Citrus Sinensis ID: 037314

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560------
MSKVKEVCLNPNTFTKMHRLRFFKFYNIFAGVNKYKVRHSRYLESLFNELRYFYWDGYPLKSLPSKNIPEHLVSLEMPHSNIEQLWNGVQNLAALKRLNLSYSKQLSRIPDISLAFNIERLDLVGCASLIETHSSIQHLNKLVFLNLGHCISLKSLPTGINLDSLKVLYLGGCSNLKRFPEISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLSGCLKLEKLPEEIGNLESLEVMLANETAISQVPPSIACLNRVESLSFDRCKGRPPLMSLKLPILFQLQNLEYLSLVDCGITELPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLTLRNCKRLQSLPELPCGSTIFARHCTSLETLSSLSTLFTRSSELWQAFDFCNCFKLNRNEVGEIVEGALKKIQIMATWWKQQDPITLYGDVPNSPWGCVCYPGSEIPEWFSFQSMGSSVTLELPPGWFNKNFVGFALCAIAPEYHGRTRGLYVQCKVKTKDGDRHVAICRLSVWEEDFAVNSSIESDHVFLGYDFYVSSGSFGGSNNEA
ccccEEEEEcHHHHHccccccEEEEccccccccccEEEcccccccccccccEEEEcccccccccccccccccEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEcccccccccccEEEEcccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccHHHHHcccccccccccccccccccccEEEEccccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccEEccccccccccccEEEcccccccccccccccccEEEcccccccEEcccccHHHccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEccccccccccccccccEEEEEcccccccccccEEEEEEEEEccccccccEEEEEEEEEccccEEEEEEEcccccccccccccccccEEEEEEEccccccccccccccc
cccccEccccHHHHHHccccEEEEEEccccccccccEEcccccccccHHcEEEEccccccccccccccHHHHEEEcccccHHHHcccccccccccEEEEccccccccccccccccccHHEEEcccccccccccccHHHHHHcEEEEcccccccccccccccHHHHHEEEcccccHHHccHHHHHHHHEEEcccccHHcccccHHcccccEEEEccccccHHccccHHcccccccEEEccccccHHcccHHcccHHHHHEEEccccccccccccHHHHHcccEEEcccccccccccccccccccccccccEEEccccccHccccHHcccccccEEEccccccccccHHHHHHHHccEEEcccccccccccccccccEEEccccccccccccccccccccccccEEEEccccHcccHccHHHHHHHHHHHHHHcccccccccHHHHcccccccccEEEEcccccccHHccccccccEEEEEccccccccccEEEEEEEEEEccccccccEEEEEEEEEcccccEEEccccccccccccccccccccEEEEEEEccccccccccccccc
mskvkevclnpntftkmhrlRFFKFYNifagvnkyKVRHSRYLESLFNELRYfywdgyplkslpsknipehlvslemphsnIEQLWNGVQNLAALKRLNLSYSkqlsripdislafNIERLDLVGCASLIETHSSIQHLNKLVFLNLghcislkslptginldslkvlylggcsnlkrfpeiscniehldlKETAIEelpssignlsrlvhldltncsrlkSVSSSLCNLKSLVNLYLSGclkleklpeeigNLESLEVMLANetaisqvppsiaclnrveslsfdrckgrpplmslklpilfqlqnleylslvdcgitelpeslgrspslnylnlaendfekiPSSIKQLSKLLFLTLRNckrlqslpelpcgstifarhctsletlSSLSTLFTRSSELWQafdfcncfklnrneVGEIVEGALKKIQIMATWWkqqdpitlygdvpnspwgcvcypgseipewfsfqsmgssvtlelppgwfnknfVGFALcaiapeyhgrtrglyvqckvktkdgdrhVAICRLSVWEedfavnssiesdhVFLGYDFyvssgsfggsnnea
mskvkevclnpntftkmhrlrFFKFYNIFAGVNKYKVRHSRYLESLFNELRYFYWDGYPLKSLPSKNIPEHLVSLEMPHSNIEQLWNGVQNLAALKRLNLSYSKQLSRIPDISLAFNIERLDLVGCASLIETHSSIQHLNKLVFLNLGHCISLKSLPTGINLDSLKVLYLGGCSNLKRFPEISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLSGCLKLEKLPEEIGNLESLEVMLANETaisqvppsiACLNRVESLSFDRCKGRPPLMSLKLPILFQLQNLEYLSLVDCGITELPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLTLRNCKRLQSLPELPCGSTIFARHCTSLETLSSLSTLFTRSSELWQAFDFCNCFKLNRNEVGEIVEGALKKIQIMATWWKQQDPITLYGDVPNSPWGCVCYPGSEIPEWFSFQSMGSSVTLELPPGWFNKNFVGFALCAIAPEYHGRTRGLYVQCKVKTKDGDRHVAICRLSVWEEDFAVNSSIESDHVFLGYDFYVssgsfggsnnea
MSKVKEVCLNPNTFTKMHRLRFFKFYNIFAGVNKYKVRHSRYLESLFNELRYFYWDGYPLKSLPSKNIPEHLVSLEMPHSNIEQLWNGVQNLAALKRLNLSYSKQLSRIPDISLAFNIERLDLVGCASLIETHSSIQHLNKLVFLNLGHCISLKSLPTGINLDSLKVLYLGGCSNLKRFPEISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLSGCLKLEKLPEEIGNLESLEVMLANETAISQVPPSIACLNRVESLSFDRCKGRPPLMSLKLPILFQLQNLEYLSLVDCGITELPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLTLRNCKRLQSLPELPCGSTIFARHCtsletlsslstlftrsselWQAFDFCNCFKLNRNEVGEIVEGALKKIQIMATWWKQQDPITLYGDVPNSPWGCVCYPGSEIPEWFSFQSMGSSVTLELPPGWFNKNFVGFALCAIAPEYHGRTRGLYVQCKVKTKDGDRHVAICRLSVWEEDFAVNSSIESDHVFLGYDFYVSSGSFGGSNNEA
******VCLNPNTFTKMHRLRFFKFYNIFAGVNKYKVRHSRYLESLFNELRYFYWDGYPLKSLPSKNIPEHLVSLEMPHSNIEQLWNGVQNLAALKRLNLSYSKQLSRIPDISLAFNIERLDLVGCASLIETHSSIQHLNKLVFLNLGHCISLKSLPTGINLDSLKVLYLGGCSNLKRFPEISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLSGCLKLEKLPEEIGNLESLEVMLANETAISQVPPSIACLNRVESLSFDRCKGRPPLMSLKLPILFQLQNLEYLSLVDCGITELPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLTLRNCKRLQSLPELPCGSTIFARHCTSLETLSSLSTLFTRSSELWQAFDFCNCFKLNRNEVGEIVEGALKKIQIMATWWKQQDPITLYGDVPNSPWGCVCYPGSEIPEWFSFQSMGSSVTLELPPGWFNKNFVGFALCAIAPEYHGRTRGLYVQCKVKTKDGDRHVAICRLSVWEEDFAVNSSIESDHVFLGYDFYV************
*SKVKEVCLNPNTFTKMHRLRFFKFYNIFAGVNKYKVRHSRYLESLFNELRYFYWDGYPLKSLPSKNIPEHLVSLEMPHSNIEQLWNGVQNLAALKRLNLSYSKQLSRIPDISLAFNIERLDLVGCASLIETHSSIQHLNKLVFLNLGHCISLKSLPTGINLDSLKVLYLGGCSNLKRFPEISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLSGCLKLEKLPEEIGNLESLEVMLANETAISQVPPSIACLNRVESLSFDRCKGRPPLMSLKLPILFQLQNLEYLSLVDCGITELPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLTLRNCKRLQSLPELPCGSTIFARHCTSLETLSSL*T***RSSELWQAFDFCNCFKLNRNEVGEIVEGALKKIQIMATWWKQQDPITLYGDVPNSPWGCVCYPGSEIPEWFSFQSMGSSVTLELPPGWFNKNFVGFALCAIAPEYHGRTRGLYVQCKVKTKDGDRHVAICRLSVWEEDFAVNSSIESDHVFLGYDFYVSSG*********
MSKVKEVCLNPNTFTKMHRLRFFKFYNIFAGVNKYKVRHSRYLESLFNELRYFYWDGYPLKSLPSKNIPEHLVSLEMPHSNIEQLWNGVQNLAALKRLNLSYSKQLSRIPDISLAFNIERLDLVGCASLIETHSSIQHLNKLVFLNLGHCISLKSLPTGINLDSLKVLYLGGCSNLKRFPEISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLSGCLKLEKLPEEIGNLESLEVMLANETAISQVPPSIACLNRVESLSFDRCKGRPPLMSLKLPILFQLQNLEYLSLVDCGITELPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLTLRNCKRLQSLPELPCGSTIFARHCTSLETLSSLSTLFTRSSELWQAFDFCNCFKLNRNEVGEIVEGALKKIQIMATWWKQQDPITLYGDVPNSPWGCVCYPGSEIPEWFSFQSMGSSVTLELPPGWFNKNFVGFALCAIAPEYHGRTRGLYVQCKVKTKDGDRHVAICRLSVWEEDFAVNSSIESDHVFLGYDFYVSSGSFGGSNNEA
**KVKEVCLNPNTFTKMHRLRFFKFYNIFAGVNKYKVRHSRYLESLFNELRYFYWDGYPLKSLPSKNIPEHLVSLEMPHSNIEQLWNGVQNLAALKRLNLSYSKQLSRIPDISLAFNIERLDLVGCASLIETHSSIQHLNKLVFLNLGHCISLKSLPTGINLDSLKVLYLGGCSNLKRFPEISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLSGCLKLEKLPEEIGNLESLEVMLANETAISQVPPSIACLNRVESLSFDRCKGRPPLMSLKLPILFQLQNLEYLSLVDCGITELPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLTLRNCKRLQSLPELPCGSTIFARHCTSLETLSSLSTLFTRSSELWQAFDFCNCFKLNRNEVGEIVEGALKKIQIMATWWKQQDPITLYGDVPNSPWGCVCYPGSEIPEWFSFQSMGSSVTLELPPGWFNKNFVGFALCAIAPEYHGRTRGLYVQCKVKTKDGDRHVAICRLSVWEEDFAVNSSIESDHVFLGYDFYVSS**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKVKEVCLNPNTFTKMHRLRFFKFYNIFAGVNKYKVRHSRYLESLFNELRYFYWDGYPLKSLPSKNIPEHLVSLEMPHSNIEQLWNGVQNLAALKRLNLSYSKQLSRIPDISLAFNIERLDLVGCASLIETHSSIQHLNKLVFLNLGHCISLKSLPTGINLDSLKVLYLGGCSNLKRFPEISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLSGCLKLEKLPEEIGNLESLEVMLANETAISQVPPSIACLNRVESLSFDRCKGRPPLMSLKLPILFQLQNLEYLSLVDCGITELPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLTLRNCKRLQSLPELPCGSTIFARHCTSLETLSSLSTLFTRSSELWQAFDFCNCFKLNRNEVGEIVEGALKKIQIMATWWKQQDPITLYGDVPNSPWGCVCYPGSEIPEWFSFQSMGSSVTLELPPGWFNKNFVGFALCAIAPEYHGRTRGLYVQCKVKTKDGDRHVAICRLSVWEEDFAVNSSIESDHVFLGYDFYVSSGSFGGSNNEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query566 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.800 0.395 0.350 1e-58
Q9SZ67 1895 Probable WRKY transcripti no no 0.657 0.196 0.376 6e-50
O235301301 Protein SUPPRESSOR OF npr no no 0.574 0.249 0.356 1e-40
O825001095 Putative disease resistan no no 0.446 0.231 0.367 6e-35
Q9FH83 1288 Probable WRKY transcripti no no 0.860 0.378 0.267 7e-28
Q9FL92 1372 Probable WRKY transcripti no no 0.461 0.190 0.318 9e-28
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.720 0.252 0.259 1e-25
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.524 0.290 0.295 6e-18
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.556 0.170 0.311 3e-17
P0CB16 1201 Putative disease resistan no no 0.395 0.186 0.310 2e-15
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  228 bits (581), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 171/488 (35%), Positives = 262/488 (53%), Gaps = 35/488 (7%)

Query: 17   MHRLRFFKFYNIFAGVNKYKVRHSRYLESLFNELRYFYWDGYPLKSLPSKNIPEHLVSLE 76
            M RLR F   N+      Y + +      L N LR F    YP +S PS    + LV L+
Sbjct: 552  MKRLRVF---NMGRSSTHYAIDY------LPNNLRCFVCTNYPWESFPSTFELKMLVHLQ 602

Query: 77   MPHSNIEQLWNGVQNLAALKRLNLSYSKQLSRIPDISLAFNIERLDLVGCASLIETHSSI 136
            + H+++  LW   ++L +L+R++LS+SK+L+R PD +   N+E ++L  C++L E H S+
Sbjct: 603  LRHNSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHHSL 662

Query: 137  QHLNKLVFLNLGHCISLKSLPTGINLDSLKVLYLGGCSNLKRFPEISCNIE---HLDLKE 193
               +K++ L L  C SLK  P  +N++SL+ L L  C +L++ PEI   ++    + ++ 
Sbjct: 663  GCCSKVIGLYLNDCKSLKRFPC-VNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQG 721

Query: 194  TAIEELPSSIGNL-SRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLSGCLKLEKLPEEIG 252
            + I ELPSSI    + +  L L N   L ++ SS+C LKSLV+L +SGC KLE LPEEIG
Sbjct: 722  SGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIG 781

Query: 253  NLESLEVMLANETAISQVPPSIACLNRVESLSFDRCKGRPPLMSLKLPILFQ-LQNLEYL 311
            +L++L V  A++T I + P SI  LN++  L F   +G    +  + P + + L +LEYL
Sbjct: 782  DLDNLRVFDASDTLILRPPSSIIRLNKLIILMF---RGFKDGVHFEFPPVAEGLHSLEYL 838

Query: 312  SLVDCGITE--LPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLTLRNCKRLQSLP 369
            +L  C + +  LPE +G   SL  L+L+ N+FE +PSSI QL  L  L L++C+RL  LP
Sbjct: 839  NLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLP 898

Query: 370  ELPCGSTIFARHCTSLETLSSLSTLFTRSSELWQA-FDFCNCFKLNRNEVGEIVEGALKK 428
            ELP    +   H      L  +  L T+  +L +   D  +    N            + 
Sbjct: 899  ELP--PELNELHVDCHMALKFIHYLVTKRKKLHRVKLDDAH----NDTMYNLFAYTMFQN 952

Query: 429  IQIMATWWKQQDPITLYGDVPNSPWGCVCYPGSEIPEWFSFQSMGSSVTLELPPGWF-NK 487
            I  M       D ++L      + +    YP  +IP WF  Q   SSV++ LP  W+   
Sbjct: 953  ISSMRHDISASDSLSL------TVFTGQPYP-EKIPSWFHHQGWDSSVSVNLPENWYIPD 1005

Query: 488  NFVGFALC 495
             F+GFA+C
Sbjct: 1006 KFLGFAVC 1013
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query566
359493487 1162 PREDICTED: TMV resistance protein N-like 0.888 0.432 0.408 4e-94
359496026 1250 PREDICTED: TMV resistance protein N-like 0.908 0.411 0.412 4e-93
225460354 1174 PREDICTED: TMV resistance protein N-like 0.934 0.450 0.421 1e-92
359493483 1274 PREDICTED: TMV resistance protein N-like 0.883 0.392 0.401 2e-92
147768286 1206 hypothetical protein VITISV_033530 [Viti 0.950 0.446 0.402 4e-89
15234388 1219 TIR-NBS-LRR class disease resistance pro 0.962 0.447 0.375 1e-86
297794743 1184 predicted protein [Arabidopsis lyrata su 0.939 0.449 0.373 5e-85
227438275 1226 disease resistance protein [Brassica rap 0.961 0.443 0.386 9e-85
297813715 1212 hypothetical protein ARALYDRAFT_327329 [ 0.969 0.452 0.367 1e-83
359493273 1233 PREDICTED: TMV resistance protein N-like 0.865 0.397 0.391 2e-80
>gi|359493487|ref|XP_003634612.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  351 bits (901), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 225/551 (40%), Positives = 307/551 (55%), Gaps = 48/551 (8%)

Query: 1    MSKVKEVCLNPNTFTKMHRLRFFKFYNI-----FAGVNKYKV---RHSRYLES------- 45
            +S+ KE+  + + FTKM RLR  K  N+        ++K ++    H  + E        
Sbjct: 543  LSESKELNFSIDAFTKMKRLRLLKICNVQIDRSLGYLSKKELIAYTHDVWTERNYLYTQN 602

Query: 46   ----------LFNELRYFYWDGYPLKSLPSKNIPEHLVSLEMPHSNIEQLWNGVQNLAAL 95
                      L N LR  YW GYPLKS PS   PE LV L M  S ++QLW G +    L
Sbjct: 603  KLHLYEDSKFLSNNLRDLYWHGYPLKSFPSNFHPEKLVELNMCFSRLKQLWEGKKGFEKL 662

Query: 96   KRLNLSYSKQLSRIPDISLAFNIERLDLVGCASLIETHSSIQHLNKLVFLNLGHCISLKS 155
            K + LS+S+ L++ PD S   N+ RL L GC SL+E H SI  L KL+FLNL  C  LKS
Sbjct: 663  KSIKLSHSQHLTKTPDFSGVPNLRRLILKGCTSLVEVHPSIGALKKLIFLNLEGCKKLKS 722

Query: 156  LPTGINLDSLKVLYLGGCSNLKRFPEISCNIEH---LDLKETAIEELPSSIGNLSRLVHL 212
              + I+++SL++L L GCS LK+FPE+  N+EH   L L+ TAI+ LP SI NL+ L  L
Sbjct: 723  FSSSIHMESLQILTLSGCSKLKKFPEVQGNMEHLPNLSLEGTAIKGLPLSIENLTGLALL 782

Query: 213  DLTNCSRLKSVSSSLCNLKSLVNLYLSGCLKLEKLPEEIGNLESLEVMLANETAISQVPP 272
            +L  C  L+S+  S+  LKSL  L L GC +L++LP+++G+L+ L  + A+ + I +VPP
Sbjct: 783  NLKECKSLESLPRSIFKLKSLKTLTLCGCSELKELPDDLGSLQCLAELNADGSGIQEVPP 842

Query: 273  SIACLNRVESLSFDRCKG-------------RPPLMSLKLPILFQLQNLEYLSLVDCGIT 319
            SI  L  ++ LS   CKG               P   L+LP    L +L  L L  C ++
Sbjct: 843  SITLLTNLQKLSLAGCKGGDSKSRNMVFSFHSSPTEELRLPSFSGLYSLRVLILQRCNLS 902

Query: 320  E--LPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLTLRNCKRLQSLPELPCG-ST 376
            E  LP  LG  PSL  L+L+ N F  IP+S+  LS+L  LTL  CK LQSLPELP    +
Sbjct: 903  EGALPSDLGSIPSLERLDLSRNSFITIPASLSGLSRLRSLTLEYCKSLQSLPELPSSVES 962

Query: 377  IFARHCTSLETLSSLSTLFTRSSELWQAFDFCNCFKLNRNEVGEIVEGALKKIQIMATWW 436
            + A  CTSLET S  S  +T        F+F NCF+L  N+  +IV   L+ IQ+M++  
Sbjct: 963  LNAHSCTSLETFSCSSGAYTSKKFGDLRFNFTNCFRLGENQGSDIVGAILEGIQLMSSIP 1022

Query: 437  KQQDPITLYGDVPNSPWGCVCYPGSEIPEWFSFQSMGSSVTLELPPGWFNKNFVGFALCA 496
            K   P  +    P++ +  +  PGS IPEWF  QS+G SV +ELPP W+N   +G A CA
Sbjct: 1023 KFLVPWGI--PTPHNEYNALV-PGSRIPEWFRHQSVGCSVNIELPPHWYNTKLMGLAFCA 1079

Query: 497  IAPEYHGRTRG 507
             A  + G   G
Sbjct: 1080 -ALNFKGAMDG 1089

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225460354|ref|XP_002263146.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493483|ref|XP_003634610.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|147768286|emb|CAN64759.1| hypothetical protein VITISV_033530 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15234388|ref|NP_192938.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] gi|4586106|emb|CAB40942.1| putative disease resistance protein (TMV N-like) [Arabidopsis thaliana] gi|7267902|emb|CAB78244.1| putative disease resistance protein (TMV N-like) [Arabidopsis thaliana] gi|332657683|gb|AEE83083.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297794743|ref|XP_002865256.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297311091|gb|EFH41515.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|227438275|gb|ACP30627.1| disease resistance protein [Brassica rapa subsp. pekinensis] Back     alignment and taxonomy information
>gi|297813715|ref|XP_002874741.1| hypothetical protein ARALYDRAFT_327329 [Arabidopsis lyrata subsp. lyrata] gi|297320578|gb|EFH51000.1| hypothetical protein ARALYDRAFT_327329 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359493273|ref|XP_002272034.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query566
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.984 0.456 0.362 7.4e-85
TAIR|locus:21229651210 AT4G19510 [Arabidopsis thalian 0.952 0.445 0.374 9.9e-82
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.630 0.275 0.392 1.4e-63
UNIPROTKB|Q403921144 N "TMV resistance protein N" [ 0.575 0.284 0.400 8.5e-61
TAIR|locus:2153072 1229 AT5G51630 [Arabidopsis thalian 0.634 0.292 0.356 8.2e-54
TAIR|locus:21229851167 AT4G19530 [Arabidopsis thalian 0.545 0.264 0.349 2.7e-52
TAIR|locus:2118116 1895 WRKY19 [Arabidopsis thaliana ( 0.505 0.150 0.420 2.2e-51
TAIR|locus:2115870 1234 AT4G08450 [Arabidopsis thalian 0.628 0.288 0.339 4.3e-51
TAIR|locus:21604871085 AT5G41550 [Arabidopsis thalian 0.507 0.264 0.381 9.6e-51
TAIR|locus:21703331197 CSA1 "constitutive shade-avoid 0.551 0.260 0.390 1e-50
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 852 (305.0 bits), Expect = 7.4e-85, P = 7.4e-85
 Identities = 209/577 (36%), Positives = 310/577 (53%)

Query:     2 SKVKEVCLNPNTFTKMHRLRFFKFYNIFA--GVN-KYKVRHSRYLESLFNELRYFYWDGY 58
             SK++ + L+   F  M+ L++ K Y+     G   ++K+   R L  L NEL Y +W GY
Sbjct:   549 SKLRAMRLSAKAFQGMYNLKYLKIYDSHCSRGCEAEFKLHLRRGLSFLPNELTYLHWHGY 608

Query:    59 PLKSLPSKNIPEHLVSLEMPHSNIEQLWNGVQNLAALKRLNLSYSKQLSRIPDISLAFNI 118
             PL+S+P    P++LV L++PHS +E++W+  +++  LK ++LS+S  L +   ++ A N+
Sbjct:   609 PLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLKWVDLSHSINLRQCLGLANAHNL 668

Query:   119 ERLDLVGCASLIETHSSIQHLNKLVFLNLGHCISLKSLPTGINLDSLKVLYLGGCSNLKR 178
             ERL+L GC SL +  S+I  L KL++LNL  C SL+SLP GI   SL+ L L GCS+LK+
Sbjct:   669 ERLNLEGCTSLKKLPSTINCLEKLIYLNLRDCTSLRSLPKGIKTQSLQTLILSGCSSLKK 728

Query:   179 FPEISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYL 238
             FP IS N+E L L  T I+ LP SI    RL  L+L NC +LK +SS L  LK L  L L
Sbjct:   729 FPLISENVEVLLLDGTVIKSLPESIQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELIL 788

Query:   239 SGCLKLEKLPEEIGNLESLEVMLANETAISQVPPSIACLNRVESLSFDRCKGRPPLMSLK 298
             SGC +LE  PE   ++ESLE++L ++T+I+++P  +  L+ +++ S         +    
Sbjct:   789 SGCSQLEVFPEIKEDMESLEILLMDDTSITEMPKMMH-LSNIKTFSLCGTSSHVSVSMFF 847

Query:   299 LPILFQLQNLEYLSLVDCGITELPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLT 358
             +P       L  L L  C + +LP+++G   SL  L L+ N+ E +P S  QL+ L +  
Sbjct:   848 MPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFD 907

Query:   359 LRNCKRLQSLPELPCGSTIFARH-CXXXXXXXXXXXXXXXXXXXWQAFDFCNCFKLNRNE 417
             L+ CK L+SLP LP        H C                      F F NC+KLN++ 
Sbjct:   908 LKFCKMLKSLPVLPQNLQYLDAHECESLETLANPLTPLTVGERIHSMFIFSNCYKLNQDA 967

Query:   418 VGEIVEGALKKIQIMATWWKQQDPITLY-GDVPNSPWGCVCYPGSEIPEWFSFQSMGSSV 476
                +V  A  K Q+MA    ++     Y G VP    G +CYP +EIP WF  Q +G S+
Sbjct:   968 QASLVGHARIKSQLMANASAKR----YYRGFVPEPLVG-ICYPATEIPSWFCHQRLGRSL 1022

Query:   477 TLELPPGWFNKNFVGFALCAIAP--EYHGRTRGLYVQC--KVKTKDGDRHVAICRLSVWE 532
              + LPP W + NFVG AL  +    +Y    +   V+C    + KD         L+ W 
Sbjct:  1023 EIPLPPHWCDINFVGLALSVVVSFKDYEDSAKRFSVKCCGNFENKDSSFTRFDFTLAGWN 1082

Query:   533 EDFAVNS----SIESDHVFLGYDF-YVSSGSFGGSNN 564
             E     S     + SDHVF+GY+  ++     G SN+
Sbjct:  1083 EPCGSLSHESRKLTSDHVFMGYNSCFLVKNVHGESNS 1119
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
TAIR|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122985 AT4G19530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160487 AT5G41550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
AT4G12010
disease resistance protein (TIR-NBS-LRR class), putative; disease resistance protein (TIR-NBS-LRR class), putative; FUNCTIONS IN- protein binding, transmembrane receptor activity, ATP binding; INVOLVED IN- signal transduction, defense response, apoptosis, innate immune response; LOCATED IN- intrinsic to membrane; EXPRESSED IN- 22 plant structures; EXPRESSED DURING- 13 growth stages; CONTAINS InterPro DOMAIN/s- NB-ARC (InterPro-IPR002182), Leucine-rich repeat (InterPro-IPR001611), Toll-Interleukin receptor (InterPro-IPR000157), Leucine-rich repeat 3 (InterPro-IPR011713); BEST Arabidopsi [...] (1219 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
DAR5
DAR5 (DA1-RELATED PROTEIN 5); zinc ion binding; DA1-RELATED PROTEIN 5 (DAR5); FUNCTIONS IN- zin [...] (702 aa)
      • 0.827
AT5G45490
disease resistance protein-related; disease resistance protein-related; FUNCTIONS IN- ATP bindi [...] (354 aa)
      • 0.744
DAR3
DAR3 (DA1-RELATED PROTEIN 3); DA1-RELATED PROTEIN 3 (DAR3); FUNCTIONS IN- molecular_function un [...] (450 aa)
      • 0.718
DAR7
DAR7 (DA1-RELATED PROTEIN 7); zinc ion binding; DA1-RELATED PROTEIN 7 (DAR7); FUNCTIONS IN- zin [...] (560 aa)
      • 0.718
AT5G45510
leucine-rich repeat family protein; leucine-rich repeat family protein; FUNCTIONS IN- protein b [...] (1222 aa)
   •  ••0.456
RQL-5
ATP-dependent DNA helicase, putative; ATP-dependent DNA helicase, putative; FUNCTIONS IN- helic [...] (911 aa)
      • 0.435
AT1G27850
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (1148 aa)
      • 0.435
AT1G21610
wound-responsive family protein; wound-responsive family protein; FUNCTIONS IN- molecular_funct [...] (684 aa)
      • 0.435
AT5G66900
disease resistance protein (CC-NBS-LRR class), putative; disease resistance protein (CC-NBS-LRR [...] (809 aa)
   •  ••0.414
AT5G48610
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (354 aa)
      • 0.408

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-65
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-08
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  230 bits (589), Expect = 2e-65
 Identities = 169/522 (32%), Positives = 255/522 (48%), Gaps = 87/522 (16%)

Query: 1    MSKVKEVCLNPNTFTKMHRLRFFKFYNIFAGVNKYKVR-H-SRYLESLFNELRYFYWDGY 58
            + ++ E+ ++ N F  M  L F KFY       K +VR H     + L  +LR   WD Y
Sbjct: 541  IDEIDELHIHENAFKGMRNLLFLKFYTK-KWDQKKEVRWHLPEGFDYLPPKLRLLRWDKY 599

Query: 59   PLKSLPSKNIPEHLVSLEMPHSNIEQLWNGVQNLAALKRLNLSYSKQLSRIPDISLAFNI 118
            PL+ +PS   PE+LV L+M  S +E+LW+GV +L  L+ ++L  SK L  IPD+S+A N+
Sbjct: 600  PLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNL 659

Query: 119  ERLDLVGCASLIETHSSIQHLNKLVFLNLGHCISLKSLPTGINLDSLKVLYLGGCSNLKR 178
            E L L  C+SL+E  SSIQ+LNKL  L++  C +L+ LPTGINL SL  L L GCS LK 
Sbjct: 660  ETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKS 719

Query: 179  FPEISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYL 238
            FP+IS NI  LDL ETAIEE PS++    RL +LD             LC +KS      
Sbjct: 720  FPDISTNISWLDLDETAIEEFPSNL----RLENLDEL----------ILCEMKS------ 759

Query: 239  SGCLKLEKLPEEIGNLESLEVML---------ANETAISQVPPSIACLNRVESLSFDRCK 289
                  EKL E +  L  L  ML         ++  ++ ++P SI  L+++E L  + C 
Sbjct: 760  ------EKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCI 813

Query: 290  GRPPLMSLKLPILFQLQNLEYLSLVDCGITELPESLGRSPSLNYLNLAENDFEKIPSSIK 349
                     LP    L++LE L L  C  + L      S +++ LNL+    E++P  I+
Sbjct: 814  NL-----ETLPTGINLESLESLDLSGC--SRLRTFPDISTNISDLNLSRTGIEEVPWWIE 866

Query: 350  QLSKLLFLTLRNCKRLQ----SLPELPCGSTIFARHCTSLETLS--SLSTLFTRSSELWQ 403
            + S L FL +  C  LQ    ++ +L    T+    C +L   S     +    +++   
Sbjct: 867  KFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIH 926

Query: 404  AF-------DFCNCFKLNRNEVGEIVEGALKKIQIMATWWKQQDPITLYGDVPNSPWGCV 456
            +        +F NCF L+            + +    + +KQ   + L G+         
Sbjct: 927  SKLPSTVCINFINCFNLD-----------QEALLQQQSIFKQ---LILSGE--------- 963

Query: 457  CYPGSEIPEWFSFQSMGSSVT-LELPPGWFNKNFVGFALCAI 497
                 E+P +F+ ++ G+S+T + L      + F  F  CA+
Sbjct: 964  -----EVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAV 1000

syringae 6; Provisional. Length = 1153
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 566
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
PLN032101153 Resistant to P. syringae 6; Provisional 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.81
KOG4237498 consensus Extracellular matrix protein slit, conta 99.8
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.53
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.52
KOG0617264 consensus Ras suppressor protein (contains leucine 99.51
KOG0617264 consensus Ras suppressor protein (contains leucine 99.48
KOG4237498 consensus Extracellular matrix protein slit, conta 99.44
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.3
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.27
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.08
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.98
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.87
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.84
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.83
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.8
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.78
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.73
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.61
KOG4341483 consensus F-box protein containing LRR [General fu 98.59
PRK15386426 type III secretion protein GogB; Provisional 98.54
KOG4341483 consensus F-box protein containing LRR [General fu 98.53
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.49
PLN03150623 hypothetical protein; Provisional 98.49
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.38
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.37
PLN03150623 hypothetical protein; Provisional 98.36
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.35
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.29
PRK15386426 type III secretion protein GogB; Provisional 98.19
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.15
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.92
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.92
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.78
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.64
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.54
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.53
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.32
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.28
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.27
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.21
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.02
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.99
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.98
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.92
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.73
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.38
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.25
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.17
PF0772520 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le 95.63
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.37
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.14
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.37
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.16
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.12
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.97
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.19
KOG4308478 consensus LRR-containing protein [Function unknown 90.8
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.51
smart0037026 LRR Leucine-rich repeats, outliers. 89.51
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.34
KOG4308478 consensus LRR-containing protein [Function unknown 82.85
smart0037026 LRR Leucine-rich repeats, outliers. 82.29
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 82.29
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.88
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=2.1e-51  Score=477.71  Aligned_cols=473  Identities=33%  Similarity=0.531  Sum_probs=374.3

Q ss_pred             CCCcceeecCHHHHhcCcCCcEEEEeecC-CCCccceEEcCCCccCCCccceEEEeCCccCCCCCCCCCCCCeEEEEcCC
Q 037314            1 MSKVKEVCLNPNTFTKMHRLRFFKFYNIF-AGVNKYKVRHSRYLESLFNELRYFYWDGYPLKSLPSKNIPEHLVSLEMPH   79 (566)
Q Consensus         1 ~s~~~~~~~~~~~f~~m~~Lr~L~l~~~~-~~~~~~~~~l~~~l~~l~~~Lr~L~l~~~~l~~lp~~~~~~~L~~L~L~~   79 (566)
                      +++++++.++.+||++|++|++|++++.. ...+.....+|+++..+|++||+|+|.+|+++++|..|.+++|++|+|++
T Consensus       541 ~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~  620 (1153)
T PLN03210        541 IDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQG  620 (1153)
T ss_pred             cCccceeeecHHHHhcCccccEEEEecccccccccceeecCcchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcC
Confidence            45677889999999999999999998742 12245667899999999999999999999999999999999999999999


Q ss_pred             CCCccccccCCCCCCCcEEecCCCCCCCCCCCCCCCCCccEEEeeCCCCccccchhhhhcccCcEEecCCCCCCCccCCc
Q 037314           80 SNIEQLWNGVQNLAALKRLNLSYSKQLSRIPDISLAFNIERLDLVGCASLIETHSSIQHLNKLVFLNLGHCISLKSLPTG  159 (566)
Q Consensus        80 ~~i~~l~~~~~~l~~L~~L~Ls~~~~l~~~p~l~~l~~L~~L~L~~c~~~~~~~~~~~~l~~L~~L~L~~c~~l~~lp~~  159 (566)
                      |+++.+|.+++.+++|+.|+|+++..++.+|+++.+++|++|+|++|..+..+|.+++++++|+.|++++|+.++.+|..
T Consensus       621 s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~  700 (1153)
T PLN03210        621 SKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTG  700 (1153)
T ss_pred             ccccccccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCc
Confidence            99999999999999999999999988999999999999999999999999999999999999999999999999999998


Q ss_pred             CCCCCccEEEecCCCCCCcCCcccCCCCEEecCCCCCcccCccccCCCCCcEEeccCCCCccc-------ccccccCCCC
Q 037314          160 INLDSLKVLYLGGCSNLKRFPEISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKS-------VSSSLCNLKS  232 (566)
Q Consensus       160 ~~l~~L~~L~L~~~~~l~~~~~~~~~L~~L~L~~~~i~~lp~~~~~l~~L~~L~L~~~~~l~~-------lp~~l~~l~~  232 (566)
                      +++++|+.|++++|..++.+|....+|+.|++++|.++.+|..+ .+++|++|.+.++.....       .+......++
T Consensus       701 i~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~-~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~s  779 (1153)
T PLN03210        701 INLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNL-RLENLDELILCEMKSEKLWERVQPLTPLMTMLSPS  779 (1153)
T ss_pred             CCCCCCCEEeCCCCCCccccccccCCcCeeecCCCccccccccc-cccccccccccccchhhccccccccchhhhhcccc
Confidence            89999999999999999999999899999999999999999876 688999999987543211       1112233568


Q ss_pred             CcEEeccCCcCCcccccccCCCCccceeccCCc-cccccCcccccCCCCCEEEccCCCCCCCCCCCCcccccCCCCCcEE
Q 037314          233 LVNLYLSGCLKLEKLPEEIGNLESLEVMLANET-AISQVPPSIACLNRVESLSFDRCKGRPPLMSLKLPILFQLQNLEYL  311 (566)
Q Consensus       233 L~~L~ls~~~~l~~~p~~l~~l~~L~~L~l~~n-~l~~l~~~l~~l~~L~~L~l~~~~~~~~~~~~~l~~~~~l~~L~~L  311 (566)
                      |+.|++++|.....+|..++++++|+.|++++| .+..+|..+ .+++|+.|++++|.....     +|.  ..++|+.|
T Consensus       780 L~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~-----~p~--~~~nL~~L  851 (1153)
T PLN03210        780 LTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRT-----FPD--ISTNISDL  851 (1153)
T ss_pred             chheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCCCcccc-----ccc--cccccCEe
Confidence            889999998888888888888888888888775 466777655 677888888888765443     221  12567777


Q ss_pred             ecccCCCcccCCCCCCCCCCCEEeccCCC-CeecCcchhcCCCCcEecccccccCCcCC--CCCCCCeEeecCCcCcccc
Q 037314          312 SLVDCGITELPESLGRSPSLNYLNLAEND-FEKIPSSIKQLSKLLFLTLRNCKRLQSLP--ELPCGSTIFARHCTSLETL  388 (566)
Q Consensus       312 ~L~~~~l~~lp~~l~~l~~L~~L~Ls~n~-l~~lp~~i~~l~~L~~L~L~~c~~L~~lp--~lp~~~~L~~~~c~~L~~l  388 (566)
                      +|++|.+.++|..+..+++|+.|+|++|+ ++.+|..+..+++|+.|++++|..|+.++  ..|.. ...+.+.. .   
T Consensus       852 ~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~-~~~~~~n~-~---  926 (1153)
T PLN03210        852 NLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSE-VAMATDNI-H---  926 (1153)
T ss_pred             ECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchh-hhhhcccc-c---
Confidence            77777777777777777777777777755 66777667777777777777777666543  11111 00000000 0   


Q ss_pred             cCcchhcccccccceeeEeeCCCCCChhhhhhhHHHHHHHHHHHhhhcccCCCccccCCCCCCCCceeecCCCCCCCccc
Q 037314          389 SSLSTLFTRSSELWQAFDFCNCFKLNRNEVGEIVEGALKKIQIMATWWKQQDPITLYGDVPNSPWGCVCYPGSEIPEWFS  468 (566)
Q Consensus       389 ~~~~~~~~~~~~~l~~l~~~~C~~L~~~~~~~i~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~iP~wf~  468 (566)
                              ...+....+.|.+|++|++.+.  +           +.      +         ..+..+++||.++|+||.
T Consensus       927 --------~~~p~~~~l~f~nC~~L~~~a~--l-----------~~------~---------~~~~~~~l~g~evp~~f~  970 (1153)
T PLN03210        927 --------SKLPSTVCINFINCFNLDQEAL--L-----------QQ------Q---------SIFKQLILSGEEVPSYFT  970 (1153)
T ss_pred             --------ccCCchhccccccccCCCchhh--h-----------cc------c---------ccceEEECCCccCchhcc
Confidence                    1112234467899999987553  1           00      0         012468999999999999


Q ss_pred             cCCCCceEE-EECCCCCCCCccceEEEEEEEeccCCC----ccceEEEEEEEeCCCCeEE
Q 037314          469 FQSMGSSVT-LELPPGWFNKNFVGFALCAIAPEYHGR----TRGLYVQCKVKTKDGDRHV  523 (566)
Q Consensus       469 ~~~~g~~~~-i~lp~~~~~~~~~g~~~c~v~~~~~~~----~~~~~~~c~~~~~~~~~~~  523 (566)
                      ||+.|++++ |.+|+.|+...|.||++|+|+++....    ...+.|.|+|++++|+.++
T Consensus       971 hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~ 1030 (1153)
T PLN03210        971 HRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIISVSFDIQVCCRFIDRLGNHFD 1030 (1153)
T ss_pred             CCcccceeeeeccCCcccCCCccceEEEEEEecCccccCCCceeEEEEEEEECCCCCccc
Confidence            999999998 999999998889999999999876522    2246777888888887654

syringae 6; Provisional
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 5e-08
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 3e-06
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 8e-06
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 2e-05
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 95/210 (45%), Gaps = 20/210 (9%)
Query: 176 LKRFPEISCNIEHLD---LKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKS 232
           L +FP+ +  + HL    +    + ELP +    + L  L L   + L+++ +S+ +L  
Sbjct: 93  LPQFPDQAFRLSHLQHXTIDAAGLXELPDTXQQFAGLETLTLAR-NPLRALPASIASLNR 151
Query: 233 LVNLYLSGCLKLEKLPEEIGNLES---------LEVMLANETAISQVPPSIACLNRVESL 283
           L  L +  C +L +LPE + + ++         L+ +    T I  +P SIA L  ++SL
Sbjct: 152 LRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSL 211
Query: 284 SFDRCKGRPPLMSLKLPILFQLQNLEYLSLVDC-GITELPESLGRSPSLNYLNLAE-NDF 341
                    PL +L  P +  L  LE L L  C  +   P   G    L  L L + ++ 
Sbjct: 212 KIRNS----PLSALG-PAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNL 266
Query: 342 EKIPSSIKQLSKLLFLTLRNCKRLQSLPEL 371
             +P  I +L++L  L LR C  L  LP L
Sbjct: 267 LTLPLDIHRLTQLEKLDLRGCVNLSRLPSL 296
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-52
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-50
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-44
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-41
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-31
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-28
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-23
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-10
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  180 bits (459), Expect = 3e-52
 Identities = 66/319 (20%), Positives = 118/319 (36%), Gaps = 39/319 (12%)

Query: 89  VQNLAALKRLNLSYSKQLSRIPDISLAFNIERLDL--VGCASLIETHSSIQHLNKLVFLN 146
             + +  + L    S  L    D      + +         +   +     + N    + 
Sbjct: 8   HHHSSGRENLYFQGSTALRPYHD-----VLSQWQRHYNADRNRWHSAWRQANSNNP-QIE 61

Query: 147 LGHCISLKSLPTGI---NLDSLKVLYLGGCSNLKRFPEISCNI---EHLDLKETAIEELP 200
                +LK+    +          L L     L +FP+ +  +   +H+ +    + ELP
Sbjct: 62  TRTGRALKATADLLEDATQPGRVALELRSVP-LPQFPDQAFRLSHLQHMTIDAAGLMELP 120

Query: 201 SSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLSGCLKLEKLPEEIGN------- 253
            ++   + L  L L     L+++ +S+ +L  L  L +  C +L +LPE + +       
Sbjct: 121 DTMQQFAGLETLTLARNP-LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEH 179

Query: 254 --LESLEVMLANETAISQVPPSIACLNRVESLSFDRCKGRPPLMSLKLPILFQLQNLEYL 311
             L +L+ +    T I  +P SIA L  ++SL          L +L  P +  L  LE L
Sbjct: 180 QGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSP----LSAL-GPAIHHLPKLEEL 234

Query: 312 SLVDC-GITELPESLGRSPSLNYLNLAE-NDFEKIPSSIKQLSKLLFLTLRNCKRLQSLP 369
            L  C  +   P   G    L  L L + ++   +P  I +L++L  L LR C  L  LP
Sbjct: 235 DLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLP 294

Query: 370 ELPCGSTIFARHCTSLETL 388
            L            +   +
Sbjct: 295 SLIA-------QLPANCII 306
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query566
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.98
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.9
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.89
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.76
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.76
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.72
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.64
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.61
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.59
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.59
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.55
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.55
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.41
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.4
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.39
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.39
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.39
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.38
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.36
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.33
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.32
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.22
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.17
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.17
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.1
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.81
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.79
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.77
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.71
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.68
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.64
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.62
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.57
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.44
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.41
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.02
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.92
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.87
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.61
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.44
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.99
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.91
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.31
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.73
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
Probab=100.00  E-value=4.3e-36  Score=330.26  Aligned_cols=346  Identities=20%  Similarity=0.202  Sum_probs=248.5

Q ss_pred             ecCHHHHhcCcCCcEEEEeecCCCCccceEEcCCCccCCCccceEEEeCCccCCCCC-CCC-CCCCeEEEEcCCCCCccc
Q 037314            8 CLNPNTFTKMHRLRFFKFYNIFAGVNKYKVRHSRYLESLFNELRYFYWDGYPLKSLP-SKN-IPEHLVSLEMPHSNIEQL   85 (566)
Q Consensus         8 ~~~~~~f~~m~~Lr~L~l~~~~~~~~~~~~~l~~~l~~l~~~Lr~L~l~~~~l~~lp-~~~-~~~~L~~L~L~~~~i~~l   85 (566)
                      .+.+.+|.++++||+|++++     +......|..+..++ +|++|++++|.++.++ ..+ .+++|++|++++|+++.+
T Consensus        47 ~~~~~~~~~l~~L~~L~Ls~-----n~i~~~~~~~~~~l~-~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~l  120 (606)
T 3t6q_A           47 TIQNTTFSRLINLTFLDLTR-----CQIYWIHEDTFQSQH-RLDTLVLTANPLIFMAETALSGPKALKHLFFIQTGISSI  120 (606)
T ss_dssp             EECTTTSTTCTTCSEEECTT-----CCCCEECTTTTTTCT-TCCEEECTTCCCSEECTTTTSSCTTCCEEECTTSCCSCG
T ss_pred             cCChhHhccCccceEEECCC-----CccceeChhhccCcc-ccCeeeCCCCcccccChhhhcccccccEeeccccCcccC
Confidence            45678999999999999998     455667788899986 8999999999998774 455 899999999999999987


Q ss_pred             -cccCCCCCCCcEEecCCCCCCC-CCCCCCCCCCccEEEeeCCCCccccchhhhhcccCc--EEecCCCCCCCccCCcCC
Q 037314           86 -WNGVQNLAALKRLNLSYSKQLS-RIPDISLAFNIERLDLVGCASLIETHSSIQHLNKLV--FLNLGHCISLKSLPTGIN  161 (566)
Q Consensus        86 -~~~~~~l~~L~~L~Ls~~~~l~-~~p~l~~l~~L~~L~L~~c~~~~~~~~~~~~l~~L~--~L~L~~c~~l~~lp~~~~  161 (566)
                       +..+..+++|++|++++|.+.. ..|.+..+++|++|++++|......+..++.+++|+  .|++++|......|..+.
T Consensus       121 ~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~l~L~l~~n~l~~~~~~~~~  200 (606)
T 3t6q_A          121 DFIPLHNQKTLESLYLGSNHISSIKLPKGFPTEKLKVLDFQNNAIHYLSKEDMSSLQQATNLSLNLNGNDIAGIEPGAFD  200 (606)
T ss_dssp             GGSCCTTCTTCCEEECCSSCCCCCCCCTTCCCTTCCEEECCSSCCCEECHHHHHTTTTCCSEEEECTTCCCCEECTTTTT
T ss_pred             CcchhccCCcccEEECCCCcccccCcccccCCcccCEEEcccCcccccChhhhhhhcccceeEEecCCCccCccChhHhh
Confidence             6778999999999999999776 457777799999999999988877788899999999  899998654433343334


Q ss_pred             CCC----------------------------------------------------ccEEEecCCCCCCcCCc---ccCCC
Q 037314          162 LDS----------------------------------------------------LKVLYLGGCSNLKRFPE---ISCNI  186 (566)
Q Consensus       162 l~~----------------------------------------------------L~~L~L~~~~~l~~~~~---~~~~L  186 (566)
                      ..+                                                    |+.|++++|......+.   ...+|
T Consensus       201 ~~~L~~L~l~~~~~~~~~~~~l~~~~l~~l~~~~~~~~~~~~i~~~~~~~l~~~~L~~L~l~~n~l~~~~~~~~~~l~~L  280 (606)
T 3t6q_A          201 SAVFQSLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVFEGLCEMSVESINLQKHYFFNISSNTFHCFSGL  280 (606)
T ss_dssp             TCEEEEEECTTCSCHHHHHHHTTTCEEEEEECCCCTTSCCCCCCGGGGGGGGGSEEEEEECTTCCCSSCCTTTTTTCTTC
T ss_pred             hccccccccCCchhHHHHhhhccccchhheechhhccccccccChhHhchhhcCceeEEEeecCccCccCHHHhccccCC
Confidence            444                                                    44455555433222222   23478


Q ss_pred             CEEecCCCCCcccCccccCCCCCcEEeccCCCCcccccccccCCCCCcEEeccCCcCCccccc-ccCCCCccceeccCCc
Q 037314          187 EHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLSGCLKLEKLPE-EIGNLESLEVMLANET  265 (566)
Q Consensus       187 ~~L~L~~~~i~~lp~~~~~l~~L~~L~L~~~~~l~~lp~~l~~l~~L~~L~ls~~~~l~~~p~-~l~~l~~L~~L~l~~n  265 (566)
                      ++|++++|.+.++|..+..+++|++|++++|...+..|..+.++++|++|++++|.....+|. .+..+++|++|++++|
T Consensus       281 ~~L~l~~n~l~~lp~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~n  360 (606)
T 3t6q_A          281 QELDLTATHLSELPSGLVGLSTLKKLVLSANKFENLCQISASNFPSLTHLSIKGNTKRLELGTGCLENLENLRELDLSHD  360 (606)
T ss_dssp             SEEECTTSCCSCCCSSCCSCTTCCEEECTTCCCSBGGGGCGGGCTTCSEEECCSCSSCCBCCSSTTTTCTTCCEEECCSS
T ss_pred             CEEeccCCccCCCChhhcccccCCEEECccCCcCcCchhhhhccCcCCEEECCCCCcccccchhhhhccCcCCEEECCCC
Confidence            888999999999998888899999999998887777777888888888888888877766554 4778888888888888


Q ss_pred             ccccc---CcccccCCCCCEEEccCCCCCCCCCCCCcccccCCCCCcEEecccCCCccc-C-CCCCCCCCCCEEeccCCC
Q 037314          266 AISQV---PPSIACLNRVESLSFDRCKGRPPLMSLKLPILFQLQNLEYLSLVDCGITEL-P-ESLGRSPSLNYLNLAEND  340 (566)
Q Consensus       266 ~l~~l---~~~l~~l~~L~~L~l~~~~~~~~~~~~~l~~~~~l~~L~~L~L~~~~l~~l-p-~~l~~l~~L~~L~Ls~n~  340 (566)
                      .+..+   +..+..+++|++|++++|.....    ....+..+++|++|++++|.+... + ..+..+++|++|++++|.
T Consensus       361 ~l~~~~~~~~~~~~l~~L~~L~l~~n~l~~~----~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~l~~n~  436 (606)
T 3t6q_A          361 DIETSDCCNLQLRNLSHLQSLNLSYNEPLSL----KTEAFKECPQLELLDLAFTRLKVKDAQSPFQNLHLLKVLNLSHSL  436 (606)
T ss_dssp             CCCEEEESTTTTTTCTTCCEEECCSCSCEEE----CTTTTTTCTTCSEEECTTCCEECCTTCCTTTTCTTCCEEECTTCC
T ss_pred             ccccccCcchhcccCCCCCEEECCCCcCCcC----CHHHhcCCccCCeEECCCCcCCCcccchhhhCcccCCEEECCCCc
Confidence            87755   55677788888888887763211    011134444555555555554442 1 224444555555555554


Q ss_pred             Ceec-CcchhcCCCCcEecccccc
Q 037314          341 FEKI-PSSIKQLSKLLFLTLRNCK  363 (566)
Q Consensus       341 l~~l-p~~i~~l~~L~~L~L~~c~  363 (566)
                      +... |..+..+++|++|++++|+
T Consensus       437 l~~~~~~~~~~l~~L~~L~L~~n~  460 (606)
T 3t6q_A          437 LDISSEQLFDGLPALQHLNLQGNH  460 (606)
T ss_dssp             CBTTCTTTTTTCTTCCEEECTTCB
T ss_pred             cCCcCHHHHhCCCCCCEEECCCCC
Confidence            4432 3334444555555555444
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 566
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 8e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 60.0 bits (144), Expect = 2e-10
 Identities = 35/180 (19%), Positives = 69/180 (38%), Gaps = 14/180 (7%)

Query: 182 ISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLSGC 241
           I  N++ L L    ++++ + + +L+ L  LDL N     S  + L  L  L  L L   
Sbjct: 217 ILTNLDELSLNGNQLKDIGT-LASLTNLTDLDLANNQ--ISNLAPLSGLTKLTELKLGAN 273

Query: 242 LKLEKLPEEIGNLESLEVMLANETAISQVPPSIACLNRVESLSFDRCKGRPPLMSLKLPI 301
            ++  +    G      + L         P S        +L F+      P+ SL    
Sbjct: 274 -QISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLT--- 329

Query: 302 LFQLQNLEYLSLVDCGITELPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLTLRN 361
                 L+ L   +  ++++  SL    ++N+L+   N    +   +  L+++  L L +
Sbjct: 330 -----KLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLT-PLANLTRITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query566
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.79
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.36
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.3
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.3
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.06
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.98
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.9
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.86
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.68
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.31
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.25
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.96
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.47
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.27
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.93  E-value=2.5e-24  Score=219.84  Aligned_cols=188  Identities=20%  Similarity=0.311  Sum_probs=84.2

Q ss_pred             CCCCccEEEecCCCCCCcCC-cccCCCCEEecCCCCCcccCccccCCCCCcEEeccCCCCcccccccccCCCCCcEEecc
Q 037314          161 NLDSLKVLYLGGCSNLKRFP-EISCNIEHLDLKETAIEELPSSIGNLSRLVHLDLTNCSRLKSVSSSLCNLKSLVNLYLS  239 (566)
Q Consensus       161 ~l~~L~~L~L~~~~~l~~~~-~~~~~L~~L~L~~~~i~~lp~~~~~l~~L~~L~L~~~~~l~~lp~~l~~l~~L~~L~ls  239 (566)
                      .+++++.+++++|......| ....++++|++++|.+++++ .+..+++|+.|++++|...+ ++ .+..+++|++|+++
T Consensus       195 ~l~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L~~L~l~~n~l~~-~~-~~~~~~~L~~L~l~  271 (384)
T d2omza2         195 KLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISN-LA-PLSGLTKLTELKLG  271 (384)
T ss_dssp             GCTTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCG-GGGGCTTCSEEECCSSCCCC-CG-GGTTCTTCSEEECC
T ss_pred             cccccceeeccCCccCCCCcccccCCCCEEECCCCCCCCcc-hhhcccccchhccccCccCC-CC-cccccccCCEeecc
Confidence            34455555555543222221 12234555555555555443 24445555555555544322 21 14444555555555


Q ss_pred             CCcCCcccccccCCCCccceeccCCccccccCcccccCCCCCEEEccCCCCCCCCCCCCcccccCCCCCcEEecccCCCc
Q 037314          240 GCLKLEKLPEEIGNLESLEVMLANETAISQVPPSIACLNRVESLSFDRCKGRPPLMSLKLPILFQLQNLEYLSLVDCGIT  319 (566)
Q Consensus       240 ~~~~l~~~p~~l~~l~~L~~L~l~~n~l~~l~~~l~~l~~L~~L~l~~~~~~~~~~~~~l~~~~~l~~L~~L~L~~~~l~  319 (566)
                      ++...+. + .+..++.++.+.+..|.+..++ .+..+++++.|++++|....      ++.+..+++|++|++++|+++
T Consensus       272 ~~~l~~~-~-~~~~~~~l~~l~~~~n~l~~~~-~~~~~~~l~~L~ls~n~l~~------l~~l~~l~~L~~L~L~~n~l~  342 (384)
T d2omza2         272 ANQISNI-S-PLAGLTALTNLELNENQLEDIS-PISNLKNLTYLTLYFNNISD------ISPVSSLTKLQRLFFANNKVS  342 (384)
T ss_dssp             SSCCCCC-G-GGTTCTTCSEEECCSSCCSCCG-GGGGCTTCSEEECCSSCCSC------CGGGGGCTTCCEEECCSSCCC
T ss_pred             CcccCCC-C-cccccccccccccccccccccc-ccchhcccCeEECCCCCCCC------CcccccCCCCCEEECCCCCCC
Confidence            4433221 1 2344444555555555444432 24444555555555443221      222444455555555555554


Q ss_pred             ccCCCCCCCCCCCEEeccCCCCeecCcchhcCCCCcEeccccc
Q 037314          320 ELPESLGRSPSLNYLNLAENDFEKIPSSIKQLSKLLFLTLRNC  362 (566)
Q Consensus       320 ~lp~~l~~l~~L~~L~Ls~n~l~~lp~~i~~l~~L~~L~L~~c  362 (566)
                      +++ .++.+++|++|++++|+++.++. +.++++|+.|+|++|
T Consensus       343 ~l~-~l~~l~~L~~L~l~~N~l~~l~~-l~~l~~L~~L~L~~N  383 (384)
T d2omza2         343 DVS-SLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLNDQ  383 (384)
T ss_dssp             CCG-GGGGCTTCCEEECCSSCCCBCGG-GTTCTTCSEEECCCE
T ss_pred             CCh-hHcCCCCCCEEECCCCcCCCChh-hccCCCCCEeeCCCC
Confidence            443 24445555555555555554442 444555555555443
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure