Citrus Sinensis ID: 037465


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430--
MEMIGEEYFNMLATRSFFQEIEKDCNMHDIVHDFAQFVCRKECLWLEIDGNKESVINFFGGKVRHLGLNFEGGAPLPMSFFEFDRLRSLLIYDESLSNLSLNGSILPELFSKLACLRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLSGLCIKRLPETLCELYNLQKLDIRWCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSLRTLGKFVVGGGVDGSSTCRLESLKNLQLLRECGIEGLGNVSHLDEAERLQLYNQQNLLCLHLEFGRVVDGEDEERRRKKEKDEQLLKALQPPVNVEELWIVYYGGNIFPKWLTSLTNLRNLYLSSCFNCEHLPPLGKLPLEKLTLYNLKSVKRVGNEFLGIEESSEDDPSSSSSSSSELSIEGCPLLENRYREGKGEDWHKISHIPHIQMSPD
cHHHHHHHHHHHHHcccccccccccEEcHHHHHHHHHHHHcEEEEEEEccccccccccccccEEEEEEEEccccccccccccccccEEEEEccccccccccccccHHHHHcccccEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHccccccEEccccccccccccHHHHccccccEEEcccccccccccccccccccccccccEEEccccccccccccccccccccccEEEEccccccccHHHHHHHcccccccccEEEEEEEccccccHHHHHHHHccHHHHHHcccccccccEEEEEEEccccccccHHccccccEEEEEccccccccccccccccccEEEccccccEEEcccccccccccccccccccccccEEccccccccHHHHcccccccccccccccEEEcccc
cHHHHHHHHHHHHHHHHccccccccEHHHHHHHHHHHHccccEEEEEcccccccccccccccEEEEEEEccccccccHHHccccccEEEEEcccccccccccHHHHHHHHHHccccEEEEEccccccccccHHHHHHcccHccccccccEEEccccccccccHHcccccccEEEEEcccccHHccccHHcccccccEEEEcccccHHcccccccccccccEccEEEccccccccccccHHcHccHHHccEEEEcccccccccHHHHHHcccccccccEEEEEcccccccccccccccHHHHHHHHHHccccccccEEEEEccccccccHHHccccccEEEEEccccccccccccccccccEEEEcccccccEccHHHcccccccccccccccccccEEEEcccHHHHHHccccccccccHHccccccccccc
MEMIGEEYFNMLATRSFFQEIEKDCNMHDIVHDFAQFVCRKeclwleidgnkeSVINFFGgkvrhlglnfeggaplpmsfFEFDRLRSLLIYdeslsnlslngsiLPELFSKLACLRALVIsqsssfshpgpnliteipENVGKLIHLKYLNLSGLCIKRLPETLCELYNLQKLDIRWCRNLRELPAGIGKLMNMRSLLndntrslkympigiSKLTSLRTLGkfvvgggvdgsstcRLESLKNLQLLRECgieglgnvshldeAERLQLYNQQNLLClhlefgrvvdgedeerRRKKEKDEQLLKalqppvnveELWIVYYGGNIFPKWLTSLTNLRnlylsscfncehlpplgklplekltlynlksvkrvgneflgieesseddpsssssssselsiegcpllenryregkgedwhkishiphiqmspd
MEMIGEEYFNMLATRSFFQEIEKDCNMHDIVHDFAQFVCRKECLWLEIDGNKESVINFFGGKVRHLGLNFEGGAPLPMSFFEFDRLRSLLIYDESLSNLSLNGSILPELFSKLACLRALVISQsssfshpgpnLITEIPENVGKLIHLKYLNLSGLCIKRLPETLCELYNlqkldirwCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSLRTLGKFVvgggvdgsstcRLESLKNLQLLRECGIEGLGNVSHLDEAERLQLYNQQNLLCLHLEFgrvvdgedeerrrkkekdeqllkalqppvnveELWIVYYGGNIFPKWLTSLTNLRNLYLSSCFNCEHLPPLGKLPLEKLTLYNLKSVKRVGNEFLgieesseddpsssssssselsiegcPLLENRYREGKgedwhkishiphiqmspd
MEMIGEEYFNMLATRSFFQEIEKDCNMHDIVHDFAQFVCRKECLWLEIDGNKESVINFFGGKVRHLGLNFEGGAPLPMSFFEFDRLRSLLIYDEslsnlslngsilPELFSKLACLRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLSGLCIKRLPETLCELYNLQKLDIRWCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSLRTLGKFVVGGGVDGSSTCRLESLKNLQLLRECGIEGLGNVSHLDEAERlqlynqqnllclhlEFgrvvdgedeerrrkkekdeQLLKALQPPVNVEELWIVYYGGNIFPKWLTSLTNLRNLYLSSCFNCEHlpplgklplekltlYNLKSVKRVGNEFLGieesseddpsssssssselsieGCPLLENRYREGKGEDWHKISHIPHIQMSPD
*****EEYFNMLATRSFFQEIEKDCNMHDIVHDFAQFVCRKECLWLEIDGNKESVINFFGGKVRHLGLNFEGGAPLPMSFFEFDRLRSLLIYDESLSNLSLNGSILPELFSKLACLRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLSGLCIKRLPETLCELYNLQKLDIRWCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSLRTLGKFVVGGGVDGSSTCRLESLKNLQLLRECGIEGLGNVSHLDEAERLQLYNQQNLLCLHLEFGRVV********************LQPPVNVEELWIVYYGGNIFPKWLTSLTNLRNLYLSSCFNCEHLPPLGKLPLEKLTLYNLKSVKRVGNEFLG*****************************************************
MEMIGEEYFNMLATRSFFQEIEKDCNMHDIVHDFAQFVCRKECLWLEIDGNK****NFFGGKVRHLGLNFEGGAPLPMSFFEFDRLRSLLIYDESLSNLSLNGSILPELFSKLACLRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLSGLCIKRLPETLCELYNLQKLDIRWCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSLRTLGKFVVGGGVDGSSTCRLESLKNLQLLRECGIEGLGNVSHLDEAERLQLYNQQNLLCLHLEFGRVVD***********KDEQLLKALQPPVNVEELWIVYYGGNIFPKWLTSLTNLRNLYLSSCFNCEHLPPLGKLPLEKLTLYNLKSVKRVGNEFLGIEES*******SSSSSSELSIEGCPLLENRYREGKGEDWHKISHIPHIQMSP*
MEMIGEEYFNMLATRSFFQEIEKDCNMHDIVHDFAQFVCRKECLWLEIDGNKESVINFFGGKVRHLGLNFEGGAPLPMSFFEFDRLRSLLIYDESLSNLSLNGSILPELFSKLACLRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLSGLCIKRLPETLCELYNLQKLDIRWCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSLRTLGKFVVGGGVDGSSTCRLESLKNLQLLRECGIEGLGNVSHLDEAERLQLYNQQNLLCLHLEFGRVVD**************QLLKALQPPVNVEELWIVYYGGNIFPKWLTSLTNLRNLYLSSCFNCEHLPPLGKLPLEKLTLYNLKSVKRVGNEFLGI********************EGCPLLENRYREGKGEDWHKISHIPHIQMSPD
MEMIGEEYFNMLATRSFFQEIEKDCNMHDIVHDFAQFVCRKECLWLEIDGNKESVINFFGGKVRHLGLNFEGGAPLPMSFFEFDRLRSLLIYDESLSNLSLNGSILPELFSKLACLRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLSGLCIKRLPETLCELYNLQKLDIRWCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSLRTLGKFVVGGGVDGSSTCRLESLKNLQLLRECGIEGLGNVSHLDEAERLQLYNQQNLLCLHLEFGRVVDGEDEERRRKKEKDEQLLKALQPPVNVEELWIVYYGGNIFPKWLTSLTNLRNLYLSSCFNCEHLPPLGKLPLEKLTLYNLKSVKRVGNEFLGIEESSEDDPSSSSSSSSELSIEGCPLLENRYREGKGEDWHKISHIPHIQM***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEMIGEEYFNMLATRSFFQEIEKDCNMHDIVHDFAQFVCRKECLWLEIDGNKESVINFFGGKVRHLGLNFEGGAPLPMSFFEFDRLRSLLIYDESLSNLSLNGSILPELFSKLACLRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLSGLCIKRLPETLCELYNLQKLDIRWCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSLRTLGKFVVGGGVDGSSTCRLESLKNLQLLRECGIEGLGNVSHLDEAERLQLYNQQNLLCLHLEFGRVVDGEDEERRRKKEKDEQLLKALQPPVNVEELWIVYYGGNIFPKWLTSLTNLRNLYLSSCFNCEHLPPLGKLPLEKLTLYNLKSVKRVGNEFLGIEESSEDDPSSSSSSSSELSIEGCPLLENRYREGKGEDWHKISHIPHIQMSPD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query432 2.2.26 [Sep-21-2011]
Q7XA42 979 Putative disease resistan N/A no 0.710 0.313 0.323 6e-33
Q9LRR5 1424 Putative disease resistan yes no 0.858 0.260 0.326 1e-32
Q7XA39 988 Putative disease resistan N/A no 0.715 0.312 0.321 1e-31
Q7XA40 992 Putative disease resistan N/A no 0.740 0.322 0.326 2e-31
Q7XBQ9 970 Disease resistance protei N/A no 0.715 0.318 0.313 2e-29
Q9LRR4 1054 Putative disease resistan no no 0.828 0.339 0.294 4e-28
Q38834852 Disease resistance RPP13- no no 0.701 0.355 0.286 1e-15
Q7SXW3 601 Leucine-rich repeat-conta yes no 0.298 0.214 0.306 1e-07
Q9C646899 Probable disease resistan no no 0.476 0.229 0.270 6e-07
Q7KRY7 1851 Protein lap4 OS=Drosophil yes no 0.398 0.092 0.271 8e-07
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function desciption
 Score =  142 bits (357), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 122/377 (32%), Positives = 178/377 (47%), Gaps = 70/377 (18%)

Query: 1   MEMIGEEYFNMLATRSFFQEIEKDC-----NMHDIVHDFAQFVCRKECLWLEIDGNKESV 55
           +E +G E +N L  RSFFQEIE +       MHD++HD A  +            N  S 
Sbjct: 441 LEDVGNEVWNELYLRSFFQEIEVESGKTYFKMHDLIHDLATSL---------FSANTSS- 490

Query: 56  INFFGGKVRHLGLNFEGGAPLPMSFFEFDRLRSLLIYDESLSNLSLNGSILPELFSKLAC 115
                  +R +  N++G                   Y  S+    +  S  P L  K   
Sbjct: 491 -----SNIREINANYDG-------------------YMMSIGFAEVVSSYSPSLLQKFVS 526

Query: 116 LRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLSG-LCIKRLPETLCELYNLQKL 174
           LR L +  S+         + ++P ++G L+HL+YL+LSG   I+ LP+ LC+L NLQ L
Sbjct: 527 LRVLNLRNSN---------LNQLPSSIGDLVHLRYLDLSGNFRIRNLPKRLCKLQNLQTL 577

Query: 175 DIRWCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSLRTLGKFVVGGGVDGS 234
           D+ +C +L  LP    KL ++R+LL D   SL   P  I  LT L++L  FV+G      
Sbjct: 578 DLHYCDSLSCLPKQTSKLGSLRNLLLDGC-SLTSTPPRIGLLTCLKSLSCFVIG----KR 632

Query: 235 STCRLESLKNLQLLRECGIEGLGNVSHLDEAERLQLYNQQNL--LCLHLEFGRVVDGEDE 292
              +L  LKNL L     I  L  V    +A+   L  + NL  LCL  +    +DG   
Sbjct: 633 KGHQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWD----LDG--- 685

Query: 293 ERRRKKEKDEQLLKALQPPVNVEELWIVYYGGNIFPKWL--TSLTNLRNLYLSSCFNCEH 350
               K   D ++L+AL+P  N++ L I  +GG   P W+  + L N+ ++ +  C NC  
Sbjct: 686 ----KHRYDSEVLEALKPHSNLKYLEINGFGGIRLPDWMNQSVLKNVVSIRIRGCENCSC 741

Query: 351 LPPLGKLP-LEKLTLYN 366
           LPP G+LP LE L L+ 
Sbjct: 742 LPPFGELPCLESLELHT 758




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q9C646|RX24L_ARATH Probable disease resistance protein RXW24L OS=Arabidopsis thaliana GN=RXW24L PE=2 SV=1 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query432
359482769 904 PREDICTED: putative disease resistance p 0.923 0.441 0.382 1e-71
147825450 927 hypothetical protein VITISV_000086 [Viti 0.937 0.436 0.387 7e-71
359482790 923 PREDICTED: putative disease resistance p 0.932 0.436 0.378 4e-70
359482792 922 PREDICTED: putative disease resistance p 0.921 0.431 0.389 5e-70
224122696 906 cc-nbs-lrr resistance protein [Populus t 0.930 0.443 0.379 8e-70
359482788 903 PREDICTED: putative disease resistance p 0.939 0.449 0.378 9e-70
359482784 919 PREDICTED: putative disease resistance p 0.918 0.431 0.380 4e-67
224122712 945 cc-nbs-lrr resistance protein [Populus t 0.921 0.421 0.378 1e-66
147855898 1295 hypothetical protein VITISV_034885 [Viti 0.800 0.267 0.426 5e-66
359482794 880 PREDICTED: putative disease resistance p 0.817 0.401 0.418 8e-65
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  276 bits (706), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 186/486 (38%), Positives = 258/486 (53%), Gaps = 87/486 (17%)

Query: 1   MEMIGEEYFNMLATRSFFQEIEKD-------CNMHDIVHDFAQFVCRKECLWLEIDGNKE 53
           MEM+G  YF  LA RSFFQ+ EKD       C MHDIVHDFAQF+ + EC  +E+D  K+
Sbjct: 444 MEMVGRTYFEYLAARSFFQDFEKDTDGNIIRCEMHDIVHDFAQFLTQNECFIVEVDNQKK 503

Query: 54  SVINFFGGKVRHLGLNFEGGAPLPMSFFEFDRLRSLLIYDESLSNLSLNGSILPELFSKL 113
             ++ F  K+RH  L      P   S      L +LL  +      + +  +L E    L
Sbjct: 504 GSMDLFFQKIRHATLVVRESTPNFASTCNMKNLHTLLAKE------AFDSRVL-EALGNL 556

Query: 114 ACLRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLSGL-CIKRLPETLCELYNLQ 172
            CLRAL +S +        + I E+P+ VGKLIHL+YLNLS    ++ LPET+C+LYNLQ
Sbjct: 557 TCLRALDLSSN--------DWIEELPKEVGKLIHLRYLNLSWCESLRELPETICDLYNLQ 608

Query: 173 KLDIRWCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSLRTLGKFVVGGGVD 232
            L+I  C +L++LP  +GKL+N+R L N  TRSLK +P GI +L+SL+TL  F+V     
Sbjct: 609 TLNIEGCSSLQKLPHAMGKLINLRHLEN-YTRSLKGLPKGIGRLSSLQTLDVFIVSS--H 665

Query: 233 GSSTCRLESLKNLQLLR-ECGIEGLGNVSHLDEAERLQLYNQQNLLCLHLEFGRVVDGED 291
           G+  C++  L+NL  LR    +EGL  V    E E+ +L N+ +   L LEFG       
Sbjct: 666 GNDECQIGDLRNLNNLRGRLSVEGLDEVKDAGEPEKAELKNRVHFQYLTLEFG------- 718

Query: 292 EERRRKKEKDEQLLKALQPPVNVEELWIVYYGGNIFPKWL--TSLTNLRNLYLSSCFNCE 349
                +KE  + + +ALQP  N++ L IV YG   +P W+  +SL  L+ L+L  C  C 
Sbjct: 719 -----EKEGTKGVAEALQPHPNLKSLGIVDYGDREWPNWMMGSSLAQLKILHLWFCKRCP 773

Query: 350 HLPPLGKLP-LEKLTLYNLKSVKRVGNEFLG------------------------IEESS 384
            LPPLG+LP LEKL ++ +  VK +G+EFLG                        I+E  
Sbjct: 774 CLPPLGQLPVLEKLYIWGMDGVKYIGSEFLGSSSTVFPKLKELAISGLVELKQWEIKEKE 833

Query: 385 ED---------------------DPSSSSSSSSELSIEGCPLLENRYREGKGEDWHKISH 423
           E                      D     +   +L I G P+L+ RYR+  GED HKISH
Sbjct: 834 ERSIMPCLNHLIMRGCPKLEGLPDHVLQRTPLQKLDIAGSPILKRRYRKDIGEDRHKISH 893

Query: 424 IPHIQM 429
           IP +++
Sbjct: 894 IPEVEV 899




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147825450|emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482792|ref|XP_002268589.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224122696|ref|XP_002318903.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859576|gb|EEE97123.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482788|ref|XP_003632840.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224122712|ref|XP_002318907.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859580|gb|EEE97127.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147855898|emb|CAN78626.1| hypothetical protein VITISV_034885 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482794|ref|XP_002268547.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query432
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.766 0.232 0.299 3.9e-23
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.773 0.316 0.275 1.6e-21
TAIR|locus:2078012852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.710 0.360 0.263 7.2e-11
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.282 0.102 0.338 5.3e-08
TAIR|locus:2163578771 AT5G45500 "AT5G45500" [Arabido 0.270 0.151 0.347 8.5e-08
UNIPROTKB|D6RGK9163 CNOT6L "CCR4-NOT transcription 0.201 0.533 0.325 1.4e-07
TAIR|locus:2205824 1384 AT1G27170 [Arabidopsis thalian 0.199 0.062 0.409 2.3e-07
ZFIN|ZDB-GENE-071004-97 558 zgc:171797 "zgc:171797" [Danio 0.201 0.155 0.348 4.1e-07
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.238 0.066 0.348 4.7e-07
ZFIN|ZDB-GENE-030131-6062 601 lrrc40 "leucine rich repeat co 0.212 0.153 0.351 5.9e-07
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 281 (104.0 bits), Expect = 3.9e-23, P = 3.9e-23
 Identities = 107/357 (29%), Positives = 163/357 (45%)

Query:     1 MEMIGEEYFNMLATRSFFQEIEKDCN---MHDIVHDFAQFVCRKECLWLEIDGNKESVIN 57
             +E IG +Y   L  +SFFQ ++       MHD+++D A+ V    C  LE D   E    
Sbjct:   458 LEDIGNDYLGDLVAQSFFQRLDITMTSFVMHDLMNDLAKAVSGDFCFRLEDDNIPE---- 513

Query:    58 FFGGKVRHLGLN-FEGGAPLPM-SFFEFDRLRSLLIYDEXXXXXXXXXXXXPELFSKLAC 115
                   RH   +  +  A +   S    + LR++L ++              ++ + L  
Sbjct:   514 -IPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILPFNSPTSLESLQLTE--KVLNPL-- 568

Query:   116 LRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLSGLCIKRLPETLCELYNLQKLD 175
             L AL   +  S SH     IT +P+++  L  L+YL+LS   IK LPE +C L NLQ L 
Sbjct:   569 LNALSGLRILSLSH---YQITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLL 625

Query:   176 IRWCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSLRTLGKFVVGGGVDGSS 235
             +  CR+L  LP  I +L+N+R LL+     L  MP GI KL SL+ L  FV+G  + G+ 
Sbjct:   626 LSNCRDLTSLPKSIAELINLR-LLDLVGTPLVEMPPGIKKLRSLQKLSNFVIGR-LSGAG 683

Query:   236 TCRLESLKNLQ-LLRECGIEGLGNVSHLDEAERXXXXXXXXXXXXXXEFXXXXXXXXXXX 294
                L+ L +L+  LR   I  L NV+   EA+               ++           
Sbjct:   684 LHELKELSHLRGTLR---ISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGS 740

Query:   295 XXXXX-XXXQLLKALQPPVNVEELWIVYYGGNIFPKWL--TSLTNLRNLYLSSCFNC 348
                      ++L+ L+P  +++   I  Y G  FPKWL  +S   + ++ LSSC  C
Sbjct:   741 FNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLC 797




GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163578 AT5G45500 "AT5G45500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|D6RGK9 CNOT6L "CCR4-NOT transcription complex subunit 6-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-97 zgc:171797 "zgc:171797" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6062 lrrc40 "leucine rich repeat containing 40" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query432
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 43.3 bits (102), Expect = 2e-04
 Identities = 59/223 (26%), Positives = 108/223 (48%), Gaps = 32/223 (14%)

Query: 43  CLWLEIDGNKESVINFFGGKVRHLGLNFEGGAPLPMSFFEFDRLRSLLIYDESLSNLSLN 102
           CLW  I  N  S +      +   G N  G   +  + F    ++++     +LSN  L+
Sbjct: 58  CLWQGITCNNSSRVV----SIDLSGKNISG--KISSAIFRLPYIQTI-----NLSNNQLS 106

Query: 103 GSILPELFSKLACLRALVISQSSSFSHPGP--------------NLIT-EIPENVGKLIH 147
           G I  ++F+  + LR L +S +++F+   P              N+++ EIP ++G    
Sbjct: 107 GPIPDDIFTTSSSLRYLNLS-NNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSS 165

Query: 148 LKYLNLSG-LCIKRLPETLCELYNLQKLDIRWCRNLRELPAGIGKLMNMRSL-LNDNTRS 205
           LK L+L G + + ++P +L  L +L+ L +   + + ++P  +G++ +++ + L  N  S
Sbjct: 166 LKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLS 225

Query: 206 LKYMPIGISKLTSLRTLGKFVVGGGVDGSSTCRLESLKNLQLL 248
            + +P  I  LTSL  L   +V   + G     L +LKNLQ L
Sbjct: 226 GE-IPYEIGGLTSLNHLD--LVYNNLTGPIPSSLGNLKNLQYL 265


Length = 968

>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 432
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.96
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.74
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.71
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.71
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.58
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.5
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.48
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.46
KOG4237498 consensus Extracellular matrix protein slit, conta 99.41
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.41
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.35
KOG4237498 consensus Extracellular matrix protein slit, conta 99.28
KOG4341483 consensus F-box protein containing LRR [General fu 99.09
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.06
KOG4341483 consensus F-box protein containing LRR [General fu 99.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.97
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.96
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.93
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.91
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.84
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.8
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.76
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.69
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
PLN03150623 hypothetical protein; Provisional 98.59
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.58
PLN03150623 hypothetical protein; Provisional 98.52
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.51
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.41
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.38
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.27
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.23
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.22
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.11
PRK15386426 type III secretion protein GogB; Provisional 98.08
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.98
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.93
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.92
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.89
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.81
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.8
PRK15386426 type III secretion protein GogB; Provisional 97.72
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.71
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.65
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.47
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.18
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.12
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.1
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.06
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.02
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.0
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.2
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.12
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.68
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.48
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.43
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.1
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.2
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.97
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.94
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.19
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 89.91
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.49
smart0037026 LRR Leucine-rich repeats, outliers. 89.49
KOG4308478 consensus LRR-containing protein [Function unknown 87.39
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.59
KOG4308478 consensus LRR-containing protein [Function unknown 83.85
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.96  E-value=7.7e-28  Score=260.15  Aligned_cols=378  Identities=22%  Similarity=0.237  Sum_probs=248.8

Q ss_pred             HHHHHHhCCCCccccCCeeecHHHHHHHHHhhccce--------EEeecCCCccceecccCCceEEEEeecCCCCC---C
Q 037465            8 YFNMLATRSFFQEIEKDCNMHDIVHDFAQFVCRKEC--------LWLEIDGNKESVINFFGGKVRHLGLNFEGGAP---L   76 (432)
Q Consensus         8 ~~~~L~~~~li~~~~~~~~mhdl~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~i~~L~l~~~~~~~---~   76 (432)
                      -++.|++++||+.....+.|||++++||+++++++.        .|...+.......+.+..+++.+.+....+.+   -
T Consensus       471 ~l~~L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~  550 (1153)
T PLN03210        471 GLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQSNEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIH  550 (1153)
T ss_pred             ChHHHHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhcCCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeec
Confidence            478999999999877679999999999999998753        22222111222334456778888877665544   2


Q ss_pred             CccccccCcccEEEEecCCcCc-cCccCCcchhhhccC-CcceEEEeCCCCCCCCCCCCcccccCccccCCccccEEEeC
Q 037465           77 PMSFFEFDRLRSLLIYDESLSN-LSLNGSILPELFSKL-ACLRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLS  154 (432)
Q Consensus        77 ~~~~~~~~~L~~L~l~~~~~~~-~~~~~~~~~~~~~~l-~~L~~L~L~~~~~~~~~~~~~~~~lp~~~~~l~~L~~L~L~  154 (432)
                      +.+|..|++|+.|.+..+.... ...... ++..+..+ ++||.|++.+         +.++.+|..+ ...+|+.|+++
T Consensus       551 ~~aF~~m~~L~~L~~~~~~~~~~~~~~~~-lp~~~~~lp~~Lr~L~~~~---------~~l~~lP~~f-~~~~L~~L~L~  619 (1153)
T PLN03210        551 ENAFKGMRNLLFLKFYTKKWDQKKEVRWH-LPEGFDYLPPKLRLLRWDK---------YPLRCMPSNF-RPENLVKLQMQ  619 (1153)
T ss_pred             HHHHhcCccccEEEEecccccccccceee-cCcchhhcCcccEEEEecC---------CCCCCCCCcC-CccCCcEEECc
Confidence            4578899999999997663211 011222 23334444 4588888888         6778888766 46788888888


Q ss_pred             CccccccchhhhccCCccEEecccccccccCChhhhcccccceEEcCCCCccccCCccCCcccccccccceEecccccCC
Q 037465          155 GLCIKRLPETLCELYNLQKLDIRWCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSLRTLGKFVVGGGVDGS  234 (432)
Q Consensus       155 ~~~l~~lp~~i~~l~~L~~L~l~~~~~~~~lp~~i~~l~~L~~L~l~~~~~~~~~p~~l~~l~~L~~L~l~~~~~~~~~~  234 (432)
                      ++.+..+|..+..+++|+.|+++++..+..+| .++.+++|+.|++++|.....+|..++.+++|+.|++.+|....   
T Consensus       620 ~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip-~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~---  695 (1153)
T PLN03210        620 GSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIP-DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLE---  695 (1153)
T ss_pred             CccccccccccccCCCCCEEECCCCCCcCcCC-ccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcC---
Confidence            88888888778888888888888877677777 47778888888888887788888888888888888887765442   


Q ss_pred             CCcCccccccCccCCceeeCCCCCCCCchhhhhcccccccCCceEEEeeccccCCchHHH-------hhhhhhhHhhhh-
Q 037465          235 STCRLESLKNLQLLRECGIEGLGNVSHLDEAERLQLYNQQNLLCLHLEFGRVVDGEDEER-------RRKKEKDEQLLK-  306 (432)
Q Consensus       235 ~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~-------~~~~~~~~~~~~-  306 (432)
                        ..+.. .++++|+.|.+++|..+...+.       ..++|+.|+++++.+..-+....       .........+.. 
T Consensus       696 --~Lp~~-i~l~sL~~L~Lsgc~~L~~~p~-------~~~nL~~L~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~~l~~~  765 (1153)
T PLN03210        696 --ILPTG-INLKSLYRLNLSGCSRLKSFPD-------ISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWER  765 (1153)
T ss_pred             --ccCCc-CCCCCCCEEeCCCCCCcccccc-------ccCCcCeeecCCCccccccccccccccccccccccchhhcccc
Confidence              12222 2567777888877765443221       12355555555554221110000       000000000000 


Q ss_pred             -------cCCCCCCCcEEEEeeeCC-CCCChhhhccCCCcEEEEeCCCCCCCCCCCCCcc-cceEeccccccccccCccc
Q 037465          307 -------ALQPPVNVEELWIVYYGG-NIFPKWLTSLTNLRNLYLSSCFNCEHLPPLGKLP-LEKLTLYNLKSVKRVGNEF  377 (432)
Q Consensus       307 -------~l~~~~~L~~L~l~~~~~-~~~~~~l~~l~~L~~L~l~~~~~~~~l~~~~~l~-L~~L~l~~c~~l~~~~~~~  377 (432)
                             ....+++|+.|++++|.. ..+|.++.++++|+.|++++|..++.+|....++ |+.|++++|..++.+|...
T Consensus       766 ~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~~L~sL~~L~Ls~c~~L~~~p~~~  845 (1153)
T PLN03210        766 VQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLRTFPDIS  845 (1153)
T ss_pred             ccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCCCccccCEEECCCCCccccccccc
Confidence                   112246888899988754 4478888899999999999998888888655788 9999999998887765421


Q ss_pred             cCC-------CCCCCCCCC--CCCCCcceEEEeCCcccccccc
Q 037465          378 LGI-------EESSEDDPS--SSSSSSSELSIEGCPLLENRYR  411 (432)
Q Consensus       378 ~~~-------~~~~~~~~~--~~~~~L~~L~i~~cp~L~~~~~  411 (432)
                      ...       .....+ |.  +.+++|+.|++++|++|+.+..
T Consensus       846 ~nL~~L~Ls~n~i~~i-P~si~~l~~L~~L~L~~C~~L~~l~~  887 (1153)
T PLN03210        846 TNISDLNLSRTGIEEV-PWWIEKFSNLSFLDMNGCNNLQRVSL  887 (1153)
T ss_pred             cccCEeECCCCCCccC-hHHHhcCCCCCEEECCCCCCcCccCc
Confidence            100       000001 21  4577888888888888887643



syringae 6; Provisional

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query432
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-04
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 4e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-05
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 86.9 bits (216), Expect = 4e-19
 Identities = 39/150 (26%), Positives = 63/150 (42%), Gaps = 12/150 (8%)

Query: 76  LPMSFFEFDRLRSLLIYDES-LSNL--SLNGSILPELFSKLACLRALVISQSSSFSHPGP 132
           LP S    +RLR L I     L+ L   L  +        L  L++L +           
Sbjct: 142 LPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEW--------- 192

Query: 133 NLITEIPENVGKLIHLKYLNLSGLCIKRLPETLCELYNLQKLDIRWCRNLRELPAGIGKL 192
             I  +P ++  L +LK L +    +  L   +  L  L++LD+R C  LR  P   G  
Sbjct: 193 TGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGR 252

Query: 193 MNMRSLLNDNTRSLKYMPIGISKLTSLRTL 222
             ++ L+  +  +L  +P+ I +LT L  L
Sbjct: 253 APLKRLILKDCSNLLTLPLDIHRLTQLEKL 282


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query432
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.92
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.85
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.85
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.84
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.82
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.82
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.81
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.81
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.79
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.79
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.76
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.73
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.73
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.72
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.71
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.68
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.67
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.66
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.64
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.64
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.64
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.62
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.62
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.6
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.59
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.57
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.56
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.56
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.53
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.51
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.51
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.51
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.49
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.46
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.44
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.44
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.42
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.41
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.39
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.39
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.32
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.32
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.28
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.24
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.24
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.13
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.12
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.0
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.0
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.93
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.91
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.73
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.73
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.67
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.64
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.53
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.48
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.44
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.44
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.23
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.19
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.1
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.09
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.99
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.87
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.83
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.77
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 96.41
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.82
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.42
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.13
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.06
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 89.4
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.96  E-value=1.2e-28  Score=257.73  Aligned_cols=132  Identities=15%  Similarity=0.114  Sum_probs=71.0

Q ss_pred             cccccCCceEEEeeccccCCchHHHhhhhhhhHhhhhcCCCCCCCcEEEEeeeCCC-CCChhhhccCCCcEEEEeCCCCC
Q 037465          270 LYNQQNLLCLHLEFGRVVDGEDEERRRKKEKDEQLLKALQPPVNVEELWIVYYGGN-IFPKWLTSLTNLRNLYLSSCFNC  348 (432)
Q Consensus       270 l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~-~~~~~l~~l~~L~~L~l~~~~~~  348 (432)
                      +..+++|+.|++++|.              ..+.++..++.++.|+.|++++|... .+|..++.+++|+.|++++|...
T Consensus       628 ~~~l~~L~~LdLs~N~--------------l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~  693 (768)
T 3rgz_A          628 FDNNGSMMFLDMSYNM--------------LSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLD  693 (768)
T ss_dssp             CSSSBCCCEEECCSSC--------------CBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCE
T ss_pred             hhccccccEEECcCCc--------------ccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCccc
Confidence            3445666666666666              33445555666667777777666665 45666667777777777777665


Q ss_pred             CCCC-CCCCcc-cceEeccccccccccCccccCCCCCCCCCCCCCCCCcceEEEeCCcccc----ccccCCCCCCccccc
Q 037465          349 EHLP-PLGKLP-LEKLTLYNLKSVKRVGNEFLGIEESSEDDPSSSSSSSSELSIEGCPLLE----NRYREGKGEDWHKIS  422 (432)
Q Consensus       349 ~~l~-~~~~l~-L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~i~~cp~L~----~~~~~~~~~~~~~~~  422 (432)
                      +.+| .++.++ |++|++++|+--..+|..             +.|.++....+.|||.|-    ..|....+++|++++
T Consensus       694 g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~-------------~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~  760 (768)
T 3rgz_A          694 GRIPQAMSALTMLTEIDLSNNNLSGPIPEM-------------GQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQ  760 (768)
T ss_dssp             ECCCGGGGGCCCCSEEECCSSEEEEECCSS-------------SSGGGSCGGGGCSCTEEESTTSCCCCSCC--------
T ss_pred             CcCChHHhCCCCCCEEECcCCcccccCCCc-------------hhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCC
Confidence            5555 356666 777777776643444432             124455555556665543    258888999999999


Q ss_pred             CCCCcc
Q 037465          423 HIPHIQ  428 (432)
Q Consensus       423 ~~~~~~  428 (432)
                      |+|++.
T Consensus       761 ~~~~~~  766 (768)
T 3rgz_A          761 RSHHHH  766 (768)
T ss_dssp             ------
T ss_pred             CccccC
Confidence            999864



>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 432
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.1 bits (92), Expect = 3e-04
 Identities = 17/117 (14%), Positives = 38/117 (32%), Gaps = 13/117 (11%)

Query: 96  LSNLSLNGSILPELFSKLACLRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLSG 155
           L+  +L+  +   L S+   + A    +         + + +          +++++LS 
Sbjct: 7   LTGKNLHPDVTGRLLSQG--VIAFRCPR---------SFMDQPLAEHFSPFRVQHMDLSN 55

Query: 156 LCIKR--LPETLCELYNLQKLDIRWCRNLRELPAGIGKLMNMRSLLNDNTRSLKYMP 210
             I+   L   L +   LQ L +   R    +   + K  N+  L            
Sbjct: 56  SVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFA 112


>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query432
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.69
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.67
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.67
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.61
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.52
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.52
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.32
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.24
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.2
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.12
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.06
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.98
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.95
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.9
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.99
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.53
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.3
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.13
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.74
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.87  E-value=1.5e-22  Score=186.83  Aligned_cols=235  Identities=22%  Similarity=0.235  Sum_probs=135.8

Q ss_pred             hhhhccCCcceEEEeCCCCCCCCCCCCcccccCccccCCccccEEEeCCcccccc-chhhhccCCccEEecccccccccC
Q 037465          107 PELFSKLACLRALVISQSSSFSHPGPNLITEIPENVGKLIHLKYLNLSGLCIKRL-PETLCELYNLQKLDIRWCRNLREL  185 (432)
Q Consensus       107 ~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~~lp~~~~~l~~L~~L~L~~~~l~~l-p~~i~~l~~L~~L~l~~~~~~~~l  185 (432)
                      |+.+..+++|++|++++|.       ...+.+|..|+++++|++|++++|.+..+ +..+..+.+|+++++++|.....+
T Consensus        69 p~~l~~L~~L~~L~Ls~~N-------~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~  141 (313)
T d1ogqa_          69 PSSLANLPYLNFLYIGGIN-------NLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTL  141 (313)
T ss_dssp             CGGGGGCTTCSEEEEEEET-------TEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCC
T ss_pred             ChHHhcCcccccccccccc-------ccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccC
Confidence            3345555555555555420       22234555555555555555555554433 233555555555555555544555


Q ss_pred             ChhhhcccccceEEcCCCCccccCCccCCccccc-ccccceEecccccCCCCcCccccccCccCCceeeCCCCCCCCchh
Q 037465          186 PAGIGKLMNMRSLLNDNTRSLKYMPIGISKLTSL-RTLGKFVVGGGVDGSSTCRLESLKNLQLLRECGIEGLGNVSHLDE  264 (432)
Q Consensus       186 p~~i~~l~~L~~L~l~~~~~~~~~p~~l~~l~~L-~~L~l~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~  264 (432)
                      |..++.++.++.+++++|...+.+|..+..+.++ +.+.+..+...     ...+..+..+.. ..+++...    ....
T Consensus       142 p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~-----~~~~~~~~~l~~-~~l~l~~~----~~~~  211 (313)
T d1ogqa_         142 PPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLT-----GKIPPTFANLNL-AFVDLSRN----MLEG  211 (313)
T ss_dssp             CGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEE-----EECCGGGGGCCC-SEEECCSS----EEEE
T ss_pred             chhhccCcccceeecccccccccccccccccccccccccccccccc-----cccccccccccc-cccccccc----cccc
Confidence            5555555555555555555544555555444443 33444333322     112223333322 12333331    1111


Q ss_pred             hhhcccccccCCceEEEeeccccCCchHHHhhhhhhhHhhhhcCCCCCCCcEEEEeeeCCC-CCChhhhccCCCcEEEEe
Q 037465          265 AERLQLYNQQNLLCLHLEFGRVVDGEDEERRRKKEKDEQLLKALQPPVNVEELWIVYYGGN-IFPKWLTSLTNLRNLYLS  343 (432)
Q Consensus       265 ~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~-~~~~~l~~l~~L~~L~l~  343 (432)
                      ..+..+..+++++.+++.++.+              .. .+..+..+++|+.|++++|... .+|.++..+++|++|+|+
T Consensus       212 ~~~~~~~~~~~l~~l~~~~~~l--------------~~-~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls  276 (313)
T d1ogqa_         212 DASVLFGSDKNTQKIHLAKNSL--------------AF-DLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVS  276 (313)
T ss_dssp             CCGGGCCTTSCCSEEECCSSEE--------------CC-BGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECC
T ss_pred             cccccccccccccccccccccc--------------cc-cccccccccccccccCccCeecccCChHHhCCCCCCEEECc
Confidence            2234455667777777777662              12 2234666788888888888776 679999999999999999


Q ss_pred             CCCCCCCCCCCCCcc-cceEecccccccccc
Q 037465          344 SCFNCEHLPPLGKLP-LEKLTLYNLKSVKRV  373 (432)
Q Consensus       344 ~~~~~~~l~~~~~l~-L~~L~l~~c~~l~~~  373 (432)
                      +|...+.+|.++++. |+.+++.+|+.+...
T Consensus       277 ~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~  307 (313)
T d1ogqa_         277 FNNLCGEIPQGGNLQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             SSEEEEECCCSTTGGGSCGGGTCSSSEEEST
T ss_pred             CCcccccCCCcccCCCCCHHHhCCCccccCC
Confidence            997777889888899 999999998866554



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure