IYNNSLQGNLPDSLINLKNLTRINFSSNKFNGS 568

Query:   345 LPNSLGSLTSLVSLHLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRV 404
             +    GS +S +S  + +N F G IP+ L   T L  L +G+N+F G I   FG + S +
Sbjct:   569 ISPLCGS-SSYLSFDVTENGFEGDIPLELGKSTNLDRLRLGKNQFTGRIPRTFG-KISEL 626

Query:   405 VVLILRSNQFRGLLP 419
              +L +  N   G++P
Sbjct:   627 SLLDISRNSLSGIIP 641
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0009553 "embryo sac development" evidence=IMP
GO:0008544 "epidermis development" evidence=IGI
GO:0009790 "embryo development" evidence=IGI
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206245 CLV2 "clavata 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-27
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-21
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PLN032101153 PLN03210, PLN03210, Resistant to P 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  139 bits (351), Expect = 1e-35
 Identities = 139/436 (31%), Positives = 206/436 (47%), Gaps = 37/436 (8%)

Query: 1   MLVGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLG 60
           ML G++   +   + L  L L  N   G +IP  + ++ +L +L L+  Q VG IP  LG
Sbjct: 151 MLSGEIPNDIGSFSSLKVLDLGGNVLVG-KIPNSLTNLTSLEFLTLASNQLVGQIPRELG 209

Query: 61  NLSNLQSLDLSLNYLYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRL 120
            + +L+ + L  N L  E    + GL+ L  LDL Y NL+      L    L +L  L L
Sbjct: 210 QMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL--GNLKNLQYLFL 267

Query: 121 SNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQLSV--ADR 178
              +L    P +I +   L  LDLS    DNSL    G IP  + +L + E L +   + 
Sbjct: 268 YQNKLSGPIPPSIFSLQKLISLDLS----DNSLS---GEIPELVIQLQNLEILHLFSNNF 320

Query: 179 PRRIPRSMASLCNLRTIYL-----SGCVSKEL------EILVLQSSSISGHLTEQIGHFK 227
             +IP ++ SL  L+ + L     SG + K L       +L L +++++G + E +    
Sbjct: 321 TGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSG 380

Query: 228 NLDTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENN 287
           NL  L L +NS+ G +P SL     LR + L DN  +G L    F  L  +    ++ NN
Sbjct: 381 NLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPS-EFTKLPLVYFLDISNNN 439

Query: 288 LTLKVN-HDW-VPPFQLVQLGLRSFYLDLFNNSFSGSI-SHFCYQNLMLLTLSNNKFTGN 344
           L  ++N   W +P  Q+         L L  N F G +   F  + L  L LS N+F+G 
Sbjct: 440 LQGRINSRKWDMPSLQM---------LSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGA 490

Query: 345 LPNSLGSLTSLVSLHLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRV 404
           +P  LGSL+ L+ L L +N  SG IP  L +C  L+ LD+  N+  G I   F E    +
Sbjct: 491 VPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSE-MPVL 549

Query: 405 VVLILRSNQFRGLLPT 420
             L L  NQ  G +P 
Sbjct: 550 SQLDLSQNQLSGEIPK 565

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 420
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.76
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.72
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.66
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.45
KOG0617264 consensus Ras suppressor protein (contains leucine 99.43
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.36
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.33
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.26
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
PLN03150623 hypothetical protein; Provisional 99.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.0
PLN03150 623 hypothetical protein; Provisional 99.0
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.98
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.97
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.96
KOG4341483 consensus F-box protein containing LRR [General fu 98.96
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.9
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.9
KOG4341483 consensus F-box protein containing LRR [General fu 98.89
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.86
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.85
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.85
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.76
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.76
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.65
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.59
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.48
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.36
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.24
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.17
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.12
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.93
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.88
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.87
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.83
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.72
PRK15386 426 type III secretion protein GogB; Provisional 97.68
PRK15386 426 type III secretion protein GogB; Provisional 97.63
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.55
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.54
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.44
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.36
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.33
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.19
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.97
KOG4308478 consensus LRR-containing protein [Function unknown 95.92
KOG4308 478 consensus LRR-containing protein [Function unknown 95.84
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.64
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.24
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.08
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.11
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 93.42
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 89.32
KOG0473 326 consensus Leucine-rich repeat protein [Function un 88.48
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.72
smart0037026 LRR Leucine-rich repeats, outliers. 87.72
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 87.27
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 83.19
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.2e-44  Score=370.58  Aligned_cols=406  Identities=32%  Similarity=0.439  Sum_probs=254.9

Q ss_pred             CCCCCCccCCCCCCcEEecccCCCCCCCchhhhhccccCceeecCCCcccCCCCCCCCCCCCccEEEeeccccccccccc
Q 037249            3 VGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLGNLSNLQSLDLSLNYLYVENFLW   82 (420)
Q Consensus         3 ~~~l~~~~~~~~~L~~L~l~~~~i~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~   82 (420)
                      .|.+|+.+.++++|++|++++|.+... +|..+.++++|++|++++|.+.+.+|..++++++|++|++++|.+....+..
T Consensus       153 ~~~~p~~~~~l~~L~~L~L~~n~l~~~-~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~  231 (968)
T PLN00113        153 SGEIPNDIGSFSSLKVLDLGGNVLVGK-IPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYE  231 (968)
T ss_pred             cccCChHHhcCCCCCEEECccCccccc-CChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChh
Confidence            345555556666666666665555433 4555555566666666666555555555555556666666555555444444


Q ss_pred             ccCCCcccEEEcccccCCCccchhhhhCCCCCCcEEEccCCCCCCCCchhhccCCCCCEEEccCCcCCCCCCCCCCCCCh
Q 037249           83 LSGLSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRLSNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPS  162 (420)
Q Consensus        83 ~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~  162 (420)
                      +.++++|++|++++|.+...  ....+..+++|++|++++|.+.+..+..+..+++|++|++++|.+.       +.++.
T Consensus       232 l~~l~~L~~L~L~~n~l~~~--~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~-------~~~p~  302 (968)
T PLN00113        232 IGGLTSLNHLDLVYNNLTGP--IPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLS-------GEIPE  302 (968)
T ss_pred             HhcCCCCCEEECcCceeccc--cChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeec-------cCCCh
Confidence            55556666666655554422  1224445555666666655555444444555555666666555543       22444


Q ss_pred             hhhhccccccccccCCC--CccccccccccCCcEEeeccCcc-----------cceeEEEeecCcccccchhhhhcCCCC
Q 037249          163 WLYRLTHFEQLSVADRP--RRIPRSMASLCNLRTIYLSGCVS-----------KELEILVLQSSSISGHLTEQIGHFKNL  229 (420)
Q Consensus       163 ~l~~~~~L~~L~l~~~~--~~~~~~~~~~~~L~~L~l~~~~~-----------~~l~~L~l~~~~~~~~~~~~l~~~~~L  229 (420)
                      .+..+++|+.|++.++.  ...|.++..+++|+.|++++|.+           +.++.|++++|.+.+..+..+..+++|
T Consensus       303 ~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L  382 (968)
T PLN00113        303 LVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNL  382 (968)
T ss_pred             hHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCC
Confidence            55555555555555554  33445555555555555555543           245555555555555555555555555


Q ss_pred             CEEECCCcccccCCccchhhccCCcEeecCCccccCccchhhhcccCccceEeecCCccceecCCCCCCccceeeecccc
Q 037249          230 DTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWVPPFQLVQLGLRS  309 (420)
Q Consensus       230 ~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~~~~l~~~~  309 (420)
                      +.+++++|.+.+..|..++.+++|+.|++++|.+++..+. .+..+++|+.+++++|.+....+..+.....++.+.+..
T Consensus       383 ~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~-~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~  461 (968)
T PLN00113        383 FKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPS-EFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLAR  461 (968)
T ss_pred             CEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECCh-hHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcC
Confidence            5555555555555555555566666666666665554444 455566666666666655554444444444444444333


Q ss_pred             e----------------eeccccCccccccccc--ccCCccEEEccCCccccCCcccccccccccEEeccCCccccccCc
Q 037249          310 F----------------YLDLFNNSFSGSISHF--CYQNLMLLTLSNNKFTGNLPNSLGSLTSLVSLHLHKNIFSGTIPI  371 (420)
Q Consensus       310 ~----------------~l~l~~~~~~~~~~~~--~~~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~  371 (420)
                      +                .+++++|.+.+..+..  .+++|++|++++|++.+.+|..+..+++|+.|++++|.+++.+|.
T Consensus       462 n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~  541 (968)
T PLN00113        462 NKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPA  541 (968)
T ss_pred             ceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCCh
Confidence            2                5777888887776654  567889999999999888888888999999999999999888888


Q ss_pred             cccccCCCceEeCCCcccccccchhhhhcCCCceEEEeeccccccCCCC
Q 037249          372 SLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSNQFRGLLPT  420 (420)
Q Consensus       372 ~l~~l~~L~~L~l~~n~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~  420 (420)
                      .++.+++|++|++++|++++.+|..+.. +++|++|++++|++++.+|.
T Consensus       542 ~~~~l~~L~~L~Ls~N~l~~~~p~~l~~-l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        542 SFSEMPVLSQLDLSQNQLSGEIPKNLGN-VESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             hHhCcccCCEEECCCCcccccCChhHhc-CcccCEEeccCCcceeeCCC
Confidence            8999999999999999999888988886 89999999999999998884

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-16
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 8e-08
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-16
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-08
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-07
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 6e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 6e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 126/481 (26%), Positives = 188/481 (39%), Gaps = 79/481 (16%)
Query: 1   MLVGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFI-GSIRNLRYLNLSDTQFVGMIPP-- 57
             VG + P  L L  L YL L+ N F G +IP F+ G+   L  L+LS   F G +PP  
Sbjct: 258 QFVGPIPP--LPLKSLQYLSLAENKFTG-EIPDFLSGACDTLTGLDLSGNHFYGAVPPFF 314
Query: 58  --PXXXXXXXXXXXXXXXXXYVENFLWLSGLSFLE----------------------QLD 93
                                ++  L + GL  L+                       LD
Sbjct: 315 GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD 374
Query: 94  LCYVNLSKASDWLLVANTLPSLVELRLSNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSL 153
           L   N S      L  N   +L EL L N       P T+SN S L  L LSF+      
Sbjct: 375 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS--- 431
Query: 154 IPGWGPIPSWLYRLTHFEQLSV--ADRPRRIPRSMASLCNLRTIYL-------------S 198
               G IPS L  L+    L +        IP+ +  +  L T+ L             S
Sbjct: 432 ----GTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLS 487
Query: 199 GCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHL 258
            C +  L  + L ++ ++G + + IG  +NL  L L NNS  G +P  L +   L  L L
Sbjct: 488 NCTN--LNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDL 545
Query: 259 PDNKLNGTLFEIHFVNLTKLSVSSVN-------ENNLTLKVNHDW--VPPFQLVQLGLRS 309
             N  NGT+    F    K++ + +        +N+   K  H    +  FQ    G+RS
Sbjct: 546 NTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQ----GIRS 601
Query: 310 FYLDLFNNSFSGSISHFCYQ-----------NLMLLTLSNNKFTGNLPNSLGSLTSLVSL 358
             L+  +     +I+   Y            ++M L +S N  +G +P  +GS+  L  L
Sbjct: 602 EQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFIL 661
Query: 359 HLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSNQFRGLL 418
           +L  N  SG+IP  + +   L ILD+  N+  G I        + +  + L +N   G +
Sbjct: 662 NLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAM-SALTMLTEIDLSNNNLSGPI 720
Query: 419 P 419
           P
Sbjct: 721 P 721
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-57
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-54
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-50
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-42
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-45
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-37
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-36
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-34
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-24
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-36
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-35
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-32
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-21
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-20
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-09
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-22
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-12
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  205 bits (525), Expect = 2e-59
 Identities = 109/430 (25%), Positives = 168/430 (39%), Gaps = 71/430 (16%)

Query: 2   LVGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPP--L 59
               V+ SLL L  L  L LS +   G  +  F     +L  L+LS     G +     L
Sbjct: 65  GFSAVSSSLLSLTGLESLFLSNSHING-SVSGF-KCSASLTSLDLSRNSLSGPVTTLTSL 122

Query: 60  GNLSNLQSLDLSLNYL-YVENFLWLSGLSFLEQLDLCYVNLSKA-SDWLLVANTLPSLVE 117
           G+ S L+ L++S N L +         L+ LE LDL   ++S A     ++++    L  
Sbjct: 123 GSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKH 182

Query: 118 LRLSNCQLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQLSVAD 177
           L +S  ++     + +S   +L  LD+S + F          IP                
Sbjct: 183 LAISGNKISG--DVDVSRCVNLEFLDVSSNNFS-------TGIP---------------- 217

Query: 178 RPRRIPRSMASLCNLRTIYLSGCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNN 237
                   +     L+ + +SG               +SG  +  I     L  L++ +N
Sbjct: 218 -------FLGDCSALQHLDISGN-------------KLSGDFSRAISTCTELKLLNISSN 257

Query: 238 SIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWV 297
             VG +P     L  L+ L L +NK  G + +        L+   ++ N+         V
Sbjct: 258 QFVGPIPPLP--LKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFY-----GAV 310

Query: 298 PP--FQLVQLGLRSFYLDLFNNSFSGSI--SHFCY-QNLMLLTLSNNKFTGNLPNSLGSL 352
           PP       L      L L +N+FSG +        + L +L LS N+F+G LP SL +L
Sbjct: 311 PPFFGSCSLLE----SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNL 366

Query: 353 T-SLVSLHLHKNIFSGTIPISLKNC--TALMILDVGENEFVGNISTWFGERFSRVVVLIL 409
           + SL++L L  N FSG I  +L       L  L +  N F G I        S +V L L
Sbjct: 367 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHL 425

Query: 410 RSNQFRGLLP 419
             N   G +P
Sbjct: 426 SFNYLSGTIP 435
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query420
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.67
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.5
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.49
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.48
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.48
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.45
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.41
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.2
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.2
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.1
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.06
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.92
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.9
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.88
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.77
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.59
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.46
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.39
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.81
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.78
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.77
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.62
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.6e-46  Score=376.07  Aligned_cols=404  Identities=27%  Similarity=0.384  Sum_probs=295.9

Q ss_pred             CCCCCCCccCCCCCCcEEecccCCCCCCCchhhhhccccCceeecCCCcccCCCCCCCCCCCCccEEEeecccccccccc
Q 037249            2 LVGKVNPSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLGNLSNLQSLDLSLNYLYVENFL   81 (420)
Q Consensus         2 ~~~~l~~~~~~~~~L~~L~l~~~~i~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~   81 (420)
                      +.|.+|. +.++++|++|++++|.+.+. .+..+..+++|++|++++|.+.+.+|..  .+++|++|++++|.+....+.
T Consensus       212 l~~~~~~-l~~l~~L~~L~Ls~n~l~~~-~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~  287 (768)
T 3rgz_A          212 FSTGIPF-LGDCSALQHLDISGNKLSGD-FSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPD  287 (768)
T ss_dssp             CCSCCCB-CTTCCSCCEEECCSSCCCSC-HHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCC
T ss_pred             CCCCCcc-cccCCCCCEEECcCCcCCCc-ccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCH
Confidence            3455565 88888888888888887755 6777778888888888887776555543  566666666666665544443


Q ss_pred             cccC-CCcccEEEcccccCCCccchhhhhCCCCCCcEEEccCCCCC-CCCchhhccCCCCCEEEccCCcCCCCCCCCCCC
Q 037249           82 WLSG-LSFLEQLDLCYVNLSKASDWLLVANTLPSLVELRLSNCQLH-HLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGP  159 (420)
Q Consensus        82 ~~~~-l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~-~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~  159 (420)
                      .+.. +++|++|++++|.+....  ...+..+++|++|++++|.+. .++...+..+++|++|++++|.+..       .
T Consensus       288 ~~~~~~~~L~~L~Ls~n~l~~~~--p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~-------~  358 (768)
T 3rgz_A          288 FLSGACDTLTGLDLSGNHFYGAV--PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG-------E  358 (768)
T ss_dssp             CSCTTCTTCSEEECCSSEEEECC--CGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEE-------C
T ss_pred             HHHhhcCcCCEEECcCCcCCCcc--chHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCc-------c
Confidence            3433 366666666666654321  124455666666666666665 3333335666666666666665531       1


Q ss_pred             CChhhhh---------------------------ccccccccccCCC--CccccccccccCCcEEeeccCcc--------
Q 037249          160 IPSWLYR---------------------------LTHFEQLSVADRP--RRIPRSMASLCNLRTIYLSGCVS--------  202 (420)
Q Consensus       160 ~~~~l~~---------------------------~~~L~~L~l~~~~--~~~~~~~~~~~~L~~L~l~~~~~--------  202 (420)
                      ++..+..                           +++|+.|+++++.  ..+|.++..+++|+.|++++|.+        
T Consensus       359 ~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l  438 (768)
T 3rgz_A          359 LPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSL  438 (768)
T ss_dssp             CCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGG
T ss_pred             ccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHH
Confidence            2333333                           4456666666665  35667777888888888888754        


Q ss_pred             ---cceeEEEeecCcccccchhhhhcCCCCCEEECCCcccccCCccchhhccCCcEeecCCccccCccchhhhcccCccc
Q 037249          203 ---KELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLS  279 (420)
Q Consensus       203 ---~~l~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~L~  279 (420)
                         +.++.|++++|.+.+..|..+..+++|+.|++++|++.+..|..+..+++|++|++++|.+++.+|. .+..+++|+
T Consensus       439 ~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~-~~~~l~~L~  517 (768)
T 3rgz_A          439 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPK-WIGRLENLA  517 (768)
T ss_dssp             GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCG-GGGGCTTCC
T ss_pred             hcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCCh-HHhcCCCCC
Confidence               5678888888888888888888888888888888888877788888888888899888888877776 677888888


Q ss_pred             eEeecCCccceecCCCCCCccceeeecccceeec----------------------------------------------
Q 037249          280 VSSVNENNLTLKVNHDWVPPFQLVQLGLRSFYLD----------------------------------------------  313 (420)
Q Consensus       280 ~l~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~----------------------------------------------  313 (420)
                      +|++++|.+....+..+.....++.+.+..+.+.                                              
T Consensus       518 ~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  597 (768)
T 3rgz_A          518 ILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQ  597 (768)
T ss_dssp             EEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECT
T ss_pred             EEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccc
Confidence            8888888888777777777777775555444221                                              


Q ss_pred             -----------------cccCccccccccc--ccCCccEEEccCCccccCCcccccccccccEEeccCCccccccCcccc
Q 037249          314 -----------------LFNNSFSGSISHF--CYQNLMLLTLSNNKFTGNLPNSLGSLTSLVSLHLHKNIFSGTIPISLK  374 (420)
Q Consensus       314 -----------------l~~~~~~~~~~~~--~~~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~l~  374 (420)
                                       ++.+.+.+..+..  .+++|++|++++|++++.+|..++.+++|+.|++++|.+++.+|..++
T Consensus       598 ~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~  677 (768)
T 3rgz_A          598 GIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVG  677 (768)
T ss_dssp             TCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGG
T ss_pred             cccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHh
Confidence                             0011111222211  346899999999999999999999999999999999999999999999


Q ss_pred             ccCCCceEeCCCcccccccchhhhhcCCCceEEEeeccccccCCCC
Q 037249          375 NCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSNQFRGLLPT  420 (420)
Q Consensus       375 ~l~~L~~L~l~~n~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~  420 (420)
                      .+++|++||+++|++++.+|..+.. +++|++|++++|+++|.||.
T Consensus       678 ~L~~L~~LdLs~N~l~g~ip~~l~~-l~~L~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          678 DLRGLNILDLSSNKLDGRIPQAMSA-LTMLTEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             GCTTCCEEECCSSCCEECCCGGGGG-CCCCSEEECCSSEEEEECCS
T ss_pred             CCCCCCEEECCCCcccCcCChHHhC-CCCCCEEECcCCcccccCCC
Confidence            9999999999999999999999997 99999999999999999994
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 420
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 81.2 bits (199), Expect = 2e-17
 Identities = 80/384 (20%), Positives = 134/384 (34%), Gaps = 42/384 (10%)

Query: 8   PSLLDLNHLSYLGLSFNDFQGVQIPRFIGSIRNLRYLNLSDTQFVGMIPPPLGNLSNLQS 67
            S  DL+ ++ L       + +     +  + NL  +N S+ Q   +   PL NL+ L  
Sbjct: 38  VSQTDLDQVTTLQADRLGIKSID---GVEYLNNLTQINFSNNQLTDI--TPLKNLTKLVD 92

Query: 68  LDLSLNYLYVENFLWLSGLSFLEQLDLCYVNLSKASDWLLVANTLP----SLVELRLSNC 123
           + ++ N +     L          L    +        L   N L     ++ ++   + 
Sbjct: 93  ILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSG 152

Query: 124 QLHHLPPLTISNFSSLTVLDLSFSQFDNSLIPGWGPIPSWLYRLTHFEQLSVADRPRRIP 183
                     +  + L  L    +     +        S L +LT+ E L   +      
Sbjct: 153 LTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDI 212

Query: 184 RSMASLCNLRTIYLSGCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLV 243
             +  L NL  + L+G   K++                 +    NL  LDL NN I  L 
Sbjct: 213 TPLGILTNLDELSLNGNQLKDI---------------GTLASLTNLTDLDLANNQISNLA 257

Query: 244 PLSLNELSKLRILHLPDNKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWVPPFQLV 303
           PLS   L+KL  L L  N+++          LT L+   +NEN L        +      
Sbjct: 258 PLS--GLTKLTELKLGANQISNI---SPLAGLTALTNLELNENQLEDISPISNLKNLT-- 310

Query: 304 QLGLRSFYLDLFNNSFSGSISHFCYQNLMLLTLSNNKFTGNLPNSLGSLTSLVSLHLHKN 363
                  YL L+ N+ S          L  L  +NNK +    +SL +LT++  L    N
Sbjct: 311 -------YLTLYFNNISDISPVSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHN 361

Query: 364 IFSGTIPISLKNCTALMILDVGEN 387
             S   P++  N T +  L + + 
Sbjct: 362 QISDLTPLA--NLTRITQLGLNDQ 383
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query420
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.72
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.59
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.16
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.04
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.22
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.96
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.76
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.52
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.96  E-value=1.7e-27  Score=219.51  Aligned_cols=196  Identities=26%  Similarity=0.309  Sum_probs=143.2

Q ss_pred             ccccccccccCCcEEeeccCcccceeEEEeecCcccccchhhhhcCCCCCEEECCCcccccCCccchhhccCCcEeecCC
Q 037249          181 RIPRSMASLCNLRTIYLSGCVSKELEILVLQSSSISGHLTEQIGHFKNLDTLDLGNNSIVGLVPLSLNELSKLRILHLPD  260 (420)
Q Consensus       181 ~~~~~~~~~~~L~~L~l~~~~~~~l~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~  260 (420)
                      ........+++++.++++++.             +++..+  ...+++|+++++++|.+.+.  ..+..+++|+.+++++
T Consensus       188 ~~~~~~~~l~~~~~l~l~~n~-------------i~~~~~--~~~~~~L~~L~l~~n~l~~~--~~l~~l~~L~~L~l~~  250 (384)
T d2omza2         188 SDISVLAKLTNLESLIATNNQ-------------ISDITP--LGILTNLDELSLNGNQLKDI--GTLASLTNLTDLDLAN  250 (384)
T ss_dssp             CCCGGGGGCTTCSEEECCSSC-------------CCCCGG--GGGCTTCCEEECCSSCCCCC--GGGGGCTTCSEEECCS
T ss_pred             ccccccccccccceeeccCCc-------------cCCCCc--ccccCCCCEEECCCCCCCCc--chhhcccccchhcccc
Confidence            334445556666666665544             333322  34567888888888888764  3567788888888888


Q ss_pred             ccccCccchhhhcccCccceEeecCCccceecCCCCCCccceeeecccceeeccccCcccccccccccCCccEEEccCCc
Q 037249          261 NKLNGTLFEIHFVNLTKLSVSSVNENNLTLKVNHDWVPPFQLVQLGLRSFYLDLFNNSFSGSISHFCYQNLMLLTLSNNK  340 (420)
Q Consensus       261 ~~l~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~l~~~~~~~~~~~~~~~~L~~L~l~~~~  340 (420)
                      |.+++..   .+..+++|+.++++++.+....+  +......+       .++...|.+.+......+++++.|++++|+
T Consensus       251 n~l~~~~---~~~~~~~L~~L~l~~~~l~~~~~--~~~~~~l~-------~l~~~~n~l~~~~~~~~~~~l~~L~ls~n~  318 (384)
T d2omza2         251 NQISNLA---PLSGLTKLTELKLGANQISNISP--LAGLTALT-------NLELNENQLEDISPISNLKNLTYLTLYFNN  318 (384)
T ss_dssp             SCCCCCG---GGTTCTTCSEEECCSSCCCCCGG--GTTCTTCS-------EEECCSSCCSCCGGGGGCTTCSEEECCSSC
T ss_pred             CccCCCC---cccccccCCEeeccCcccCCCCc--cccccccc-------cccccccccccccccchhcccCeEECCCCC
Confidence            8877433   36778888888888887764432  22222222       566667777766555577899999999999


Q ss_pred             cccCCcccccccccccEEeccCCccccccCccccccCCCceEeCCCcccccccchhhhhcCCCceEEEeecc
Q 037249          341 FTGNLPNSLGSLTSLVSLHLHKNIFSGTIPISLKNCTALMILDVGENEFVGNISTWFGERFSRVVVLILRSN  412 (420)
Q Consensus       341 l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~~~~~L~~L~l~~~  412 (420)
                      +++. + .+..+++|++|++++|+++ .++ .++.+++|++|++++|++++..|  +.. +++|+.|++++|
T Consensus       319 l~~l-~-~l~~l~~L~~L~L~~n~l~-~l~-~l~~l~~L~~L~l~~N~l~~l~~--l~~-l~~L~~L~L~~N  383 (384)
T d2omza2         319 ISDI-S-PVSSLTKLQRLFFANNKVS-DVS-SLANLTNINWLSAGHNQISDLTP--LAN-LTRITQLGLNDQ  383 (384)
T ss_dssp             CSCC-G-GGGGCTTCCEEECCSSCCC-CCG-GGGGCTTCCEEECCSSCCCBCGG--GTT-CTTCSEEECCCE
T ss_pred             CCCC-c-ccccCCCCCEEECCCCCCC-CCh-hHcCCCCCCEEECCCCcCCCChh--hcc-CCCCCEeeCCCC
Confidence            9854 3 4889999999999999998 444 68999999999999999987655  554 999999999987
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure