Citrus Sinensis ID: 037371
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 330 | ||||||
| 24461866 | 890 | NBS-LRR type disease resistance protein | 0.954 | 0.353 | 0.448 | 2e-64 | |
| 24461865 | 892 | NBS-LRR type disease resistance protein | 0.951 | 0.352 | 0.453 | 3e-62 | |
| 24461864 | 899 | NBS-LRR type disease resistance protein | 0.936 | 0.343 | 0.448 | 1e-55 | |
| 24461863 | 889 | NBS-LRR type disease resistance protein | 0.957 | 0.355 | 0.455 | 4e-52 | |
| 24461861 | 890 | NBS-LRR type disease resistance protein | 0.939 | 0.348 | 0.447 | 5e-51 | |
| 225443158 | 903 | PREDICTED: probable disease resistance p | 0.951 | 0.347 | 0.383 | 4e-47 | |
| 255553059 | 812 | Disease resistance protein RFL1, putativ | 0.951 | 0.386 | 0.414 | 4e-47 | |
| 255553103 | 910 | Disease resistance protein RPS5, putativ | 0.936 | 0.339 | 0.390 | 1e-46 | |
| 224122896 | 820 | cc-nbs-lrr resistance protein [Populus t | 0.903 | 0.363 | 0.376 | 4e-44 | |
| 359482672 | 905 | PREDICTED: probable disease resistance p | 0.957 | 0.349 | 0.392 | 6e-43 |
| >gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
Score = 252 bits (643), Expect = 2e-64, Method: Compositional matrix adjust.
Identities = 145/323 (44%), Positives = 213/323 (65%), Gaps = 8/323 (2%)
Query: 2 SLSKLPSGISNLVSLHHLDLSRTNITGLPQELKALEKLRYLNLDHTRFLSIIPPQLISGF 61
SL+ LP GIS LVSL HLDLS+++I LP ELKAL L+ LNL++T L+ IP QLIS
Sbjct: 570 SLTNLPEGISKLVSLQHLDLSKSSIEELPLELKALVNLKCLNLEYTWSLTTIPRQLISNL 629
Query: 62 SKLEVLRLLSRGRWSVLEEEEGSVLCDDAEPLMKELLGLKHLNVLSWSFRSSLAVQKFLK 121
S+L VLR+ + + E S+L E +++ELLGLK+L V+S++ RSS +Q FL
Sbjct: 630 SRLHVLRMFAASHSAFDRASEDSILFGGGELIVEELLGLKYLEVISFTLRSSHGLQSFLS 689
Query: 122 YPKLVSITQSVWVECGTYTRPPFNVLHLAYMENLQELELGSS-KLEEMKIDSTEEVKKLF 180
KL S T+++ ++C + V LA ++ L L + KLEE+K+D T EV++
Sbjct: 690 SHKLRSCTRALLLQCFNDS-TSLEVSALADLKQLNRLWITECKKLEELKMDYTREVQQFV 748
Query: 181 RNGFRSLNTVVLRSC-RGKDLTWLVFVQNLKQLNMQGF-TMEEIISVDKLSDISEIIGSE 238
F SL V + +C + KDLT+LVF NL+ + + G MEE++S+ K +++ E++ +
Sbjct: 749 ---FHSLKKVEILACSKLKDLTFLVFAPNLESIELMGCPAMEEMVSMGKFAEVPEVVAN- 804
Query: 239 HNIFARLEYLTMWRGTNVKSVYPNPLPFPKLKKIQVFHCRQLKKLPLNSSSAKGRRVVIE 298
N FA+L+ L ++ TN+KS+Y PLPFP LK + HC +LKKLPL+S+SA+ R +VI
Sbjct: 805 LNPFAKLQNLKLFGATNLKSIYWKPLPFPHLKSMSFSHCYKLKKLPLDSNSARERNIVIS 864
Query: 299 GTKKWWEELQWEDQATQNAFFSC 321
GT++WWE+L+W D+AT+NAF C
Sbjct: 865 GTRRWWEQLEWVDEATRNAFLPC 887
|
Source: Citrus trifoliata Species: Citrus trifoliata Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|225443158|ref|XP_002263674.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255553059|ref|XP_002517572.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223543204|gb|EEF44736.1| Disease resistance protein RFL1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255553103|ref|XP_002517594.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223543226|gb|EEF44758.1| Disease resistance protein RPS5, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224122896|ref|XP_002318943.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857319|gb|EEE94866.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359482672|ref|XP_003632805.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 330 | ||||||
| TAIR|locus:2201986 | 885 | RFL1 "AT1G12210" [Arabidopsis | 0.912 | 0.340 | 0.373 | 4e-36 | |
| TAIR|locus:2034770 | 894 | SUMM2 "AT1G12280" [Arabidopsis | 0.887 | 0.327 | 0.366 | 1.2e-33 | |
| TAIR|locus:2153474 | 874 | AT5G05400 [Arabidopsis thalian | 0.915 | 0.345 | 0.346 | 1.1e-32 | |
| TAIR|locus:2034765 | 884 | AT1G12290 [Arabidopsis thalian | 0.875 | 0.326 | 0.347 | 2.8e-31 | |
| TAIR|locus:2132741 | 892 | AT4G10780 [Arabidopsis thalian | 0.912 | 0.337 | 0.318 | 1.6e-30 | |
| TAIR|locus:2008510 | 967 | AT1G61190 "AT1G61190" [Arabido | 0.878 | 0.299 | 0.365 | 3.6e-29 | |
| TAIR|locus:2201996 | 889 | RPS5 "AT1G12220" [Arabidopsis | 0.927 | 0.344 | 0.341 | 1.7e-28 | |
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.878 | 0.326 | 0.321 | 6.4e-26 | |
| TAIR|locus:2036214 | 851 | AT1G15890 [Arabidopsis thalian | 0.8 | 0.310 | 0.321 | 2.2e-23 | |
| TAIR|locus:2008440 | 899 | AT1G61180 [Arabidopsis thalian | 0.893 | 0.328 | 0.309 | 6e-22 |
| TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 399 (145.5 bits), Expect = 4.0e-36, P = 4.0e-36
Identities = 122/327 (37%), Positives = 176/327 (53%)
Query: 2 SLSKLPSGISNLVSLHHLDLSRTNITGLPQELKALEKLRYLNLDHTRFLSIIPPQLISGF 61
SLS+LP IS LVSL +LDLS T I LP L L KL +L L+ TR L + ISG
Sbjct: 575 SLSELPEEISELVSLQYLDLSGTYIERLPHGLHELRKLVHLKLERTRRL-----ESISGI 629
Query: 62 SKLEVLRLLSRGRWSVLEEEEGSVLCDDAEPLMKELLGLKHLNVLSWSFRSSLAVQKFLK 121
S L LR L R R S + G LMKEL L+HL +++ S L + F
Sbjct: 630 SYLSSLRTL-RLRDSKTTLDTG---------LMKELQLLEHLELITTDISSGLVGELFC- 678
Query: 122 YPKLVSITQSVWV-ECGTYTRPPFNVLHLAYMENLQELELGSSKLEEMKIDSTEEVKKLF 180
YP++ Q +++ + VL L + NL + + + + E+ I+ T K L
Sbjct: 679 YPRVGRCIQHIYIRDHWERPEESVGVLVLPAIHNLCYISIWNCWMWEIMIEKTPWKKNLT 738
Query: 181 RNGFRSLNTVVLRSCRG-KDLTWLVFVQNLKQLNMQGFT-MEEIISVDKLSDISEIIGSE 238
F +L+ V + C G KDLTWL+F NL L + G +E+IIS +K + + E E
Sbjct: 739 NPNFSNLSNVRIEGCDGLKDLTWLLFAPNLINLRVWGCKHLEDIISKEKAASVLE---KE 795
Query: 239 HNIFARLEYLTMWRGTNVKSVYPNPLPFPKLKKIQVFH-CRQLKKLPLNSSSA-KGRRVV 296
F +LE L +++ + +KS+Y N LPF +L+ + + + C +L+KLPL+S S K V
Sbjct: 796 ILPFQKLECLNLYQLSELKSIYWNALPFQRLRCLDILNNCPKLRKLPLDSKSVVKVEEFV 855
Query: 297 IE-GTKKWWEELQWEDQATQNAFF-SC 321
I+ KKW E ++WED+ATQ F +C
Sbjct: 856 IKYKEKKWIERVEWEDEATQYRFLPTC 882
|
|
| TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_XIII000034 | cc-nbs-lrr resistance protein (820 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 330 | |||
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 1e-05 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-04 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 0.001 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.002 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 0.002 |
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
Score = 42.1 bits (100), Expect = 1e-05
Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 2/56 (3%)
Query: 15 SLHHLDLSRTNITGLPQE-LKALEKLRYLNLDHTRFLSIIPPQLISGFSKLEVLRL 69
+L LDLS +T +P K L L+ L+L L+ I P+ SG L L L
Sbjct: 1 NLKSLDLSNNRLTVIPDGAFKGLPNLKVLDLSGNN-LTSISPEAFSGLPSLRSLDL 55
|
Length = 60 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 330 | |||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.81 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.8 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.75 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.75 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.74 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.74 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.73 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.7 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.67 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.58 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.5 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.48 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.44 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.43 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.41 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.37 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.37 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.33 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.33 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.32 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.32 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.3 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.29 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.11 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.0 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.98 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.93 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.87 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.83 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.78 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.77 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.75 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.74 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.72 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.62 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.61 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.59 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.56 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.52 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.43 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.43 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.42 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.39 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.39 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.35 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.34 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.17 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.06 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.02 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.9 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.82 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.77 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.75 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.72 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.69 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.66 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.49 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.38 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.34 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.24 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.14 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.07 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.02 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.94 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.73 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.63 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.53 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.51 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.24 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 95.32 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 94.75 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 94.65 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 93.24 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 92.29 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 91.87 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 91.87 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 85.03 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 84.19 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 84.18 |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Probab=99.81 E-value=7.2e-20 Score=187.23 Aligned_cols=187 Identities=18% Similarity=0.208 Sum_probs=99.8
Q ss_pred cCChhhhccccccEeecCCCCCc-ccChhhhcCcccceeccCCCCCCCCCchhhhCCCCCCcEEEeccCCCCCccccccC
Q 037371 5 KLPSGISNLVSLHHLDLSRTNIT-GLPQELKALEKLRYLNLDHTRFLSIIPPQLISGFSKLEVLRLLSRGRWSVLEEEEG 83 (330)
Q Consensus 5 ~lp~~l~~l~~L~~L~L~~~~~~-~lp~~l~~l~~L~~L~l~~~~~~~~~p~~~~~~l~~L~~L~l~~~~~~~~~~~~~~ 83 (330)
.+|..++++++|++|++++|.+. .+|..++++++|++|++++|.+.+.+|.. ++++++|++|++++|.+
T Consensus 155 ~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~~L~L~~n~l--------- 224 (968)
T PLN00113 155 EIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE-LGQMKSLKWIYLGYNNL--------- 224 (968)
T ss_pred cCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChH-HcCcCCccEEECcCCcc---------
Confidence 45666666666666666666655 56666666666666666666665556654 66666666666666665
Q ss_pred ccccCCchhhHHHhccCcCcceeeEEEechhhHHHhhccccccCceEEEEE-EeCCCCCCCccccccccccCccEEEEEc
Q 037371 84 SVLCDDAEPLMKELLGLKHLNVLSWSFRSSLAVQKFLKYPKLVSITQSVWV-ECGTYTRPPFNVLHLAYMENLQELELGS 162 (330)
Q Consensus 84 ~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l-~~~~~~~~~~~~~~l~~l~~L~~L~l~~ 162 (330)
....+..++++++|++|++++|..... +......+.+|+.|++ ++.. .......+..+++|+.|+++.
T Consensus 225 ------~~~~p~~l~~l~~L~~L~L~~n~l~~~--~p~~l~~l~~L~~L~L~~n~l---~~~~p~~l~~l~~L~~L~Ls~ 293 (968)
T PLN00113 225 ------SGEIPYEIGGLTSLNHLDLVYNNLTGP--IPSSLGNLKNLQYLFLYQNKL---SGPIPPSIFSLQKLISLDLSD 293 (968)
T ss_pred ------CCcCChhHhcCCCCCEEECcCceeccc--cChhHhCCCCCCEEECcCCee---eccCchhHhhccCcCEEECcC
Confidence 334555666666666666666544321 1111122344555555 2211 222333455566666666664
Q ss_pred cCcceeeeCcccccCccCCCCCCCccEEEEecccccc--cCcccccCCccEEEEeccccc
Q 037371 163 SKLEEMKIDSTEEVKKLFRNGFRSLNTVVLRSCRGKD--LTWLVFVQNLKQLNMQGFTME 220 (330)
Q Consensus 163 ~~~~~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~--l~~l~~l~~L~~L~L~~~~l~ 220 (330)
|.+....+.. ...+++|++|++++|.+.. +.++..+++|+.|++++|.+.
T Consensus 294 n~l~~~~p~~--------~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~ 345 (968)
T PLN00113 294 NSLSGEIPEL--------VIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFS 345 (968)
T ss_pred CeeccCCChh--------HcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCc
Confidence 4443222211 1344555555555553322 223455555555555555444
|
|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 330 | |||
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-10 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-09 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 5e-09 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-08 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 6e-08 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-06 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-10 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-09 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 6e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-10 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 6e-08 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-10 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-08 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 7e-08 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 9e-08 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-06 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 7e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-04 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-09 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 4e-09 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-09 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 4e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 9e-07 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-06 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 8e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-09 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-08 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 8e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 9e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 9e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-06 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 6e-09 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 8e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 7e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 9e-04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 8e-09 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 8e-08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 9e-08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-07 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 8e-07 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-06 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-06 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-06 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 7e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-04 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-08 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 3e-08 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-05 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-05 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 4e-05 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 9e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-08 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-08 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-08 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 9e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 9e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-04 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-08 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 4e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 9e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-08 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 8e-08 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 7e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 9e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 3e-08 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 3e-08 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-07 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-07 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 4e-07 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 4e-06 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 6e-08 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 7e-05 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 1e-04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 8e-08 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 6e-07 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 8e-06 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 1e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 9e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-07 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-07 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 3e-07 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 6e-07 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 3e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-07 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-07 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 6e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 8e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-05 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-05 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 6e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 9e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-07 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 5e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 6e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 3e-07 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 3e-07 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 5e-07 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 5e-07 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-06 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 6e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-07 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-07 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 7e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 8e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-04 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 7e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 8e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 4e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 9e-07 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-04 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-06 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-06 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 6e-06 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 6e-06 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 4e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 8e-05 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-06 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-05 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-04 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 1e-06 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-06 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 6e-06 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 9e-06 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 7e-05 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-06 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-05 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 4e-05 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 6e-04 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-06 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-05 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 4e-05 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 7e-05 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-04 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 3e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 4e-04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 3e-06 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 8e-06 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 3e-05 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 6e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 5e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 7e-04 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 1e-05 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-05 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 1e-05 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 3e-05 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 5e-05 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 3e-04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 8e-04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 3e-04 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-05 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-05 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-05 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-05 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 4e-05 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 8e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 6e-05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 3e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 3e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 2e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 3e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 9e-04 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 3e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 6e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 7e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 7e-05 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 7e-05 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 2e-04 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 9e-05 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 2e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 6e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 7e-04 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-04 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 6e-04 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 8e-04 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 5e-04 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 6e-04 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 6e-04 |
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 330 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.9 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.88 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.88 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.88 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.87 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.87 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.87 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.87 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.86 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.86 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.86 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.86 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.85 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.85 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.85 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.85 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.84 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.84 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.84 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.84 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.84 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.84 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.84 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.84 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.84 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.83 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.83 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.83 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.83 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.83 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.83 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.83 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.82 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.82 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.82 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.82 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.81 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.81 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.81 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.81 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.81 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.81 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.81 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.81 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.81 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.81 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.8 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.8 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.79 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.79 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.79 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.79 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.79 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.79 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.79 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.78 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.78 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.78 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.78 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.78 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.78 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.77 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.77 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.77 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.77 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.77 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.75 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.75 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.75 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.73 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.73 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.73 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.73 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.73 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.73 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.72 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.72 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.7 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.69 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.69 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.68 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.68 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.68 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.68 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.67 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.66 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.66 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.65 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.64 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.64 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.63 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.62 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.61 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.6 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.6 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.59 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.59 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.57 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.55 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.54 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.54 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.54 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.54 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.54 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.53 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.53 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.52 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.51 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.51 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.5 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.49 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.49 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.49 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.48 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.48 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.45 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.37 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.36 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.35 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.33 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.33 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.3 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.28 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.26 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.26 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.22 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.2 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.2 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.19 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.17 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.17 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.16 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.15 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.13 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.11 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.07 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.02 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.0 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.96 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.96 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.92 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.92 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.91 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.91 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.64 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.6 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.53 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.39 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.29 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.21 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.1 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.0 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 98.0 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.98 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.75 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.7 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.63 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.59 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.39 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 96.38 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.29 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.28 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 95.92 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 92.68 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
Probab=99.90 E-value=6.7e-23 Score=183.29 Aligned_cols=238 Identities=19% Similarity=0.208 Sum_probs=185.1
Q ss_pred cccccEeecCCCCCcccChhhhcCcccceeccCCCCCCCCCchhhhCCCCCCcEEEeccCCCCCccccccCccccCCchh
Q 037371 13 LVSLHHLDLSRTNITGLPQELKALEKLRYLNLDHTRFLSIIPPQLISGFSKLEVLRLLSRGRWSVLEEEEGSVLCDDAEP 92 (330)
Q Consensus 13 l~~L~~L~L~~~~~~~lp~~l~~l~~L~~L~l~~~~~~~~~p~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~ 92 (330)
..++++|++++|.+..+|..++++++|++|++++|.+. .+|.. ++++++|++|++++|.+ . .
T Consensus 80 ~~~l~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~n~l~-~lp~~-~~~l~~L~~L~Ls~n~l---------------~-~ 141 (328)
T 4fcg_A 80 QPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLM-ELPDT-MQQFAGLETLTLARNPL---------------R-A 141 (328)
T ss_dssp STTCCEEEEESSCCSSCCSCGGGGTTCSEEEEESSCCC-CCCSC-GGGGTTCSEEEEESCCC---------------C-C
T ss_pred ccceeEEEccCCCchhcChhhhhCCCCCEEECCCCCcc-chhHH-HhccCCCCEEECCCCcc---------------c-c
Confidence 37899999999999999999999999999999999885 88886 89999999999999988 3 4
Q ss_pred hHHHhccCcCcceeeEEEechhhHHHhhccccccCceEEEEEEeCCCCCCCccccccccccCccEEEEEccCcceeeeCc
Q 037371 93 LMKELLGLKHLNVLSWSFRSSLAVQKFLKYPKLVSITQSVWVECGTYTRPPFNVLHLAYMENLQELELGSSKLEEMKIDS 172 (330)
Q Consensus 93 ~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~ 172 (330)
++..+.++++|++|++++|.... .....+.... ....+..+++|++|+++.|.++.+.. .
T Consensus 142 lp~~l~~l~~L~~L~L~~n~~~~--------~~p~~~~~~~-----------~~~~~~~l~~L~~L~L~~n~l~~lp~-~ 201 (328)
T 4fcg_A 142 LPASIASLNRLRELSIRACPELT--------ELPEPLASTD-----------ASGEHQGLVNLQSLRLEWTGIRSLPA-S 201 (328)
T ss_dssp CCGGGGGCTTCCEEEEEEETTCC--------CCCSCSEEEC------------CCCEEESTTCCEEEEEEECCCCCCG-G
T ss_pred CcHHHhcCcCCCEEECCCCCCcc--------ccChhHhhcc-----------chhhhccCCCCCEEECcCCCcCcchH-h
Confidence 56678999999999999875321 0011111110 11246789999999999888774422 1
Q ss_pred ccccCccCCCCCCCccEEEEecccccccC-cccccCCccEEEEecccccccccccccccccccccCccccCcccceeecc
Q 037371 173 TEEVKKLFRNGFRSLNTVVLRSCRGKDLT-WLVFVQNLKQLNMQGFTMEEIISVDKLSDISEIIGSEHNIFARLEYLTMW 251 (330)
Q Consensus 173 ~~~~~~~~~~~~~~L~~L~L~~~~~~~l~-~l~~l~~L~~L~L~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~ 251 (330)
...+++|++|++++|.+..++ .++.+++|++|++++|.+.+..+ ..++.+++|++|+++
T Consensus 202 --------l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p------------~~~~~l~~L~~L~L~ 261 (328)
T 4fcg_A 202 --------IANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYP------------PIFGGRAPLKRLILK 261 (328)
T ss_dssp --------GGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCCBCC------------CCTTCCCCCCEEECT
T ss_pred --------hcCCCCCCEEEccCCCCCcCchhhccCCCCCEEECcCCcchhhhH------------HHhcCCCCCCEEECC
Confidence 357889999999999776654 68889999999999966655544 267889999999999
Q ss_pred cccccccccCCCCCCCCccEEEEccCCCCCCCCCCCcCCCCCceEEeccHHHHhhccc
Q 037371 252 RGTNVKSVYPNPLPFPKLKKIQVFHCRQLKKLPLNSSSAKGRRVVIEGTKKWWEELQW 309 (330)
Q Consensus 252 ~~~~l~~l~~~~~~~~~L~~L~i~~c~~L~~lp~~~~~~~~~~~~i~~~~~~~~~l~~ 309 (330)
+|.....++.....+++|+.|++++|+.++.+|.....+. .+..+..+......+.+
T Consensus 262 ~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~iP~~l~~L~-~L~~l~l~~~~~~~l~~ 318 (328)
T 4fcg_A 262 DCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLP-ANCIILVPPHLQAQLDQ 318 (328)
T ss_dssp TCTTCCBCCTTGGGCTTCCEEECTTCTTCCCCCGGGGGSC-TTCEEECCGGGSCC---
T ss_pred CCCchhhcchhhhcCCCCCEEeCCCCCchhhccHHHhhcc-CceEEeCCHHHHHHHhh
Confidence 9988888887777899999999999999999998887766 45555655555544443
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 330 | ||||
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-07 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-04 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 0.002 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 3e-06 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 0.001 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 1e-05 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 2e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 6e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.001 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 6e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.001 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.001 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1m9la_ | 198 | c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree | 0.002 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 0.002 |
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Internalin LRR domain domain: Internalin A species: Listeria monocytogenes [TaxId: 1639]
Score = 48.5 bits (114), Expect = 4e-07
Identities = 12/63 (19%), Positives = 28/63 (44%), Gaps = 4/63 (6%)
Query: 7 PSGISNLVSLHHLDLSRTNITGLPQELKALEKLRYLNLDHTRFLSIIPPQLISGFSKLEV 66
S +S+L L L + ++ + L L + +L+ H + + P ++ +++
Sbjct: 322 ISPVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLTP---LANLTRITQ 377
Query: 67 LRL 69
L L
Sbjct: 378 LGL 380
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 330 | |||
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.78 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.77 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.76 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.74 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.74 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.73 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.72 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.71 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.69 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.69 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.68 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.67 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.64 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.64 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.62 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.61 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.6 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.6 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.54 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.52 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.52 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.38 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.35 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.3 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.29 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.25 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.21 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.19 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.17 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.06 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.86 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.82 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.82 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.74 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.66 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.45 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.97 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.61 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.29 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.55 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.3 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.05 |
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Ngr ectodomain-like domain: Decorin species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.78 E-value=2.2e-18 Score=150.10 Aligned_cols=239 Identities=17% Similarity=0.129 Sum_probs=173.8
Q ss_pred CCccCChhhhccccccEeecCCCCCcccCh-hhhcCcccceeccCCCCCCCCCchhhhCCCCCCcEEEeccCCCCCcccc
Q 037371 2 SLSKLPSGISNLVSLHHLDLSRTNITGLPQ-ELKALEKLRYLNLDHTRFLSIIPPQLISGFSKLEVLRLLSRGRWSVLEE 80 (330)
Q Consensus 2 ~l~~lp~~l~~l~~L~~L~L~~~~~~~lp~-~l~~l~~L~~L~l~~~~~~~~~p~~~~~~l~~L~~L~l~~~~~~~~~~~ 80 (330)
+++++|..+. +++++|+|++|+++++|+ .+.++++|++|++++|.+....|. ++.++++|++|++++|++ +.
T Consensus 21 ~L~~lP~~l~--~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~l~~n~~~~i~~~-~f~~l~~L~~L~l~~n~l-~~--- 93 (305)
T d1xkua_ 21 GLEKVPKDLP--PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPG-AFAPLVKLERLYLSKNQL-KE--- 93 (305)
T ss_dssp CCCSCCCSCC--TTCCEEECCSSCCCCBCTTTTTTCTTCCEEECCSSCCCCBCTT-TTTTCTTCCEEECCSSCC-SB---
T ss_pred CCCccCCCCC--CCCCEEECcCCcCCCcChhHhhccccccccccccccccccchh-hhhCCCccCEecccCCcc-Cc---
Confidence 5889998875 689999999999999987 689999999999999988544444 499999999999999988 22
Q ss_pred ccCccccCCchhhHHHhccCcCcceeeEEEechhhHHHhhccccccCceEEEEEEeCCCCCCCccccccccccCccEEEE
Q 037371 81 EEGSVLCDDAEPLMKELLGLKHLNVLSWSFRSSLAVQKFLKYPKLVSITQSVWVECGTYTRPPFNVLHLAYMENLQELEL 160 (330)
Q Consensus 81 ~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~l~~l~~L~~L~l 160 (330)
++. .....++.|.+..|....+.... .........+................+..+++|+.+++
T Consensus 94 ------------l~~--~~~~~l~~L~~~~n~l~~l~~~~--~~~~~~~~~l~~~~n~~~~~~~~~~~~~~l~~L~~l~l 157 (305)
T d1xkua_ 94 ------------LPE--KMPKTLQELRVHENEITKVRKSV--FNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRI 157 (305)
T ss_dssp ------------CCS--SCCTTCCEEECCSSCCCBBCHHH--HTTCTTCCEEECCSSCCCGGGBCTTGGGGCTTCCEEEC
T ss_pred ------------Ccc--chhhhhhhhhccccchhhhhhhh--hhccccccccccccccccccCCCccccccccccCcccc
Confidence 111 12346677776666554332211 11223344455421111122233446788899999999
Q ss_pred EccCcceeeeCcccccCccCCCCCCCccEEEEecccccc--cCcccccCCccEEEEecccccccccccccccccccccCc
Q 037371 161 GSSKLEEMKIDSTEEVKKLFRNGFRSLNTVVLRSCRGKD--LTWLVFVQNLKQLNMQGFTMEEIISVDKLSDISEIIGSE 238 (330)
Q Consensus 161 ~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~--l~~l~~l~~L~~L~L~~~~l~~~~~~~~~~~~~~~~~~~ 238 (330)
.++.+..+. ...+++|++|++++|.... ...+.+++.++.|+++++.+..+.+ ..
T Consensus 158 ~~n~l~~l~-----------~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~l~~L~~s~n~l~~~~~------------~~ 214 (305)
T d1xkua_ 158 ADTNITTIP-----------QGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDN------------GS 214 (305)
T ss_dssp CSSCCCSCC-----------SSCCTTCSEEECTTSCCCEECTGGGTTCTTCCEEECCSSCCCEECT------------TT
T ss_pred ccCCccccC-----------cccCCccCEEECCCCcCCCCChhHhhcccccccccccccccccccc------------cc
Confidence 977666442 2346889999999994433 3467889999999999999988865 26
Q ss_pred cccCcccceeecccccccccccCCCCCCCCccEEEEccCCCCCCCCCCCc
Q 037371 239 HNIFARLEYLTMWRGTNVKSVYPNPLPFPKLKKIQVFHCRQLKKLPLNSS 288 (330)
Q Consensus 239 ~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~i~~c~~L~~lp~~~~ 288 (330)
+..+++|++|+++++ .++.++.....+++|++|+++++ +++.++...+
T Consensus 215 ~~~l~~L~~L~L~~N-~L~~lp~~l~~l~~L~~L~Ls~N-~i~~i~~~~f 262 (305)
T d1xkua_ 215 LANTPHLRELHLNNN-KLVKVPGGLADHKYIQVVYLHNN-NISAIGSNDF 262 (305)
T ss_dssp GGGSTTCCEEECCSS-CCSSCCTTTTTCSSCCEEECCSS-CCCCCCTTSS
T ss_pred ccccccceeeecccc-cccccccccccccCCCEEECCCC-ccCccChhhc
Confidence 778899999999999 78888776677999999999995 7988876443
|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|